Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL079C1166114561410.0
Sklu_2193.11143116344490.0
YIL048W (NEO1)1151116041730.0
Scas_704.381161112841490.0
Kwal_23.57891133115441010.0
KLLA0C08393g1148115940990.0
CAGL0L00715g1144111439950.0
Scas_89.127125711851e-154
KLLA0A04015g1343100611901e-142
YAL026C (DRS2)135594111501e-136
CAGL0G06270g1328104711431e-135
Kwal_26.7070131595311411e-135
ADR350W131187710721e-125
YER166W (DNF1)15719869251e-104
CAGL0L11814g15769659031e-101
Scas_576.815919329001e-101
YDR093W (DNF2)16129558822e-98
AGR120C15479878793e-98
CAGL0G08085g15788988732e-97
Scas_636.1615549428671e-96
KLLA0C17644g15768898662e-96
CAGL0H04477g16263655472e-56
KLLA0E01650g15503695434e-56
Kwal_23.355615973655401e-55
YMR162C (DNF3)16563945321e-54
AFL191W15753645185e-53
Scas_669.316383954972e-50
Scas_505.410252983639e-35
Scas_665.3014398012818e-25
AFR567W14497892738e-24
KLLA0B08217g14397912728e-24
Kwal_26.920714696712584e-22
CAGL0A00517g11229452413e-20
YOR291W14726332352e-19
Kwal_23.316011007252342e-19
KLLA0E14630g10825552315e-19
AFL011W12427302272e-18
Kwal_14.14989398032262e-18
YDR038C (ENA5)10916042235e-18
YDR039C (ENA2)10916042225e-18
YDR040C (ENA1)10916042217e-18
KLLA0F20658g10825022182e-17
CAGL0I04312g9517662182e-17
CAGL0M11308g14526342164e-17
YGL167C (PMR1)9507622048e-16
CAGL0K12034g10878302021e-15
Kwal_47.1754712408072022e-15
KLLA0A08910g12807132003e-15
Scas_707.48*7416741958e-15
AGL097C10965941922e-14
AEL301W9576751878e-14
KLLA0A03157g9386811796e-13
CAGL0J01870g9467471662e-11
YGL006W (PMC1)11734701663e-11
CAGL0L01419g12146811351e-07
AFR354C12106961323e-07
YPL036W (PMA2)9475281181e-05
AGL085C9093161152e-05
Scas_583.14*8752951134e-05
Scas_688.19133241109e-05
KLLA0A09031g8994191091e-04
YGL008C (PMA1)9184191091e-04
YEL031W (SPF1)12154241072e-04
Kwal_47.175228994191063e-04
KLLA0E22352g12064331053e-04
CAGL0A00495g902279980.003
Scas_710.41904300960.005
Scas_227.0d30782860.038
KLLA0F07447g975117860.065
KLLA0D04092g115241820.21
Scas_297.180074800.32
AGL041C123380800.32
Scas_569.0d468116790.35
Sklu_2437.572170770.72
Scas_716.3756091751.2
Scas_615.994276741.7
CAGL0M08602g101288722.7
Scas_678.1929845694.9
Kwal_55.21575989132705.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL079C
         (1145 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...  2370   0.0  
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement        1718   0.0  
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...  1612   0.0  
Scas_704.38                                                          1602   0.0  
Kwal_23.5789                                                         1584   0.0  
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...  1583   0.0  
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...  1543   0.0  
Scas_89.1                                                             461   e-154
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...   462   e-142
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...   447   e-136
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...   444   e-135
Kwal_26.7070                                                          444   e-135
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...   417   e-125
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...   360   e-104
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...   352   e-101
Scas_576.8                                                            351   e-101
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...   344   2e-98
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...   343   3e-98
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...   340   2e-97
Scas_636.16                                                           338   1e-96
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...   338   2e-96
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...   215   2e-56
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...   213   4e-56
Kwal_23.3556                                                          212   1e-55
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...   209   1e-54
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...   204   5e-53
Scas_669.3                                                            196   2e-50
Scas_505.4                                                            144   9e-35
Scas_665.30                                                           112   8e-25
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...   109   8e-24
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...   109   8e-24
Kwal_26.9207                                                          103   4e-22
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    97   3e-20
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    95   2e-19
Kwal_23.3160                                                           95   2e-19
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    94   5e-19
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    92   2e-18
Kwal_14.1498                                                           92   2e-18
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    91   5e-18
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    90   5e-18
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    90   7e-18
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    89   2e-17
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    89   2e-17
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    88   4e-17
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    83   8e-16
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    82   1e-15
Kwal_47.17547                                                          82   2e-15
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    82   3e-15
Scas_707.48*                                                           80   8e-15
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    79   2e-14
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    77   8e-14
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    74   6e-13
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    69   2e-11
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    69   3e-11
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    57   1e-07
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    55   3e-07
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    50   1e-05
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    49   2e-05
Scas_583.14*                                                           48   4e-05
Scas_688.1                                                             47   9e-05
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    47   1e-04
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    47   1e-04
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    46   2e-04
Kwal_47.17522                                                          45   3e-04
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    45   3e-04
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    42   0.003
Scas_710.41                                                            42   0.005
Scas_227.0d                                                            38   0.038
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    38   0.065
KLLA0D04092g complement(344666..348124) some similarities with s...    36   0.21 
Scas_297.1                                                             35   0.32 
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    35   0.32 
Scas_569.0d                                                            35   0.35 
Sklu_2437.5 YOL095C, Contig c2437 9395-11560                           34   0.72 
Scas_716.37                                                            33   1.2  
Scas_615.9                                                             33   1.7  
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    32   2.7  
Scas_678.19                                                            31   4.9  
Kwal_55.21575                                                          32   5.3  

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score = 2370 bits (6141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1145/1145 (100%), Positives = 1145/1145 (100%)

Query: 1    MSFTPPPETSSAYNYHPGKPFGSDRGQQGVGSSRRARQERRGSLDSFELEFDDSLDAALE 60
            MSFTPPPETSSAYNYHPGKPFGSDRGQQGVGSSRRARQERRGSLDSFELEFDDSLDAALE
Sbjct: 1    MSFTPPPETSSAYNYHPGKPFGSDRGQQGVGSSRRARQERRGSLDSFELEFDDSLDAALE 60

Query: 61   SLQIKRSASHERHSGIRGAEDFELKSMGRVDDGGHSPSGVLTNQDTQPLISQDSWDYGQV 120
            SLQIKRSASHERHSGIRGAEDFELKSMGRVDDGGHSPSGVLTNQDTQPLISQDSWDYGQV
Sbjct: 61   SLQIKRSASHERHSGIRGAEDFELKSMGRVDDGGHSPSGVLTNQDTQPLISQDSWDYGQV 120

Query: 121  KRLRSGWLGPQSSWQRLKSWVLPGAKAGAPLLGVTATYSSTHSIELTDQHVDREIHLDTT 180
            KRLRSGWLGPQSSWQRLKSWVLPGAKAGAPLLGVTATYSSTHSIELTDQHVDREIHLDTT
Sbjct: 121  KRLRSGWLGPQSSWQRLKSWVLPGAKAGAPLLGVTATYSSTHSIELTDQHVDREIHLDTT 180

Query: 181  PIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPALRIGYLSSY 240
            PIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPALRIGYLSSY
Sbjct: 181  PIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPALRIGYLSSY 240

Query: 241  IVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQLVPSKNLRVGDLVKLHKDS 300
            IVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQLVPSKNLRVGDLVKLHKDS
Sbjct: 241  IVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQLVPSKNLRVGDLVKLHKDS 300

Query: 301  RIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQDEMLTKVHITASAPE 360
            RIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQDEMLTKVHITASAPE
Sbjct: 301  RIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQDEMLTKVHITASAPE 360

Query: 361  KSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVACVIYTGTDTRQAMNTSKSSVK 420
            KSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVACVIYTGTDTRQAMNTSKSSVK
Sbjct: 361  KSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVACVIYTGTDTRQAMNTSKSSVK 420

Query: 421  TGLLELEINSLSKILCICVFTLSILLVVIGGLDDDKWYVDIMRYLILFSTIIPVSLRVNL 480
            TGLLELEINSLSKILCICVFTLSILLVVIGGLDDDKWYVDIMRYLILFSTIIPVSLRVNL
Sbjct: 421  TGLLELEINSLSKILCICVFTLSILLVVIGGLDDDKWYVDIMRYLILFSTIIPVSLRVNL 480

Query: 481  DLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTV 540
            DLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTV
Sbjct: 481  DLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTV 540

Query: 541  SYTMETMDMVTDYIQTLTSPANMGAAGVAVTGSRKEVSQRVRDLVVTLATCHNVTPNFED 600
            SYTMETMDMVTDYIQTLTSPANMGAAGVAVTGSRKEVSQRVRDLVVTLATCHNVTPNFED
Sbjct: 541  SYTMETMDMVTDYIQTLTSPANMGAAGVAVTGSRKEVSQRVRDLVVTLATCHNVTPNFED 600

Query: 601  NELAYQAASPDEIAIVKFTERVGLSLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTK 660
            NELAYQAASPDEIAIVKFTERVGLSLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTK
Sbjct: 601  NELAYQAASPDEIAIVKFTERVGLSLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTK 660

Query: 661  RMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDWLEEEVSNMAREGLRTLVIARKKLSTR 720
            RMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDWLEEEVSNMAREGLRTLVIARKKLSTR
Sbjct: 661  RMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDWLEEEVSNMAREGLRTLVIARKKLSTR 720

Query: 721  LYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRN 780
            LYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRN
Sbjct: 721  LYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRN 780

Query: 781  AGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLL 840
            AGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLL
Sbjct: 781  AGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLL 840

Query: 841  IDGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGN 900
            IDGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGN
Sbjct: 841  IDGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGN 900

Query: 901  DVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIH 960
            DVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIH
Sbjct: 901  DVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIH 960

Query: 961  RGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKTYPE 1020
            RGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKTYPE
Sbjct: 961  RGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKTYPE 1020

Query: 1021 LYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFIGVGSEVFKKMVALSFTALVINE 1080
            LYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFIGVGSEVFKKMVALSFTALVINE
Sbjct: 1021 LYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFIGVGSEVFKKMVALSFTALVINE 1080

Query: 1081 LIMVALEIYTWNKTMAISEIVTFAIYVLSIPLLGEYFDLTSMLALPFFIQLTIILTVSIF 1140
            LIMVALEIYTWNKTMAISEIVTFAIYVLSIPLLGEYFDLTSMLALPFFIQLTIILTVSIF
Sbjct: 1081 LIMVALEIYTWNKTMAISEIVTFAIYVLSIPLLGEYFDLTSMLALPFFIQLTIILTVSIF 1140

Query: 1141 PVWAA 1145
            PVWAA
Sbjct: 1141 PVWAA 1145

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 1718 bits (4449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 846/1163 (72%), Positives = 962/1163 (82%), Gaps = 59/1163 (5%)

Query: 1    MSFTPPPETSSAYNYHPGKPFGSDRGQQGVGSSRRARQERRGSLDSFELEFDDSLDAALE 60
            MSF+PPP              GS++  Q   S+       R S+DSF+L+F+DSLDAALE
Sbjct: 1    MSFSPPP--------------GSNKLNQAPSSNNG-----RSSIDSFDLQFEDSLDAALE 41

Query: 61   SLQIKRSASHERHSGIRGAEDFELKSMGRVDDG----GHSPSGVLTN----------QDT 106
            SLQI  S +          E+FE++++ +  D      HS    L +          +DT
Sbjct: 42   SLQINNSLN-------TSGENFEMRTIDQDGDDTQSFKHSRVSSLNDSAKNTHLSSGRDT 94

Query: 107  QPLI--SQDSWDYGQVKRLRSGWLGPQSSWQRLKSWVLPGAKAGAPLLGVTATYSSTHS- 163
            QPLI  +Q+ W   Q    +S W    S + RL            P     + Y ST+S 
Sbjct: 95   QPLIGTTQEPWSNNQQGSNQSPW----SKFIRL---------IKTPTTTDLSKYRSTNSS 141

Query: 164  IELTDQHVDREIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLV 223
            IELTDQHV+REIH DTTPIYDK KYP+NAISNAKYN ITF+PI+LYEQFKFFFNLYFLLV
Sbjct: 142  IELTDQHVEREIHPDTTPIYDKNKYPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLV 201

Query: 224  SLSQSIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQLV 283
            +LSQ+IPALRIGYLSSYIVPLAFVL+VTMSKEAMDDIQRR+RD+E+NNELYEVLN +QLV
Sbjct: 202  ALSQAIPALRIGYLSSYIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYEVLNKAQLV 261

Query: 284  PSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNL 343
            PSK+L+VGDL+K+HK +RIPAD++LLQSSEPSGE+F+KTDQLDGETDWKLRVA SLTQNL
Sbjct: 262  PSKDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNL 321

Query: 344  TQDEMLTKVHITASAPEKSIHMFTGKLTYKGSSA-PLSVDNTLWANTVLASSGTCVACVI 402
            + D++L K+ ITAS+PEKSIH F GKLTYK SS+  LSVDNT+WANTVLAS G+C+ CV+
Sbjct: 322  STDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIGCVV 381

Query: 403  YTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDKWYVDIM 462
            YTGTDTRQAMNT+ SSVKTGLLELEINSLSKILC CVF LSI+LV   G  +  WYVDIM
Sbjct: 382  YTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVLVAFAGFGNKDWYVDIM 441

Query: 463  RYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKT 522
            RYLILFSTIIPVSLRVNLDLGKSVYARQIE D +IPDTIVRTSTIPEDLGRIEYLLSDKT
Sbjct: 442  RYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKT 501

Query: 523  GTLTQNDMQLRKIHLGTVSYTMETMDMVTDYIQTLTSPANMGAAGVAVTGSRKEVSQRVR 582
            GTLTQNDMQL+K+HLGTVSYTM+TMD+VTDY+Q L S +      +  + ++K++  RVR
Sbjct: 502  GTLTQNDMQLKKLHLGTVSYTMDTMDIVTDYVQELVSSST--TTPMPQSTAKKDLPNRVR 559

Query: 583  DLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKFTERVGLSLFKRDRHSLTLFHEYSG 642
            DLVVTLA CHNVTP FED EL YQAASPDEIAIVKFTE VGLSLFKRDRHS++LFH++S 
Sbjct: 560  DLVVTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSA 619

Query: 643  VNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDWLEEEVSNM 702
             N +YDIL VFPF SDTKRMGIIV D+ K E WF+QKGADTVM++IVQSNDWL+EEV NM
Sbjct: 620  TNFEYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGADTVMARIVQSNDWLDEEVGNM 679

Query: 703  AREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTG 762
            AREGLRTLVI RKKLS + YEQF KEY DASLSMLNRDE M+ V+K+HLEHNLELLGLTG
Sbjct: 680  AREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTG 739

Query: 763  VEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRD 822
            VEDKLQ DVK+SIELLRNAGVKIWMLTGDKVETARCV +SAKLISRGQYVHT+TKL+R +
Sbjct: 740  VEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPE 799

Query: 823  GALSRLEYLKANRNSCLLIDGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVAL 882
            GAL+ LEYLK N++SCLLIDG+SL +++++Y+ EFF+IV+ LP VIACRCTPQQKADVAL
Sbjct: 800  GALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVAL 859

Query: 883  LIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLW 942
            LIRE+TGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAAD+S+TQFCHLTKLLLW
Sbjct: 860  LIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLW 919

Query: 943  HGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVF 1002
            HGRNSYKRSAKL+QFVIHRGL+ISVCQAVYS+ S  +PIALYQGWLMVGYATCYTMAPVF
Sbjct: 920  HGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAPVF 979

Query: 1003 SLTLDHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFIGVGS 1062
            SLTLDHDIDESLTK YPELYKELT G SLSYKTFFVWVILSLFQG  IQG SQ F  +  
Sbjct: 980  SLTLDHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILSLFQGCAIQGISQYFTSLDE 1039

Query: 1063 EVFKKMVALSFTALVINELIMVALEIYTWNKTMAISEIVTFAIYVLSIPLLGEYFDLTSM 1122
              FKK+VALSFTALVINELIMVALEIYTWNKTM I+EIVTF IYV+S+P L EYFDLT +
Sbjct: 1040 VDFKKLVALSFTALVINELIMVALEIYTWNKTMVITEIVTFLIYVVSVPFLSEYFDLTFV 1099

Query: 1123 LALPFFIQLTIILTVSIFPVWAA 1145
              LPF+ +L  IL VS+FPVWAA
Sbjct: 1100 SQLPFYAKLIFILAVSVFPVWAA 1122

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score = 1612 bits (4173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 789/1160 (68%), Positives = 946/1160 (81%), Gaps = 53/1160 (4%)

Query: 6    PPETSSAYNYHPGKPFGSDRGQQGVGSSRRARQERRGSLDSFELEFDDSLDAALESLQIK 65
            PP    ++  H    F S+  Q               S+DSF+L  DDS DAAL+SLQI 
Sbjct: 4    PP----SFKSHKQNLFNSNNNQHA------------NSVDSFDLHLDDSFDAALDSLQIN 47

Query: 66   RSASH-ERHSGIRGAEDFELKSMGRVDD-GGHSPSG--VLTNQDTQPLI------SQDSW 115
             +     +H+ +   E FE++++  +D+   HS       +N DT PL+        D++
Sbjct: 48   NNPEPLSKHNTVGDRESFEMRTVDDLDNFSNHSSDSHRKSSNTDTHPLMYDNRLSQDDNF 107

Query: 116  DYGQVKRLRSGW----LGPQSSWQRL---KSWVLPGAKAGAPLLGVTATYSSTHSIELTD 168
             +  +                S+ ++   K+W    +K G+P             IEL+D
Sbjct: 108  KFTNIASSPPSSSNNIFSKALSYLKVSNTKNW----SKFGSP-------------IELSD 150

Query: 169  QHVDREIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQS 228
            QH++REIH DTTP+YD+ +Y +N +SNAKYNA+TF+P +LYEQFKFF+NLYFL+V+LSQ+
Sbjct: 151  QHIEREIHPDTTPVYDRNRYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQA 210

Query: 229  IPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQLVPSKNL 288
            +PALRIGYLSSYIVPLAFVL VTM+KEA+DDIQRRRRDRE+NNELY V+  ++ +PSK+L
Sbjct: 211  VPALRIGYLSSYIVPLAFVLTVTMAKEAIDDIQRRRRDRESNNELYHVITRNRSIPSKDL 270

Query: 289  RVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQDEM 348
            +VGDL+K+HK  RIPAD++LLQSSEPSGE+F+KTDQLDGETDWKLRVA  LTQNL+++++
Sbjct: 271  KVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDL 330

Query: 349  LTKVHITASAPEKSIHMFTGKLTYKGS-SAPLSVDNTLWANTVLASSGTCVACVIYTGTD 407
            + ++ ITASAPEKSIH F GK+TYK S S PLSVDNTLWANTVLASSG C+ACV+YTG D
Sbjct: 331  INRISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVVYTGRD 390

Query: 408  TRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDKWYVDIMRYLIL 467
            TRQAMNT+ + VKTGLLELEINS+SKILC CVF LSILLV   G  +D WY+DI+RYLIL
Sbjct: 391  TRQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGFHNDDWYIDILRYLIL 450

Query: 468  FSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQ 527
            FSTIIPVSLRVNLDL KSVYA QIE DK+IP+TIVRTSTIPEDLGRIEYLLSDKTGTLTQ
Sbjct: 451  FSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQ 510

Query: 528  NDMQLRKIHLGTVSYTMETMDMVTDYIQTLTSPAN--MGAAGVAVTGSRKEVSQRVRDLV 585
            NDMQL+KIHLGTVSYT ET+D+V+DY+Q+L S  N  +  + VA++ +RK++S RVRD++
Sbjct: 511  NDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMSFRVRDMI 570

Query: 586  VTLATCHNVTPNFEDNELAYQAASPDEIAIVKFTERVGLSLFKRDRHSLTLFHEYSGVNL 645
            +TLA CHNVTP FED+EL YQAASPDEIAIVKFTE VGLSLFKRDRHS++L HE+SG  L
Sbjct: 571  LTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHEHSGKTL 630

Query: 646  QYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDWLEEEVSNMARE 705
             Y+IL VFPF SD+KRMGIIVRD   +E WF+QKGADTVMSKIV+SNDWLEEE  NMARE
Sbjct: 631  NYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMSKIVESNDWLEEETGNMARE 690

Query: 706  GLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVED 765
            GLRTLVI RKKL+ ++YEQF KEY DASLSMLNRD+ M++V+ ++LEH+LELLGLTGVED
Sbjct: 691  GLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVED 750

Query: 766  KLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGAL 825
            KLQKDVK+SIELLRNAG+KIWMLTGDKVETARCV +SAKLISRGQYVHTITK+TR +GA 
Sbjct: 751  KLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAF 810

Query: 826  SRLEYLKANRNSCLLIDGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIR 885
            ++LEYLK NRN+CLLIDG+SL +++ HY  EFF++V+ LP VIACRCTPQQKADVAL+IR
Sbjct: 811  NQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIR 870

Query: 886  EMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGR 945
            +MTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAAD+SITQFCHLT+LLLWHGR
Sbjct: 871  KMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGR 930

Query: 946  NSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVFSLT 1005
            NSYKRSAKL+QFV+HRGL+I++CQAVYSI S  +PIALYQGWLMVGYATCYTMAPVFSLT
Sbjct: 931  NSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAPVFSLT 990

Query: 1006 LDHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFIGVGSEVF 1065
            LDHDI+ESLTK YPELYKELTEG+SLSYKTFFVWV+LSLFQG+VIQ FSQ F  +    F
Sbjct: 991  LDHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFSQAFTSLLDTDF 1050

Query: 1066 KKMVALSFTALVINELIMVALEIYTWNKTMAISEIVTFAIYVLSIPLLGEYFDLTSMLAL 1125
             +MVA+SFTALV+NELIMVALEIYTWNKTM ++EI T   Y++S+P LG+YFDL  M  +
Sbjct: 1051 TRMVAISFTALVVNELIMVALEIYTWNKTMLVTEIATLLFYIVSVPFLGDYFDLGYMTTV 1110

Query: 1126 PFFIQLTIILTVSIFPVWAA 1145
             ++  L +IL +SIFPVW A
Sbjct: 1111 NYYAGLLVILLISIFPVWTA 1130

>Scas_704.38
          Length = 1161

 Score = 1602 bits (4149), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 772/1128 (68%), Positives = 928/1128 (82%), Gaps = 30/1128 (2%)

Query: 41   RGSLDSFELEFDDSLDAALESLQIKRSASHERHS-----GIRGA---------EDFELKS 86
            R S DSF+L+F+DS DA L+++++     ++ ++      I  A         E FE+KS
Sbjct: 20   RNSADSFDLQFEDSFDAVLDNIELNTDTRNQNNTLPNNQNINKASSENKDKLQESFEMKS 79

Query: 87   MGRVDDG-GHSPSGVLTNQDTQPLI-----SQDSWDYGQVKRLRSGWLGPQSSWQRLKSW 140
            +   + G GHS +   +N D QPL+     + D   Y +   +    L   S+  R  +W
Sbjct: 80   LNARNGGLGHSRNS--SNGDRQPLMHDSASNPDGSPY-KYTNVSESALNLHSN-NRFSNW 135

Query: 141  VLPGAKAGAPLLGVTATYSSTHSIELTDQHVDREIHLDTTPIYDKRKYPTNAISNAKYNA 200
            +      GA        + +  S+EL D+H++REIH  TTP+YD+ +YP N ISNAKYNA
Sbjct: 136  ITKLKMVGAQKW---KKFHTMGSVELDDRHMEREIHPSTTPVYDRNRYPGNEISNAKYNA 192

Query: 201  ITFLPIVLYEQFKFFFNLYFLLVSLSQSIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDI 260
             TF+P +LYEQFKFF+NLYFL+V+LSQ+IPALRIGYLSSY+VPLAFVL VTMSKEAMDDI
Sbjct: 193  FTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFVLTVTMSKEAMDDI 252

Query: 261  QRRRRDRETNNELYEVLNNSQLVPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFV 320
            QRRRRD E+N+ELY VLN S+LVPSK+L+VGDL+K+ K  R+PAD++LLQSSEPSGETF+
Sbjct: 253  QRRRRDNESNSELYHVLNQSKLVPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFI 312

Query: 321  KTDQLDGETDWKLRVAPSLTQNLTQDEMLTKVHITASAPEKSIHMFTGKLTYKG-SSAPL 379
            KTDQLDGETDWKLR+AP+LTQNLT+ +++ KV ITASAPEK+IH F GK+TYK  SS PL
Sbjct: 313  KTDQLDGETDWKLRIAPALTQNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSNPL 372

Query: 380  SVDNTLWANTVLASSGTCVACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICV 439
            S+DNTLWANTVLAS+G C+ CV+YTG DTRQAMNT+ ++VKTGLLELEINS+SKILC  V
Sbjct: 373  SIDNTLWANTVLASTGFCIGCVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILCASV 432

Query: 440  FTLSILLVVIGGLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPD 499
            F LSI+LVV  G  +  WY+D+MRYLILFSTIIPVSLRVNLDL KSVYA QIE D +IP+
Sbjct: 433  FALSIILVVFAGFHNSDWYLDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDDTIPE 492

Query: 500  TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVTDYIQTLTS 559
            TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQL+KIHLGTVSYT ET+D+V+DY+  L +
Sbjct: 493  TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVDALVN 552

Query: 560  PAN-MGAAGVAV-TGSRKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVK 617
             +N    +G +V + SRK++S RVRD+VVTLA CHNVTP FED+EL YQAASPDEIAIVK
Sbjct: 553  SSNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFEDDELTYQAASPDEIAIVK 612

Query: 618  FTERVGLSLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFL 677
            FTE VGLSLFKRDRHS++L H +SG  L Y+IL VFPF SD+KRMGIIV D  K+E WF+
Sbjct: 613  FTESVGLSLFKRDRHSISLLHGHSGSILTYEILQVFPFNSDSKRMGIIVHDEQKDEYWFM 672

Query: 678  QKGADTVMSKIVQSNDWLEEEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSML 737
            QKGADTVM++IV++NDWLEEE  NMAREGLRTLV+ RKKLS  +Y+QF K+Y DASLSM+
Sbjct: 673  QKGADTVMARIVENNDWLEEETGNMAREGLRTLVVGRKKLSRNIYDQFKKDYDDASLSMV 732

Query: 738  NRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETAR 797
            NRD+ MN V+ ++LE++LELLGLTGVEDKLQ DVK+SIELLRNAG+KIWMLTGDKVETAR
Sbjct: 733  NRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETAR 792

Query: 798  CVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRAEF 857
            CV +SAKLISRGQYVH ITKLT+ +GAL++LEYLK N+ +CLLIDG+SL +++ +Y+ EF
Sbjct: 793  CVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLLIDGESLGMFLRYYKREF 852

Query: 858  FEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGK 917
            F++VICLP V+ACRCTPQQKADVAL+IRE TGKRVCCIGDGGNDVSMIQCADVGVGIVGK
Sbjct: 853  FDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGK 912

Query: 918  EGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSN 977
            EGKQASLAAD+SIT+FCHLT+LLLWHGRNSYKRSAKL+QF++HRGL+I++CQAVYSI S 
Sbjct: 913  EGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSK 972

Query: 978  LKPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKTYPELYKELTEGRSLSYKTFF 1037
             +PI LYQG+LMVGYATCYTMAPVFS+TLDHDI+ESLTK YPELYK+LTEG+SLSYKTFF
Sbjct: 973  FEPIGLYQGFLMVGYATCYTMAPVFSMTLDHDIEESLTKIYPELYKDLTEGKSLSYKTFF 1032

Query: 1038 VWVILSLFQGAVIQGFSQLFIGVGSEVFKKMVALSFTALVINELIMVALEIYTWNKTMAI 1097
            VW  LSLFQG VIQG SQ+F  +    F KMVA+ FTAL++NELIMVALEIYTWNK M  
Sbjct: 1033 VWCALSLFQGCVIQGCSQVFSSLLEVDFTKMVAIGFTALILNELIMVALEIYTWNKIMVF 1092

Query: 1098 SEIVTFAIYVLSIPLLGEYFDLTSMLALPFFIQLTIILTVSIFPVWAA 1145
            +EI+TF  YV+S+P LGEYFDL  M+ L F+ +L  IL VS+FPVWAA
Sbjct: 1093 TEILTFLCYVISVPFLGEYFDLKYMMTLRFYGELLFILLVSVFPVWAA 1140

>Kwal_23.5789
          Length = 1133

 Score = 1584 bits (4101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 789/1154 (68%), Positives = 928/1154 (80%), Gaps = 52/1154 (4%)

Query: 1    MSFTPPPETSSAYNYHPGKPFGSDRGQQGVGSSRRA--RQERRGSLDSFELEFDDSLDAA 58
            MSF+PPP                       GS++ +     R  S D  + + +DSLDAA
Sbjct: 1    MSFSPPP-----------------------GSNKESIPHNNRHNSFDLLDPQLEDSLDAA 37

Query: 59   LESLQIKRSASHERHSGIRGAEDFELKSMGRVDDGGHSPSGVLTNQDTQPLISQ-----D 113
            LESLQI    S  R       EDFE+ S+   +   ++        DT+PLI+      +
Sbjct: 38   LESLQIHTGGSPAR-------EDFEMTSLRSNESQKNA-----RQSDTEPLINNGATAPN 85

Query: 114  SWDYGQVKRLRSGWLGPQSSWQRLKSWVLPGAKAGAPLLGVTATYSSTHSIELTD-QHVD 172
            SW +                W R+  ++     + +P   V+   ++++SI+L D Q +D
Sbjct: 86   SWSHDPRHDSDRSTASGSPFWSRITKFM---RSSHSP--KVSTYKATSNSIQLKDDQQLD 140

Query: 173  REIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPAL 232
            REIH  TTP+YD+ KY  NAISNAKYN +TF+P +LYEQFKFFFNLYFLLV+LSQ+IPAL
Sbjct: 141  REIHPSTTPVYDRYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPAL 200

Query: 233  RIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQLVPSKNLRVGD 292
            RIGYLSSYIVPLAFVL VTMSKEA+DDIQRRRRDRE+NNELYEVL+ SQLVPSK+L+VGD
Sbjct: 201  RIGYLSSYIVPLAFVLTVTMSKEALDDIQRRRRDRESNNELYEVLSKSQLVPSKDLKVGD 260

Query: 293  LVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQDEMLTKV 352
            L+K+ K +R PAD++LLQSSEPSGE F+KTDQLDGETDWKLR+A  LTQ+L+QD++L ++
Sbjct: 261  LIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDLLYRI 320

Query: 353  HITASAPEKSIHMFTGKLTY-KGSSAPLSVDNTLWANTVLASSGTCVACVIYTGTDTRQA 411
             ITAS PEKSI+ F GKLT+ +  S PLSVDNT+WANTV AS+GT +ACV+YTG DTRQA
Sbjct: 321  SITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIACVVYTGADTRQA 380

Query: 412  MNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDKWYVDIMRYLILFSTI 471
            MNTS SSVKTGLLELEINSLSKILC CVF LS+ LV   G +++ WYVDIMRYLILFSTI
Sbjct: 381  MNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNNNDWYVDIMRYLILFSTI 440

Query: 472  IPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQ 531
            IPVSLRVNLDLGKSVYA QIE D +IP+TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDM+
Sbjct: 441  IPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDME 500

Query: 532  LRKIHLGTVSYTMETMDMVTDYIQTLTSPANMGAAGVAVTGSRKEVSQRVRDLVVTLATC 591
            L+K+HLGTVSYTM+TMD+VTDY++ ++   N  A   A   S+K++  RVRDLV+TLA C
Sbjct: 501  LKKLHLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPSA---SKKDLPGRVRDLVLTLALC 557

Query: 592  HNVTPNFEDNELAYQAASPDEIAIVKFTERVGLSLFKRDRHSLTLFHEYSGVNLQYDILH 651
            H VTP FED EL YQAASPDEIAIVKFTE VGL+LF+RDRHS+TL H+ SG N +YDILH
Sbjct: 558  HQVTPTFEDGELTYQAASPDEIAIVKFTESVGLTLFRRDRHSITLLHDQSGTNFEYDILH 617

Query: 652  VFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDWLEEEVSNMAREGLRTLV 711
            VFPF SD KRMGI++ D+ K+E WFLQKGAD VMSKIVQ NDWLEEE  N+AREGLRTLV
Sbjct: 618  VFPFNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSKIVQKNDWLEEETGNLAREGLRTLV 677

Query: 712  IARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDV 771
            I RK+LS +L + F+K+Y+DASL MLNR+  M+ V+ +HLEH+LE+LGLTGVEDKLQ+DV
Sbjct: 678  IGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDV 737

Query: 772  KTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYL 831
            K+SIELLRNAG+KIWMLTGDKVETARCV +SAKL+SRGQYVHT+TK+ + +GAL+ LE L
Sbjct: 738  KSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELL 797

Query: 832  KANRNSCLLIDGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKR 891
            K N NSCLLIDG+SL +Y+ +YR +FFEIV+ LP VIACRCTPQQKADVA  IRE+TGKR
Sbjct: 798  KINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKR 857

Query: 892  VCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRS 951
            VCCIGDGGNDVSMIQ ADVGVGIVGKEGKQASLAAD+SITQFCHL+KLLLWHGRNSYKRS
Sbjct: 858  VCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRS 917

Query: 952  AKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVFSLTLDHDID 1011
            AKL+QFVIHRGLLISVCQAVYSISS  +PIALYQGWLMVGYATCYTMAPVFSLTLDHDID
Sbjct: 918  AKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDID 977

Query: 1012 ESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFIGVGSEVFKKMVAL 1071
            ESLTKTYPELYKELT G+SLSYKTFFVWV+LSLFQG VIQG SQ F  +    FK++VAL
Sbjct: 978  ESLTKTYPELYKELTAGKSLSYKTFFVWVVLSLFQGCVIQGLSQGFTSLDELDFKRLVAL 1037

Query: 1072 SFTALVINELIMVALEIYTWNKTMAISEIVTFAIYVLSIPLLGEYFDLTSMLALPFFIQL 1131
            SFT L++NELIMVA+EIYTWNKTM +SE+VTF I+V S+PLL EYFDLT M    ++ +L
Sbjct: 1038 SFTVLILNELIMVAIEIYTWNKTMVVSEVVTFLIFVGSVPLLEEYFDLTYMSRPEYYGKL 1097

Query: 1132 TIILTVSIFPVWAA 1145
             IIL++SI PVWAA
Sbjct: 1098 AIILSLSIIPVWAA 1111

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score = 1583 bits (4099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 784/1159 (67%), Positives = 925/1159 (79%), Gaps = 46/1159 (3%)

Query: 1    MSFTPPPETSSAYNYHPGKPFGSDRGQQGVGSSRRARQERRGSLDSFELEFDDSLDAALE 60
            MSF+PPP +     Y       S   Q    S+ R         DSF+L+F+DSLDAALE
Sbjct: 1    MSFSPPPGSQIPNKY-------SKSNQHQAQSTDR---------DSFDLQFEDSLDAALE 44

Query: 61   SLQIKRSASHERHSGIRGAEDFELKSMGRVDDGGHSPSGVLTNQDTQPLISQDSWDYGQV 120
            SLQ+   +    +S +   EDFE+KSM     G H    + ++ DT PLI+  S      
Sbjct: 45   SLQLPEHSHRRENSTV--FEDFEMKSM----HGDHQTGMLHSDADTAPLITNHS---NNG 95

Query: 121  KRLRSGWLGPQSS-----WQRLKSWV---LPGAKAGAPLLGVTATYSSTHS-----IELT 167
            + L +     Q++     W + KSW       AK+    L V   YSST+S     IEL 
Sbjct: 96   RMLSNSDRNAQNTNNITVWSKAKSWFEHSFTKAKSKPSSLSV---YSSTNSVDGNKIELN 152

Query: 168  DQHVDREIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQ 227
            D +V+REIH  TTPIYD++KYP+N ISNAKYN  TF+P++LYEQFKFFFNLYFL+V+LSQ
Sbjct: 153  DHNVEREIHPATTPIYDRKKYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQ 212

Query: 228  SIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQLVPSKN 287
            +IP LRIGYLSSYIVPLAFVL VTMSKEAMDDI RR+RDRE NNELYEV+N    +PSK+
Sbjct: 213  AIPQLRIGYLSSYIVPLAFVLTVTMSKEAMDDINRRKRDREANNELYEVVNKPCPIPSKD 272

Query: 288  LRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQDE 347
            L+VGD++KL K +R+PAD+++LQ++EP+GE+F+KTDQLDGETDWKLR+A SLTQ+LT+++
Sbjct: 273  LKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTEND 332

Query: 348  MLTKVHITASAPEKSIHMFTGKLTYKGS-SAPLSVDNTLWANTVLASSGTCVACVIYTGT 406
            +L  + ITASAPE SIH F GK+TYK S S+PLSVDNT+W NTVLASS  C+ C++YTG 
Sbjct: 333  LLNNITITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICCIVYTGR 392

Query: 407  DTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDKWYVDIMRYLI 466
            +TRQA+NT+KS  KTGLLELEIN LSKILC CVF LSI+LV   G +++ WYVDIMRYLI
Sbjct: 393  ETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDWYVDIMRYLI 452

Query: 467  LFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLT 526
            LFSTIIPVSLRVNLDLGKSVYA +IE DK I DTIVRTSTIPEDLGRIEYLLSDKTGTLT
Sbjct: 453  LFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLT 512

Query: 527  QNDMQLRKIHLGTVSYTMETMDMVTDYIQTLTSPANMGAAGVAVTGSRKEVSQRVRDLVV 586
            QNDMQL+KIHLGTVSYT ETMD+VTD+IQ++    N   +    T +RK +S RV DLV 
Sbjct: 513  QNDMQLKKIHLGTVSYTNETMDIVTDFIQSM----NSRTSNSTPTTTRKNISDRVIDLVT 568

Query: 587  TLATCHNVTPNFEDNELAYQAASPDEIAIVKFTERVGLSLFKRDRHSLTLFHEYSGVNLQ 646
            TLA CHNVTP FED EL YQAASPDEIAIVKFTE VGLSLF+RDRHS++LFH++SG+ L+
Sbjct: 569  TLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGMKLE 628

Query: 647  YDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDWLEEEVSNMAREG 706
            YDI  +FPF SD+KRMG+I+ D+ K E WFLQKGADTVMS IV  NDWLEEE SNMA EG
Sbjct: 629  YDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMSSIVVRNDWLEEETSNMATEG 688

Query: 707  LRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDK 766
            LRTLVI RKKLST L+EQF KEY +ASL+M++R+  M  VV++ LE++LELLGLTGVEDK
Sbjct: 689  LRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDK 748

Query: 767  LQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALS 826
            LQKDVK+SIELLRNAG+KIWMLTGDKVETARCV +SAKLISRGQYVHT+TK+ + +GAL 
Sbjct: 749  LQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALH 808

Query: 827  RLEYLKANRNSCLLIDGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIRE 886
             LEYL+ N+NSCLLIDG+SL +Y+ ++  EFF+IV+ LP V+ACRCTPQQKADVA+ IR+
Sbjct: 809  HLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQ 868

Query: 887  MTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRN 946
             TGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAAD+SITQFCHLTKLLLWHGRN
Sbjct: 869  ATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRN 928

Query: 947  SYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVFSLTL 1006
            SYK SAKLSQFVIHRGL+ISVCQAVYSI S  +P+ALYQGWLMVGYATCYTMAPVFSLTL
Sbjct: 929  SYKSSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSLTL 988

Query: 1007 DHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFIGVGSEVFK 1066
            DHDIDESLT  YPELYKELT G+SLS+KTFFVWV LS+FQG VIQ  SQ F  +    F 
Sbjct: 989  DHDIDESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFFTSLNDSDFT 1048

Query: 1067 KMVALSFTALVINELIMVALEIYTWNKTMAISEIVTFAIYVLSIPLLGEYFDLTSMLALP 1126
            KMVA+SFTALV+NELIMV LEI TWNK MAI+E+VT  IY+ SIP LGEYFDL+ +    
Sbjct: 1049 KMVAISFTALVLNELIMVGLEINTWNKIMAITEVVTLLIYLGSIPFLGEYFDLSYVSTTK 1108

Query: 1127 FFIQLTIILTVSIFPVWAA 1145
            F +++ +IL +S+ PVWAA
Sbjct: 1109 FPLRVLVILVISVVPVWAA 1127

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 1543 bits (3995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 763/1114 (68%), Positives = 904/1114 (81%), Gaps = 20/1114 (1%)

Query: 43   SLDSFELEFDDSLDA----ALESLQIKRSASH-ERHSGIRGAEDFELKSM----GRVDDG 93
            SLDSFE  FD++LD      +    I  S ++  R +     E+FE++S+       D+ 
Sbjct: 15   SLDSFENSFDEALDNIEINPVRGYHIDNSLNNSNRITDFDIDENFEMRSVLEDEEHFDND 74

Query: 94   GHSPSGVLTNQDTQPLISQDSWDYGQVKRLRS--GWLGPQSSWQRLKSWVLPGAKAGAPL 151
            GH      T  +   L S+ +  Y  V   RS  G+  P +    LK W +    A   +
Sbjct: 75   GHPLMRDRTRSNASTLNSRYN-KYNNVSGSRSVTGY-TPSTIGVGLKKWFVNVKTA---I 129

Query: 152  LGVTATYSSTHSIELTDQHVDREIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQ 211
                  YS+  S+ L D+H +RE+H  TT +YD+ ++P+N +SNAKYNA+TFLP +LYEQ
Sbjct: 130  SSGWKDYST--SVALGDEHTEREVHPGTTQVYDRHRFPSNEVSNAKYNAVTFLPTLLYEQ 187

Query: 212  FKFFFNLYFLLVSLSQSIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNN 271
            FKFFFNLYFLLV+LSQ+IPALRIGYLSSY+VPLAFVL VTM+KEA DDIQRRRRDRE+N 
Sbjct: 188  FKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFVLTVTMAKEASDDIQRRRRDRESNM 247

Query: 272  ELYEVLNNSQLVPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDW 331
            ELYEVL   + V SK+L+VGDL+K+ K +R+PAD+ILLQSSEPSGE F+KTDQLDGETDW
Sbjct: 248  ELYEVLGRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDW 307

Query: 332  KLRVAPSLTQNLTQDEMLTKVHITASAPEKSIHMFTGKLTYKGS-SAPLSVDNTLWANTV 390
            KLR+A +LTQNL +D++L K+ ITASAPEKSIH F G++TYK + ++ L++DNTLWANTV
Sbjct: 308  KLRIACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTV 367

Query: 391  LASSGTCVACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIG 450
            LASSG C+ CVIYTG DTRQAMNT+ + VKTGLLELEIN +SKILC CVF LSILLVV  
Sbjct: 368  LASSGFCIGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFA 427

Query: 451  GLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPED 510
            GL +D WYVDIMRYLILFSTIIPVSLRVNLDL KSVYA QIE DK+IP+TIVRTSTIPED
Sbjct: 428  GLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPED 487

Query: 511  LGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVTDYIQTLTSPANMGAAGVAV 570
            LGRIEYLLSDKTGTLTQNDMQL+K+HLG VSYT ET D+V+DYIQ +    N     +  
Sbjct: 488  LGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGMIESKNDSVTNLGP 547

Query: 571  -TGSRKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKFTERVGLSLFKR 629
             + +RK+ +  V DL+ TLA CHNVTP FED+EL YQAASPDEIAIVKFTE VGLSLFKR
Sbjct: 548  RSTTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKR 607

Query: 630  DRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIV 689
            DRHS++L HE+SG  L YD+L +FPF SDTKRMGIIV D+ K++ WFLQKGADTVM++IV
Sbjct: 608  DRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGADTVMNRIV 667

Query: 690  QSNDWLEEEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKR 749
             +NDWLEEE  NMAREGLRTLVI RKKL+ ++YEQF KEY++ S SM NR++ M   + +
Sbjct: 668  ANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMANTISK 727

Query: 750  HLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRG 809
            +LEH+LELLGLTGVEDKLQKDVK+SIELLRNAG+KIWMLTGDKVETARCV +SAKLISRG
Sbjct: 728  YLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRG 787

Query: 810  QYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRAEFFEIVICLPVVIA 869
            QYVH +TKL++ +GA ++LEYLK N+N+CLLIDG+SL +++ +YR EFF++V+ LP VIA
Sbjct: 788  QYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVVHLPTVIA 847

Query: 870  CRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYS 929
            CRCTPQQKADVAL+IRE+TGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAAD+S
Sbjct: 848  CRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFS 907

Query: 930  ITQFCHLTKLLLWHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLM 989
            ITQFCHLT+LLLWHGRNSYKRSAKL+QFV+HRGL+I++CQAV+S+ S  +PIALYQGWLM
Sbjct: 908  ITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLM 967

Query: 990  VGYATCYTMAPVFSLTLDHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAV 1049
            VGYATCYTMAPVFSLTLDHDIDESLTK YPELYK+LTEG+SLSYKTFFVWV LS +QG V
Sbjct: 968  VGYATCYTMAPVFSLTLDHDIDESLTKMYPELYKDLTEGKSLSYKTFFVWVALSFYQGLV 1027

Query: 1050 IQGFSQLFIGVGSEVFKKMVALSFTALVINELIMVALEIYTWNKTMAISEIVTFAIYVLS 1109
            IQGFSQ F  +    F KMVA+ FTAL+ NELIMVALEIYTWNKTM I+EIVT AIYV S
Sbjct: 1028 IQGFSQTFTSLAEIDFTKMVAIGFTALIFNELIMVALEIYTWNKTMIITEIVTLAIYVFS 1087

Query: 1110 IPLLGEYFDLTSMLALPFFIQLTIILTVSIFPVW 1143
            +P LGEYFDL  +  L F  +L +IL VSIFPVW
Sbjct: 1088 VPFLGEYFDLKYISTLKFITELILILVVSIFPVW 1121

>Scas_89.1
          Length = 271

 Score =  461 bits (1185), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 213/257 (82%), Positives = 241/257 (93%)

Query: 722 YEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNA 781
           Y++F KEY DASLSMLN DE M+ V+K+HLEHNLELLGLTGVEDKLQ DVK+SIELLRNA
Sbjct: 2   YDKFEKEYHDASLSMLNXDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNA 61

Query: 782 GVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLI 841
           GVKIWMLTGDKVETARCV +SAKLISRGQYVHT+TKL+R +GAL+ LEYLK N++SCLLI
Sbjct: 62  GVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLI 121

Query: 842 DGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGND 901
           DG+SL +++++Y+ EFF+IV+ LP VIACRCTPQQKADVALLIRE+TGKRVCCIGDGGND
Sbjct: 122 DGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGND 181

Query: 902 VSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIHR 961
           VSMIQCADVGVGIVGKEGKQASLAAD+S+TQFCHLTKLLLWHGRNSYKRSAKL+QFVIHR
Sbjct: 182 VSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHR 241

Query: 962 GLLISVCQAVYSISSNL 978
           GL+ISVCQAVYS+ S L
Sbjct: 242 GLIISVCQAVYSVCSKL 258

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score =  462 bits (1190), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 323/1006 (32%), Positives = 524/1006 (52%), Gaps = 67/1006 (6%)

Query: 173  REIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPAL 232
            R I L+ +    +  Y  N IS  KYNA TFLP  L+++F  + NL+FL  S+ Q +P +
Sbjct: 187  RTILLNDSSANSRFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNV 246

Query: 233  RIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLN--NSQLVPSK--NL 288
                  + I  L  VL+V+  KE+++D++R   D+E N+ L +VL+  + + V  K  ++
Sbjct: 247  TPTNRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDI 306

Query: 289  RVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQDEM 348
             VGD++++  +  IPAD+I+L SSEP G  +++T  LDGET+ K++ A   T N   ++ 
Sbjct: 307  AVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKA 366

Query: 349  LTKVH--ITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVACVIYTGT 406
            L K+H  + +  P  S++ + G +T  GS+ PLS D  L     L ++      +++TG 
Sbjct: 367  LCKLHGRVQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTGH 426

Query: 407  DTRQAMNTSKSSVKTGLLELEIN----SLSKILCICVFTLSILLVVIGGLDDDK------ 456
            +T+   N + + +K   +E  IN    +L  +L +     S   V++   D         
Sbjct: 427  ETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYI 486

Query: 457  --------WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESD------KSIPDTIV 502
                    ++ DI+ + ILFS ++P+SL V +++ K   A  I SD      +S   T+V
Sbjct: 487  EGTNKAGLFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVV 546

Query: 503  RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVTDYIQTLTSPAN 562
            RTS++ E+LG+IEY+ SDKTGTLT+N M+ + + +    Y +ET+    D   T+     
Sbjct: 547  RTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCY-IETIP--EDRRATVEDGIE 603

Query: 563  MGAAGV-----AVTGSRKEVSQRVRDLVVTLATCHNVTPNFE-DNELAYQAASPDEIAIV 616
            +G          +T    + +  V + +  LATCH V P  + D  + YQAASPDE A+V
Sbjct: 604  IGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALV 663

Query: 617  KFTERVGLSLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWF 676
            +    +G     R  +S+++   +S   L+Y +L++  F S  KRM  I R      I  
Sbjct: 664  QGAADLGFRFDIRRPNSVSISTPFSE-QLEYQLLNICEFNSTRKRMSAIFR-MPDGSIKL 721

Query: 677  LQKGADTVMSKIVQS--NDWLEEEVSNM---AREGLRTLVIARKKLSTRLYEQFSKEYKD 731
              KGADTV+ + + S  N +++  + ++   A EGLRTL IA + +  + YE++SK Y+ 
Sbjct: 722  FCKGADTVILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEA 781

Query: 732  ASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGD 791
            AS +M +R E ++   +  +EH+L  LG T +EDKLQ+ V  +I  L+ AG+K+W+LTGD
Sbjct: 782  ASTTMKDRTEELDRAAEL-IEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGD 840

Query: 792  KVETARCVCVSAKLISRGQYVHTITKLTRRD---------GALSRLEYLKANRNS-CLLI 841
            + ETA  + +S +L+S    +  + + T+ D          A+   +  + + NS  L+I
Sbjct: 841  RQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVI 900

Query: 842  DGDSLAIYMSH-YRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGN 900
            DG SL   +      +F  I      VI CR +P QKA V  +++  T   +  IGDG N
Sbjct: 901  DGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGAN 960

Query: 901  DVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIH 960
            DVSMIQ A VGVGI G EG QA+ +AD++I QF  L KLL+ HG  SY+R +    +  +
Sbjct: 961  DVSMIQAAHVGVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFY 1020

Query: 961  RGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVFSLTL-DHDIDESLTKTYP 1019
            + + + + Q  Y  ++     ++ + W +  Y   +T+ P F + + D  +   L   YP
Sbjct: 1021 KNMALYMTQFWYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYP 1080

Query: 1020 ELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLF------IGVGSEVFKKMV--AL 1071
            +LYK   +G+  S   F+ WV+   +  AV+   S LF      + +G E     V    
Sbjct: 1081 QLYKLGQKGQFFSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVG 1140

Query: 1072 SFTALVINELIMVALEIYTWNKTMAISEIVTFAIYVLSIPLLGEYF 1117
             +T  +I  L   AL    W K   ++   +  I++L  P     F
Sbjct: 1141 IYTTSIIIVLGKAALITSQWTKFTLVAIPGSLVIWLLFFPFYSAVF 1186

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score =  447 bits (1150), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 305/941 (32%), Positives = 482/941 (51%), Gaps = 66/941 (7%)

Query: 173  REIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPAL 232
            R IH++ +       Y  N IS  KYN  TFLP  L+++F  + NL+FL  S  Q +P +
Sbjct: 183  RVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHV 242

Query: 233  RIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQ--LVPSK--NL 288
                  + I  L  VL+V+  KE ++DI+R   D+E NN   E+ + +    V  +  ++
Sbjct: 243  SPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDI 302

Query: 289  RVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQDEM 348
            RVGD++++  +  IPAD I+L SSEP G  +++T  LDGET+ K++ +   T      + 
Sbjct: 303  RVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKT 362

Query: 349  LTKVH--ITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVACVIYTGT 406
            L  ++  + +  P  S++ + G +T      PLS D  +     L ++      VI+TG 
Sbjct: 363  LKNMNGKVVSEQPNSSLYTYEGTMTLNDRQIPLSPDQMILRGATLRNTAWIFGLVIFTGH 422

Query: 407  DTRQAMNTSKSSVKTGLLELEINS----LSKILCICVFTLSILLVVIGGLDDDK------ 456
            +T+   N + + +K   +E  IN     L  +L + +   SI  V++   D         
Sbjct: 423  ETKLLRNATATPIKRTAVEKIINRQIIRLFTVLIVLILISSIGNVIMSTADAKHLSYLYL 482

Query: 457  --------WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESD------KSIPDTIV 502
                    ++ D + + ILFS ++P+SL V ++L K   A  I SD      K+   T+V
Sbjct: 483  EGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTVV 542

Query: 503  RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMV-TDYIQTLTSPA 561
            RTS++ E+LG+IEY+ SDKTGTLT+N M+ +   +    Y    +D +  D   T+    
Sbjct: 543  RTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCY----IDKIPEDKTATVEDGI 598

Query: 562  NMGAAGV-----AVTGSRKEVSQRVRDLVVTLATCHNVTPNFE-DNELAYQAASPDEIAI 615
             +G          +     E S  + D +  LATCH V P F+ D  + YQAASPDE A+
Sbjct: 599  EVGYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGAL 658

Query: 616  VKFTERVGLSLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIW 675
            V+    +G     R  +S+T+  E +G   +Y +L++  F S  KRM  I R      I 
Sbjct: 659  VQGGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFR-FPDGSIK 717

Query: 676  FLQKGADTVMSKIV--QSNDWLE---EEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYK 730
               KGADTV+ + +  ++N ++E     + + A EGLRTL +A + +S   YE+++  Y 
Sbjct: 718  LFCKGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYN 777

Query: 731  DASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTG 790
            +A+ ++ NR E ++E     +E NL L+G T +EDKLQ  V  +I  L+ AG+KIW+LTG
Sbjct: 778  EAATTLDNRAEKLDEAANL-IEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTG 836

Query: 791  DKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKA----------NRNSCLL 840
            D+ ETA  + +S +L+S    +  I + TR D   + LE + A           ++  L+
Sbjct: 837  DRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALV 896

Query: 841  IDGDSLAIYMSHYRAEFFEIVICL-PVVIACRCTPQQKADVALLIREMTGKRVCCIGDGG 899
            IDG SL   +     ++   V  L   VI CR +P QKA V  +++  +   +  I  G 
Sbjct: 897  IDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIASGA 956

Query: 900  NDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVI 959
            NDVSMIQ A VGVGI G EG QA+ +AD ++ QF  L KLLL HG  SY+R +    +  
Sbjct: 957  NDVSMIQAAHVGVGISGMEGMQAARSADIALGQFKFLKKLLLVHGSWSYQRISVAILYSF 1016

Query: 960  HRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDESLTKTY 1018
            ++   + + Q  Y  ++     ++ + W M  Y   +T+ P F +   D  +   L + Y
Sbjct: 1017 YKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERY 1076

Query: 1019 PELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFIG 1059
            P+LYK   +G+  S   F+ W+I   F  A++      FIG
Sbjct: 1077 PQLYKLGQKGQFFSVYIFWGWIINGFFHSAIV------FIG 1111

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score =  444 bits (1143), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 322/1047 (30%), Positives = 537/1047 (51%), Gaps = 90/1047 (8%)

Query: 173  REIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPAL 232
            REIH+      ++  Y  N IS  KYNA TFLP  L+++F  + NL+FL  S  Q +P +
Sbjct: 166  REIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHV 225

Query: 233  RIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQ--LVPSK--NL 288
                  + I  L  VL+V+  KE+++D++R   D E NN   E+   ++   +  +  ++
Sbjct: 226  SPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGDFIQKRWIDI 285

Query: 289  RVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQDEM 348
            +VGD+++++ +  IPAD+I+L SSEP G  +++T  LDGET+ K++ A + T  +     
Sbjct: 286  KVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRE 345

Query: 349  LTKVH--ITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVACVIYTGT 406
            L  +   I++  P  S++ + G L   G+  PLS +  +     L ++G     VI+TG 
Sbjct: 346  LRNIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGH 405

Query: 407  DTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLD-------DDK--- 456
            +T+   N + + +K   +E  IN    +  I +FT+ ++L++I  +        D K   
Sbjct: 406  ETKLMRNATATPIKRTAVEKVIN----MQIIALFTVLVVLILISSIGNVIMSTADAKHLS 461

Query: 457  ------------WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESD------KSIP 498
                        ++ D + + ILFS ++P+SL V ++L K   A  I SD      ++  
Sbjct: 462  YLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDT 521

Query: 499  DTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVTDYIQTLT 558
             T+V+TS++ E+LG+IEY+ SDKTGTLT+N M+ +   +    Y     +   D   T  
Sbjct: 522  PTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPE---DKAATFE 578

Query: 559  SPANMGAAGVAVTGSRKEVSQR------VRDLVVTLATCHNVTPNFE-DNELAYQAASPD 611
                +G    +    +K+++        + + +  LATCH V P F+ D  + YQAASPD
Sbjct: 579  DGIEVGYR--SFDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIPEFQADGSIKYQAASPD 636

Query: 612  EIAIVKFTERVGLSLFKRDRHSLT-LFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRT 670
            E A+V+    +G     R  +S+T L +E      +Y +L++  F S  KRM  I R   
Sbjct: 637  EGALVEGGALLGYKFLIRKPNSVTILINEEE--EREYQLLNICEFNSTRKRMSAIFR-FP 693

Query: 671  KNEIWFLQKGADTV-MSKIVQSNDWLEE----EVSNMAREGLRTLVIARKKLSTRLYEQF 725
             + I  L KGAD+V + ++ ++ ++  +     + + A EGLRTL +A K +    Y  +
Sbjct: 694  DDSIKLLCKGADSVILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAW 753

Query: 726  SKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKI 785
            +K+Y DA+ ++ +R E ++ V +  +E  L L+G T +EDKLQ+ V  +I  L+ AG+KI
Sbjct: 754  NKKYMDAATTLDHRAEKLDAVAEE-IESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKI 812

Query: 786  WMLTGDKVETARCVCVSAKLISRGQYVHTITK----LTRRD-----GALSRLEYLKANRN 836
            W+LTGDK ETA  + +S +L+S    +  I++     TRR+      AL      + + N
Sbjct: 813  WVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMN 872

Query: 837  S-CLLIDGDSLAIYMSHYRAEFFEIV--ICLPVVIACRCTPQQKADVALLIREMTGKRVC 893
            +  L+IDG SL+  +     ++F  +  +C   VI CR +P QKA V  +++  T   + 
Sbjct: 873  TLALVIDGHSLSFALEADLEDYFLAIGKMC-KAVICCRVSPLQKALVVKMVKRKTNSLLL 931

Query: 894  CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAK 953
             IGDG NDVSMIQ A VGVGI G EG QA+ +AD S+ QF  L KLLL HG  SY+R + 
Sbjct: 932  AIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQRISV 991

Query: 954  LSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDE 1012
               +  ++   + + Q  Y  ++     ++ + W M  Y   +T+ P F +   D  ++ 
Sbjct: 992  AILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNS 1051

Query: 1013 SLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAVI---------QGFSQLFIGVGSE 1063
             L + YP+LYK   +G+  S   F+ W++   +  AV+          GF+    G  ++
Sbjct: 1052 RLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGETAD 1111

Query: 1064 VFKKMVALSFTALVINELIMVALEIYTWNKTMAISEIVTFAIYVLSIPLLGEYFDLTSML 1123
             +   +A+ +T+ VI  L   AL    W K    +   +   +++  P+ G  F    + 
Sbjct: 1112 HWSWGIAI-YTSSVIIVLGKAALVTNQWTKFTLFAIPGSLFFWLIFFPIYGSIFPYAKIS 1170

Query: 1124 ALPF------FIQLTIILTVSIFPVWA 1144
               F      +   T  LT+ + P +A
Sbjct: 1171 REYFGVVEHTYGSATFWLTLIVLPTFA 1197

>Kwal_26.7070
          Length = 1315

 Score =  444 bits (1141), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 301/953 (31%), Positives = 496/953 (52%), Gaps = 68/953 (7%)

Query: 168  DQHVDREIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQ 227
            D+   R+I+++       R + +N IS  KYN  TF+P  L+++F  + NL+FL  S  Q
Sbjct: 177  DKSSPRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQ 236

Query: 228  SIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEV----LNNSQLV 283
             +P +      + I  L  VL+V+  KE ++D++R + D E N+   +V    L +  L 
Sbjct: 237  QVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTLS 296

Query: 284  PSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNL 343
               N+ VGD++K++ +  IPAD+I++ SSEP G  +++T  LDGET+ K++ A   T   
Sbjct: 297  KWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKF 356

Query: 344  TQDEMLTKVH--ITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVACV 401
               + L  +   + +  P  S++ + G +   G +  LS +  +     L ++      V
Sbjct: 357  IDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGATLRNTAWIYGLV 416

Query: 402  IYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDD------- 454
            ++TG +T+   N + + +K   +E  IN    +  + +F + I+L +I  + +       
Sbjct: 417  VFTGHETKLMRNATATPIKRTAVERVIN----MQIVALFGVLIVLALISSIGNVIKVTSD 472

Query: 455  ---------------DKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPD 499
                             ++ DI+ Y ILFS ++P+SL V +++ K   A  I SD  + D
Sbjct: 473  AEHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYD 532

Query: 500  ------TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVTDY 553
                  T+VRTS++ E+LG+IEY+ SDKTGTLT+N M+ +   +    Y +ET+    D 
Sbjct: 533  EASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCY-IETIP--EDK 589

Query: 554  IQTLTSPANMG-----AAGVAVTGSRKEVSQRVRDLVVTLATCHNVTPNF-EDNELAYQA 607
              T      +G     +    +  ++   S  + D +  LATCH V P F ED  + YQA
Sbjct: 590  AATTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQA 649

Query: 608  ASPDEIAIVKFTERVGLSLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVR 667
            ASPDE A+V+    +G     R  +S+++  E  G   +Y +L++  F S  KRM  I R
Sbjct: 650  ASPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFR 709

Query: 668  DRTKNEIWFLQKGADTVMSKIVQS--NDWLE---EEVSNMAREGLRTLVIARKKLSTRLY 722
                 EI    KGADTV+ + +++  N ++E     + + A EGLRTL +A + ++   Y
Sbjct: 710  -LPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEY 768

Query: 723  EQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAG 782
             ++   Y  AS ++ +R + +++  +  +E +L LLG T +EDKLQ  V  +I  L++AG
Sbjct: 769  AEWKDIYDAASTTLDDRAQKLDDAAEL-IEKDLFLLGATAIEDKLQDGVPETIHTLQDAG 827

Query: 783  VKIWMLTGDKVETARCVCVSAKLISRGQYVHTITK---------LTRRDGALSRLEYLKA 833
            +K+W+LTGD+ ETA  + +S +L+S    +  I +         LT +  A+S  +  + 
Sbjct: 828  IKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQ 887

Query: 834  NRNS-CLLIDGDSLAIYMSHYRAEFFEIV--ICLPVVIACRCTPQQKADVALLIREMTGK 890
            + NS  L+IDG SL   +     ++   +  +C   VI CR +P QKA V  +++  T  
Sbjct: 888  DMNSLALVIDGKSLGFALEADLEDYLLAIGKLC-KAVICCRVSPLQKALVVKMVKRKTDS 946

Query: 891  RVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKR 950
             +  IGDG NDVSMIQ A VGVGI G EG QA+ +AD++I QF +L KLLL HG  SY+R
Sbjct: 947  LLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQR 1006

Query: 951  SAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVFSL-TLDHD 1009
             ++   +  ++ + + + Q  Y  ++     ++ + W M  Y   +T+ P F +   D  
Sbjct: 1007 ISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQF 1066

Query: 1010 IDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFIGVGS 1062
            +   L   YP+LYK    G+  S + F+ WVI   +  AV    S LF   G+
Sbjct: 1067 VSSRLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGN 1119

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score =  417 bits (1072), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 293/877 (33%), Positives = 463/877 (52%), Gaps = 81/877 (9%)

Query: 188  YPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPALRIGYLSSYIVPLAFV 247
            Y  N IS  KYNA TFLP  L+++F  + NL+FL  S+ Q +P +      + I  L  V
Sbjct: 194  YGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFTTIGTLIVV 253

Query: 248  LVVTMSKEAMDDIQRRRRDRETNNELYEVLNN--SQLVPSK--NLRVGDLVKLHKDSRIP 303
            LVV+  KE+++D++R   D+E N+   +V ++   Q +  K  ++ VGD++++  +  IP
Sbjct: 254  LVVSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIP 313

Query: 304  ADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQDEMLTKVH--ITASAPEK 361
            AD+I+L SSEP G  +++T  LDGET+ K++ A   T  +     L+ +   I +  P  
Sbjct: 314  ADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELSAMRGKILSEQPNT 373

Query: 362  SIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVACVIYTGTDTRQAMNTSKSSVKT 421
            S++ + G +    +  PLS D  L     L ++      VI+TG +T+   N + + +K 
Sbjct: 374  SLYTYEGTMILHNNRIPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIKR 433

Query: 422  GLLE----LEINSLSKILCICVFTLSIL--LVVIGGLDDDKWYV-------------DIM 462
              +E    L+I +L  +L IC+  +S    L+V+    ++  Y+             +I+
Sbjct: 434  TAVERVINLQIVALFGVL-ICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFFKNIL 492

Query: 463  RYLILFSTIIPVSLRVNLDLGKSVYARQIESD------KSIPDTIVRTSTIPEDLGRIEY 516
             + ILFS ++P+SL V +++ K   A  I SD      +S   T+VRTS++ E+LG+IEY
Sbjct: 493  TFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEY 552

Query: 517  LLSDKTGTLTQNDMQLRKIHLGTVSYTM---ETMDMV------------TDYIQTLTSPA 561
            + SDKTGTLTQN M+ +   +    Y     E  D               D  + L +P 
Sbjct: 553  IFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEVGYRTYDDMHELLHTP- 611

Query: 562  NMGAAGVAVTGSRKEVSQRVRDLVVTLATCHNVTPNFEDN-ELAYQAASPDEIAIVKFTE 620
              G+   A+          + + +  L+ CH V P F++N  + YQAASPDE A+V+   
Sbjct: 612  --GSGDGAI----------IDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAA 659

Query: 621  RVGLSLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKG 680
             +G     R  +S+T+  E     + Y++L++  F S  KRM  I R    N I  L KG
Sbjct: 660  DLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFR-FPDNSIRLLCKG 718

Query: 681  ADTVMSK--IVQSNDWLE---EEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLS 735
            ADTV+ +     SN ++      + + A EGLRTL IA + +    YE++SK Y  A+ +
Sbjct: 719  ADTVILERLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATT 778

Query: 736  MLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVET 795
            M NR E +++V +  +E  L LLG T +EDKLQ  V  +I  L+ AG+K+W+LTGD+ ET
Sbjct: 779  MHNRSEELDKVAE-MIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQET 837

Query: 796  ARCVCVSAKLISRGQ---YVHTITKLTRRDGALSRLEYLKANRNS-------CLLIDGDS 845
            A  + +S KL+S       V+  TK + R+  + +L  +  ++ S        L+IDG S
Sbjct: 838  AINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKS 897

Query: 846  LAIYMSHYRAEFFEIV--ICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVS 903
            L   +     EF   +  +C   VI CR +P QKA V  +++  T   +  IGDG NDVS
Sbjct: 898  LGFALEPDLEEFLLAIGKMCR-AVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVS 956

Query: 904  MIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIHRGL 963
            MIQ A VGVGI G EG QA+ +AD+++ QF +L KLLL HG  SY+R ++   +  ++ +
Sbjct: 957  MIQAAHVGVGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNI 1016

Query: 964  LISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAP 1000
             + + Q  Y + +     ++ + W +  Y    T AP
Sbjct: 1017 ALYMTQFWYVLYNAFSGQSIMESWTLTFYNWGGTAAP 1053

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score =  360 bits (925), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 279/986 (28%), Positives = 482/986 (48%), Gaps = 152/986 (15%)

Query: 286  KNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNL-- 343
            K ++VGD+V++H +  IPAD+ILL +S+  G  +V+T  LDGET+ K+R +   T  +  
Sbjct: 399  KGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRT 458

Query: 344  TQDEMLTKVHITASAPEKSIHMFTGKLTYKG------SSAPLSVDNTLWANTVLASSGTC 397
            ++D   TK  I +  P  +++ + G + ++        + P++++N L     L ++   
Sbjct: 459  SKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWA 518

Query: 398  VACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDK- 456
            +  V++TG DT+  +N+  +  K   +  E+N    I  + +F L  +  +  G+  DK 
Sbjct: 519  MGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKK 578

Query: 457  -------------------WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSI 497
                                +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 579  GRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 638

Query: 498  PDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSY--------- 542
             +  +      ++  I +DLG++EY+ SDKTGTLTQN M+ +K  +  VSY         
Sbjct: 639  YNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 698

Query: 543  --------TMET------------MDMVTDYIQTLTSPANMGAAGVA---------VTGS 573
                     +ET             D + D ++ L+  +      V          + G+
Sbjct: 699  GLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGA 758

Query: 574  RKEVSQRV-RDLVVTLATCHNV----TPNFEDNELAYQAASPDEIAIVKFTERVGLSLFK 628
              EV QR     ++ LA CH+V     P+    +L  +A SPDE A+V     VG S   
Sbjct: 759  SGEVQQRCCEHFMLALALCHSVLVEANPD-NPKKLDLKAQSPDEAALVATARDVGFSFVG 817

Query: 629  RDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKN-----EIWFLQKGADT 683
            + +  L +  E  G+  +++IL++  F S  KRM  IV+    N         + KGAD+
Sbjct: 818  KTKKGLII--EMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADS 875

Query: 684  V----MSKIVQSNDW--LEE---EVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASL 734
            +    +S+   SN    LE+    +   A EGLRTL IA+++LS   YE+++++Y  A+ 
Sbjct: 876  IIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAA 935

Query: 735  SMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVE 794
            S+ NR++ + EVV   +E  L LLG T +ED+LQ  V   IELL  AG+K+W+LTGDKVE
Sbjct: 936  SLANREDEL-EVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVE 994

Query: 795  TARCVCVSAKLISR-----------------------------GQYVHTITKLTRRDGAL 825
            TA  +  S  L++                               +Y+     LT  +  +
Sbjct: 995  TAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEI 1054

Query: 826  --SRLEYLKANRNSCLLIDGDSL--AIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVA 881
              ++ ++     N  ++IDGD+L  A+Y    R +F  +      V+ CR +P QKA V 
Sbjct: 1055 FEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVV 1114

Query: 882  LLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLL 941
             L+++        IGDG NDV+MIQ ADVG+GI G+EG+QA + +DY+I QF +L +L+L
Sbjct: 1115 KLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVL 1174

Query: 942  WHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPV 1001
             HGR SYKR A++     ++ ++ ++    Y I ++     LY+   M+ Y   +T  PV
Sbjct: 1175 VHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPV 1234

Query: 1002 FSL-TLDHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFIGV 1060
              L  LD D++++++   P+LY+     +  + + F  +++  L+Q  +   F  L    
Sbjct: 1235 IFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYL---- 1290

Query: 1061 GSEVFKKMVALSFTALVINELIMVALEIYTWNKTMAISEIVTFAIYVLSIPLLGEY-FDL 1119
               V+ K + ++   L ++    V + +     T+A+    T+        LL +Y +D 
Sbjct: 1291 ---VYHKNMIVTSNGLGLDHRYFVGVYV----TTIAVISCNTYV-------LLHQYRWDW 1336

Query: 1120 TSMLALPFFIQLTIILTVSIFPVWAA 1145
             S L    FI L+ ++  +   +W++
Sbjct: 1337 FSGL----FIALSCLVVFAWTGIWSS 1358

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 48/91 (52%)

Query: 187 KYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPALRIGYLSSYIVPLAF 246
           +YP N I   KY  +TFLP  +  QF  F N+YFL++ +  +     +       VPL  
Sbjct: 190 QYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPGLSAVPLVV 249

Query: 247 VLVVTMSKEAMDDIQRRRRDRETNNELYEVL 277
           ++++T  K+A++D +R   D E NN    +L
Sbjct: 250 IVIITAIKDAIEDSRRTVLDLEVNNTKTHIL 280

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score =  352 bits (903), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 273/965 (28%), Positives = 466/965 (48%), Gaps = 148/965 (15%)

Query: 286  KNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNL-- 343
            K+++VGD+V++H +  IPAD+ILL +S+  G  +V+T  LDGET+ K+R A   +  +  
Sbjct: 395  KSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKT 454

Query: 344  TQDEMLTKVHITASAPEKSIHMFTGKLTYKGSS------APLSVDNTLWANTVLASSGTC 397
            ++D   T+  I +  P  +++ + G L +K S+       P++++N L     L ++   
Sbjct: 455  SRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWA 514

Query: 398  VACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDK- 456
            +  V++TG DT+  +N   +  K   +  E+N    I  + +F L  +  +  G+D DK 
Sbjct: 515  MGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKH 574

Query: 457  -------------------WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSI 497
                                +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 575  PRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 634

Query: 498  PDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVT 551
             +  +      ++  I +DLG+IEY+ SDKTGTLTQN M+ +K  +  VSY         
Sbjct: 635  YNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRA------ 688

Query: 552  DYIQTLTSPANMGAAGVAVTGSR-KEVSQRVRDLVVT----------------------- 587
             Y + L          V   G R KE   + RD+++                        
Sbjct: 689  -YTEALAGLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEI 747

Query: 588  ----------------------LATCHNV----TPNFEDNELAYQAASPDEIAIVKFTER 621
                                  LA CH+V    +P    N+L  +A SPDE A+V     
Sbjct: 748  VQDFKGRNGDIQKKCCEHFMLALALCHSVLTEPSPT-NPNKLEMKAQSPDEAALVTTARD 806

Query: 622  VGLSLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVR--DRTKNE---IWF 676
            +G     + +  + +  E  G+  +++IL++  F S  KRM  I++    T N+      
Sbjct: 807  LGFCFMGKTKTGMVV--EIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALL 864

Query: 677  LQKGADTVM-----SKIVQSNDWLEEEVS----NMAREGLRTLVIARKKLSTRLYEQFSK 727
            + KGAD+V+     +K  ++++ L E+ +      A EGLRTL +A+++L+   Y +++ 
Sbjct: 865  ICKGADSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNA 924

Query: 728  EYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWM 787
             Y  A+ S+ NR+E + E+V   +E +L LLG T +ED+LQ  V  SI LL  AG+K+W+
Sbjct: 925  RYDIAAASLTNREEQL-EIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWV 983

Query: 788  LTGDKVETARCVCVSAKLISR-----------------GQYVHT-----ITKLTRRDGAL 825
            LTGDKVETA  +  S  L++                  G+  H      I+K  R    L
Sbjct: 984  LTGDKVETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGL 1043

Query: 826  S----RLEYLKANR-----NSCLLIDGDSLAIYMS--HYRAEFFEIVICLPVVIACRCTP 874
            S     L+  K +      +  ++IDGD+L I ++    + +F  +      V+ CR +P
Sbjct: 1044 SGSEMELDNAKGDHSFPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSP 1103

Query: 875  QQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFC 934
             QKA V  L++         IGDG NDV+MIQ ADVG+GI G+EG+QA + +DY+I QF 
Sbjct: 1104 AQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFR 1163

Query: 935  HLTKLLLWHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYAT 994
            +LT+LLL HGR SYKR +++     ++ ++ ++    Y I +N     L++   ++ Y  
Sbjct: 1164 YLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNL 1223

Query: 995  CYTMAPVFSL-TLDHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVIL-SLFQGAVIQG 1052
             +T  PV  L  LD D++++++   P+LY+ +   R    +T F+W +   L+Q  +   
Sbjct: 1224 AFTSIPVILLGILDQDVNDTISLVVPQLYR-VGILRLEWNQTKFLWYMFDGLYQSVICFF 1282

Query: 1053 FSQLFIGVGSEVFKKMVALS---FTALVINELIMVALEIYTWNKTMAISEIVTFAIYVLS 1109
            F  L       V K  + L    +  +++  + + A  +Y             F I++  
Sbjct: 1283 FPYLLYKRNGVVTKNGMGLEHRYYVGIIVTTIAVFACNLYILIHQYRWDWFSGFFIFLSC 1342

Query: 1110 IPLLG 1114
            I ++G
Sbjct: 1343 IVVIG 1347

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 74/149 (49%), Gaps = 11/149 (7%)

Query: 162 HSIELTDQHVDREIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFL 221
           H++ L ++ +D E      PI +   YP N I   KY  ++F P  L  QF+ F N+YFL
Sbjct: 165 HNLPLPEEMLDEE----GNPIME---YPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFL 217

Query: 222 LVSLSQSIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQ 281
           ++ +  +     +       VPL  ++++T  K+ ++D +R   D E NN    +L   +
Sbjct: 218 VLIILGAFQIFGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHIL---E 274

Query: 282 LVPSKNLRVGDLVKLHKDSRIPADMILLQ 310
            V ++N+ V D V L +  +     +L+Q
Sbjct: 275 GVVNENVSV-DNVSLWRRFKKANSRLLMQ 302

>Scas_576.8
          Length = 1591

 Score =  351 bits (900), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 266/932 (28%), Positives = 457/932 (49%), Gaps = 132/932 (14%)

Query: 286  KNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNL-- 343
            KN++VGD+V++H +  IPAD+ILL +S+  G  +++T  LDGET+ K+R +   + ++  
Sbjct: 415  KNVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETNLKVRESLKCSHSIRN 474

Query: 344  TQDEMLTKVHITASAPEKSIHMFTGKLTYKGS------SAPLSVDNTLWANTVLASSGTC 397
            ++D   TK  + +  P  +++ + G + +  S      + P++++N L     L ++   
Sbjct: 475  SRDIARTKFWVESEGPHANLYSYQGNVKWVDSKDGDLKNEPVTINNLLLRGCTLRNTKWA 534

Query: 398  VACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDKW 457
            +  V++TG DT+  +N+  +  K   +  E+N    +  + +F +  +  +I G+D DK 
Sbjct: 535  MGMVVFTGDDTKIMLNSGATPTKKSRISRELNLSVSLNFLFLFIICFISAIINGVDYDKH 594

Query: 458  --------------------YVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSI 497
                                +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 595  PRSRDFFEFGTVAGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 654

Query: 498  PDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSY--------- 542
             +  +      ++  I +D+G+IEY+ SDKTGTLTQN M+ +K  +  +SY         
Sbjct: 655  YNAKLDYPCTPKSWNISDDMGQIEYIFSDKTGTLTQNVMEFKKCTINGISYGRAYTEALA 714

Query: 543  --------------------TMETMDMVTDYIQTLTSPANMGAAGVA---------VTGS 573
                                  +  D + + ++ L+  +      +          + G+
Sbjct: 715  GLRKRQGIDVEEEGRREKEEIAKDRDTMINTLRNLSHNSQFYPDDITFISKEFVNDLKGA 774

Query: 574  RKEVSQRV-RDLVVTLATCHNV--TPNFEDNE-LAYQAASPDEIAIVKFTERVGLSLFKR 629
              ++ Q+     ++ LA CH+V   PN  D++ L  +A SPDE A+V     VG S   +
Sbjct: 775  SGDMQQKCCEHFMLALALCHSVLVEPNKHDSKKLDVKAQSPDEAALVCTARDVGFSFIGK 834

Query: 630  DRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKN-----EIWFLQKGADTV 684
             +  L +  E  GV  ++ IL+   F S  KRM  IV+    N         + KGAD++
Sbjct: 835  TKTGLII--EVQGVQKEFQILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKGADSI 892

Query: 685  M-SKI-----VQSNDWLEE---EVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLS 735
            + S++       S + LE+    +   A EGLRTL IA+++LS   Y +++K Y  A+ S
Sbjct: 893  IYSRLGTKNGANSENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAAS 952

Query: 736  MLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVET 795
            + NR+E + E V   +E  L LLG T +ED+LQ  V  SI +L  AG+K+W+LTGDKVET
Sbjct: 953  VTNREEQL-EAVSDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVET 1011

Query: 796  ARCVCVSAKLI----------SRGQYVHT------------ITKLTRRDGAL--SRLEYL 831
            A  +  S  L+          + G  V              ITK  R    L  S +E  
Sbjct: 1012 AINIGFSCNLLNNDMELLVVKTNGDDVQEFGNDPAEIAESLITKYLREKFGLTGSEMELA 1071

Query: 832  KANRNS-------CLLIDGDSLAIYMS--HYRAEFFEIVICLPVVIACRCTPQQKADVAL 882
             A +N         ++IDG++L + ++    R +F  +      V+ CR +P QKA V  
Sbjct: 1072 DAKKNHDFPRGDFAVVIDGEALKLALNGESIRRKFLLLCKNCKAVLCCRVSPAQKAAVVK 1131

Query: 883  LIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLW 942
            L+          IGDG NDV+MIQ ADVGVGI G+EG+QA + +DY+I QF +LT+L+L 
Sbjct: 1132 LVMTSLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYLTRLVLV 1191

Query: 943  HGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPV- 1001
            HGR SY+R A++     ++ ++ ++    Y I +N     L++   ++ Y   +T  PV 
Sbjct: 1192 HGRWSYRRLAEMIPAFFYKNVIFTLALFWYGIYNNFDGSYLFEYTFLMFYNLAFTSLPVI 1251

Query: 1002 FSLTLDHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVIL-SLFQGAVIQGFSQLFIGV 1060
            F   +D D+ ++++   P+LY+     R    +T F+W +L  L+Q  +   F       
Sbjct: 1252 FMGIMDQDVSDTVSLVMPQLYRSGIL-RLDWNQTKFLWYMLDGLYQSCICFFFPYCLYHK 1310

Query: 1061 GSEVFKKMVALS---FTALVINELIMVALEIY 1089
               V    + L    +  +++  L +V+  IY
Sbjct: 1311 NQIVSNNGLGLDHRFYVGVMVTSLAVVSCNIY 1342

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 58/116 (50%), Gaps = 7/116 (6%)

Query: 162 HSIELTDQHVDREIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFL 221
           +++ L  + VD     D  PI D   YP N I   KY+ + F P  +  QF+ F N+YFL
Sbjct: 182 YNMPLPKEMVDE----DGKPITD---YPRNKIRTTKYSPLNFFPKNIMFQFQNFANVYFL 234

Query: 222 LVSLSQSIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVL 277
           ++ +  +     +       VPL  ++++T  K+A++D +R   D E NN    +L
Sbjct: 235 VLIILGAFQIFGVTNPGLAAVPLIVIVIITAIKDAIEDSRRTLLDMEVNNTRTHIL 290

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score =  344 bits (882), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 275/955 (28%), Positives = 476/955 (49%), Gaps = 140/955 (14%)

Query: 286  KNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNL-- 343
            KN++VGD+V++H +  IPADMILL +S+  G  +V+T  LDGET+ K+R +   ++ +  
Sbjct: 444  KNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKS 503

Query: 344  TQDEMLTKVHITASAPEKSIHMFTGKLTYKGS------SAPLSVDNTLWANTVLASSGTC 397
            ++D   TK  + +  P  +++ + G   ++ +      + P++++N L     L ++   
Sbjct: 504  SRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWA 563

Query: 398  VACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKI-----LCICVFTLSILLVV---- 448
            +  VI+TG DT+  +N   +  K   +  E+N  S I     L I  FT  I+  V    
Sbjct: 564  MGMVIFTGDDTKIMINAGVTPTKKSRISRELN-FSVILNFVLLFILCFTAGIVNGVYYKQ 622

Query: 449  ------------IGGLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKS 496
                        IGG      +V     +IL+ +++P+SL +++++ K+  A  I +D  
Sbjct: 623  KPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYTDVL 682

Query: 497  IPDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSY-------- 542
            + +  +      ++  I +DLG+IEY+ SDKTGTLTQN M+ +K  +  VSY        
Sbjct: 683  LYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEAL 742

Query: 543  ---------------------TMETMDMVTDYIQTLTS-----PANMGAAGVAVT----G 572
                                   +  + + D +++++      P ++      +     G
Sbjct: 743  AGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVEDLKG 802

Query: 573  SRKEVSQR-VRDLVVTLATCHN--VTPNFED-NELAYQAASPDEIAIVKFTERVGLSLFK 628
            S  +  Q+     ++ LA CH+  V PN +D  +L  +A SPDE A+V    ++G S   
Sbjct: 803  SSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFVG 862

Query: 629  RDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVR-----DRTKNEIWFLQKGADT 683
              +  L +  E  GV  ++ +L+V  F S  KRM  I++      + + +   + KGAD+
Sbjct: 863  SSKSGLIV--EIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADS 920

Query: 684  VM-SKI--VQSNDWLEEEVS----NMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSM 736
            V+ S++   Q++  L E+ +      A EGLRTL +A+++L+   YE++ K Y  A+ S+
Sbjct: 921  VIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASV 980

Query: 737  LNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETA 796
             NR+E +++V    +E  L LLG T +ED+LQ  V  SI LL  AG+K+W+LTGDKVETA
Sbjct: 981  TNREEELDKVTDV-IERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETA 1039

Query: 797  RCVCVSAKLISR----------GQYV------------HTITKLTRRDGAL--SRLEYLK 832
              +  S  +++           G+ V            + +TK  R    +  S  E  +
Sbjct: 1040 INIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKE 1099

Query: 833  ANR-------NSCLLIDGDSLAIYMS--HYRAEFFEIVICLPVVIACRCTPQQKADVALL 883
            A R       N  ++IDGD+L + ++    R +F  +      V+ CR +P QKA V  L
Sbjct: 1100 AKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPAQKAAVVKL 1159

Query: 884  IREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWH 943
            +++        IGDG NDV+MIQ ADVGVGI G+EG+QA + +DY+I QF ++T+L+L H
Sbjct: 1160 VKKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVH 1219

Query: 944  GRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVFS 1003
            G+  YKR A++     ++ ++ ++    Y I +N     L++   +  Y   +T  PV  
Sbjct: 1220 GKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVPVIL 1279

Query: 1004 LT-LDHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVIL-SLFQGAVIQGFSQLFI--- 1058
            L  LD D+ ++++   P+LY+ +   R    +T F+W +L  ++Q  +   F  L     
Sbjct: 1280 LAVLDQDVSDTVSMLVPQLYR-VGILRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYHKN 1338

Query: 1059 ------GVGSEVFKKMVALSFTALVINEL-IMVALEIYTWNKTMAISEIVTFAIY 1106
                  G+G +  +  V +  TA+ +      V +E Y W+    +   ++ A++
Sbjct: 1339 MVVTENGLGLD-HRYFVGVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLSLAVF 1392

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 54/106 (50%), Gaps = 3/106 (2%)

Query: 188 YPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPALRIGYLSSYIVPLAFV 247
           YP N I   KY  +TF P  +  QF  F N+YFL++ +  +     +       VPL  +
Sbjct: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288

Query: 248 LVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQLVPSKNLRVGDL 293
           +++T  K+ ++D +R   D E NN    +L+    V ++N+ V ++
Sbjct: 289 VIITAIKDGIEDSRRTVLDLEVNNTRTHILSG---VKNENVAVDNV 331

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score =  343 bits (879), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 279/987 (28%), Positives = 462/987 (46%), Gaps = 160/987 (16%)

Query: 286  KNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNL-- 343
            K++RVGD+V++H +  IPAD+ILL +S+  G  +V+T  LDGET+ K+R +   +  +  
Sbjct: 406  KDIRVGDIVRIHNNDEIPADIILLSTSDADGACYVETKNLDGETNLKVRQSLKCSHRIRN 465

Query: 344  TQDEMLTKVHITASAPEKSIHMFTGKLTYKGS------SAPLSVDNTLWANTVLASSGTC 397
            ++D    K  + +  P  +++ + G   +  S      + P++++N L     L ++   
Sbjct: 466  SKDISRCKFWVESEGPHANLYSYQGNFKWVDSETGVMHNEPVNINNMLLRGCSLRNTKWA 525

Query: 398  VACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDKW 457
            +  V++TGTDT+  +N   +  K   +  E+N       I  F    +L +  GL +  +
Sbjct: 526  MGIVMFTGTDTKIMLNAGVTPTKRSRISRELN----YSVILNFVFLFVLCLAAGLVNGIY 581

Query: 458  Y------------------------VDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIES 493
            Y                        +     LIL+ +++P+SL +++++ K+  A  I  
Sbjct: 582  YRRDATSRTFFEFGTVAGTPFANGILAFFVALILYQSLVPISLYISIEIIKTAQAAFIYG 641

Query: 494  DKSIPDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTM--- 544
            D  + +  +      RT  I +DLG+IEY+ SDKTGTLTQN M+ +K  +  VSY     
Sbjct: 642  DVLLYNPKLDYPCTPRTWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 701

Query: 545  --------------------------ETMDMVTDYIQTLTSPANMGAAGVAVT------- 571
                                      E    + + +  L   + +    V          
Sbjct: 702  EALAGLRKRQGVDIEEEGARERAEIEEDKKQMVELLLKLGKNSQLDPHTVTFVSKELVQD 761

Query: 572  ---GSRKEVSQRVRDLVVTLATCHNVTPNFEDN---ELAYQAASPDEIAIVKFTERVGLS 625
                + +E  + V   +++LA CH+V      N   +L  +A SPDE A+V+    +G S
Sbjct: 762  LGGANSQEQKEAVEHFMLSLALCHSVVVEENKNNPEKLDIKAQSPDEAALVETARDMGFS 821

Query: 626  LFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVR-----DRTKNEIWFLQKG 680
               R ++ + +  E  GV  ++ IL+V  F S  KRM  IV+     + +K +   L KG
Sbjct: 822  FVGRTKNGVII--EIQGVQKEFRILNVLEFNSTRKRMSCIVKIPAADENSKPKALLLCKG 879

Query: 681  ADTVM-SKIVQS-ND--WLEE---EVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDAS 733
            AD+V+ S++ +S ND   LE     +   A EGLRTL +A++++    Y  +++  + A+
Sbjct: 880  ADSVIYSRLDRSRNDPKLLERTALHLEQFATEGLRTLCVAQREIDWDEYLNWNERRELAA 939

Query: 734  LSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKV 793
             S+ NR+EA+ E V   +E  L LLG T +ED+LQ  V  SI +L +AG+K+W+LTGDKV
Sbjct: 940  ASLDNREEAL-ERVADAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDKV 998

Query: 794  ETARCVCVSAKLI----------SRGQYV---------------------HTITKLTRRD 822
            ETA  +  S  L+          S G+ V                     H   K +  +
Sbjct: 999  ETAINIGFSCNLLGSDMELLVIKSSGEDVEHLGEKDSDVVLALIDKYLETHFNMKGSPEE 1058

Query: 823  GALSRLEYLKANRNSCLLIDGDSL--AIYMSHYRAEFFEIVICLPVVIACRCTPQQKADV 880
             A +R ++        ++IDGD+L  A++    R +F  +      V+ CR +P QKA V
Sbjct: 1059 LAAARKDHTPPQSAFGVVIDGDALKLALHGEDIRRKFLLLCKNCKAVLCCRVSPSQKAAV 1118

Query: 881  ALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLL 940
              L++E        IGDG NDV+MIQ ADVG+GI G+EG+QA ++ADY+I QF +LT+L+
Sbjct: 1119 VKLVKESLDVVTLAIGDGSNDVAMIQAADVGIGIAGEEGRQAVMSADYAIGQFRYLTRLV 1178

Query: 941  LWHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAP 1000
            L HGR SYKR A++     ++ +  ++    + I SN     L++   ++ Y   +T  P
Sbjct: 1179 LVHGRWSYKRLAEMIPQFFYKNITFTLALFWFGICSNYDGSYLFEYTYLMFYNLAFTSLP 1238

Query: 1001 VFSL-TLDHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFIG 1059
            V  L  +D D  + L+   P+LYK +   R+   +  F W     F G            
Sbjct: 1239 VIFLGIMDQDASDVLSVVVPQLYK-VGILRTEWTQNKFWWYC---FDG------------ 1282

Query: 1060 VGSEVFKKMVALSFTALVINELIMVALEIYTWNKTMAISEIVTFAIYVLSIPLLG-EYFD 1118
                V++ ++   F  L      ++    Y       +    TF ++V SI ++    + 
Sbjct: 1283 ----VYQSIICFFFPYLCYYRTGLITKNAY------GLDHRYTFGVFVTSIAVVSCNLYV 1332

Query: 1119 LTSMLALPFFIQLTIILTVSIFPVWAA 1145
            L       +F  L I L+  I   W  
Sbjct: 1333 LIHQYRWDWFTTLFIFLSCGILFFWTG 1359

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 50/98 (51%), Gaps = 4/98 (4%)

Query: 187 KYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPALRIGYLSSYIVPLAF 246
            YP N I   KY  ++FLP  L  QFK   N+YFLL+     +    +   +   +PL  
Sbjct: 202 NYPRNKIRTTKYTPLSFLPKNLAYQFKNAANIYFLLLVCLSFVSIFGVTNPALAAIPLIA 261

Query: 247 VLVVTMSKEAMDDIQRRRRDRETNNE----LYEVLNNS 280
           ++V+T  K+A +D +R   D E NN     L+ V NN+
Sbjct: 262 IVVITGLKDAFEDSRRTILDLEVNNMRSHILHGVENNN 299

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score =  340 bits (873), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 255/898 (28%), Positives = 435/898 (48%), Gaps = 141/898 (15%)

Query: 286  KNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQ 345
            KN++VGD+V++H +  IPAD+ILL +S+  G  +V+T  LDGET+ K+R +   T ++  
Sbjct: 406  KNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRS 465

Query: 346  --DEMLTKVHITASAPEKSIHMFTGKLTYKG------SSAPLSVDNTLWANTVLASSGTC 397
              D   T+  I +  P  +++ + G   +         + P++++N L     L ++   
Sbjct: 466  SIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWA 525

Query: 398  VACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDKW 457
            +  V +TG DT+  +N   +  K   +  E+N    +  +  F L  +L  I GL +  +
Sbjct: 526  MGVVAFTGDDTKIMLNAGVTPTKKSRISKELN----LSVLFNFALLFVLCFIAGLYNGIY 581

Query: 458  ------------------------YVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIES 493
                                    +V     +IL+ +++P+SL +++++ K+  A  I  
Sbjct: 582  HNKHPRSRDFFDFGTGTGGSATSGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYL 641

Query: 494  DKSIPDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSY----- 542
            D  + +  +      ++  I +DLG+IEY+ SDKTGTLTQN M+ +K  +  VSY     
Sbjct: 642  DVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 701

Query: 543  ------------------TMETMDMVTDYIQTLTSPANMGAAGV---------------A 569
                               +E   +  D  + +    N+                     
Sbjct: 702  EALAGLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDD 761

Query: 570  VTGSRKEVSQR-VRDLVVTLATCHNV--TPNFED-NELAYQAASPDEIAIVKFTERVGLS 625
            +TG    V Q+  +  ++ LA CH+V   P+ ED  +L  +A SPDE A+V     +G S
Sbjct: 762  LTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGFS 821

Query: 626  LFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVR-----DRTKNEIWFLQKG 680
              K+ +  + L  E  G+  ++ IL++  F S  KRM  IV+        K +   + KG
Sbjct: 822  FLKKTKEGMVL--EVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKG 879

Query: 681  ADTVMSKIVQSNDWLEE--------EVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDA 732
            AD+V+   +      EE         +   A EGLRTL +A+++LS   YE+++K+Y  A
Sbjct: 880  ADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIA 939

Query: 733  SLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDK 792
            + ++++R+E + E V   +E +L LLG T +ED+LQ  V  SI LL  AG+K+W+LTGDK
Sbjct: 940  AAAVVDREEEL-EKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDK 998

Query: 793  VETARCVCVSAKLISR-----------------------------GQYVHTITKLTRRDG 823
            VETA  +  S  L++                               QY+H    +    G
Sbjct: 999  VETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMA---G 1055

Query: 824  ALSRLEYLKANRN-----SCLLIDGDSL--AIYMSHYRAEFFEIVICLPVVIACRCTPQQ 876
            +   L+  KA  +       ++IDG++L  A+     + +F  +      V+ CR +P Q
Sbjct: 1056 SEEELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQ 1115

Query: 877  KADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHL 936
            KA V  L++         IGDG NDV+MIQ A++GVGI G+EG+QA +++DY+I QF +L
Sbjct: 1116 KAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYL 1175

Query: 937  TKLLLWHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCY 996
            T+LLL HG+  YKR A++     ++ ++ ++    + I ++     L++   +  Y   +
Sbjct: 1176 TRLLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAF 1235

Query: 997  TMAPVFSLTL-DHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGF 1053
            T  PV  L + D D+ ++++  +P+LY+     +  S +T F+W +L     +VI  F
Sbjct: 1236 TSIPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWS-QTKFLWYMLDGLYQSVIAFF 1292

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 84/186 (45%), Gaps = 15/186 (8%)

Query: 107 QPLISQDSWDYGQVKRLRSGWLGPQSSWQRL---KSWVLPGAKAG-----APLLG----- 153
           QP  +++S    Q+KRLR G    + S++R    +S  L  AK         L+G     
Sbjct: 100 QPGKNRESKSGDQIKRLRWGTQRRRKSFKRYDIGRSKTLKWAKKNIQDPLEELIGNENEA 159

Query: 154 VTATYSSTHSIELTDQHVDREIHLDTTPIYDK--RKYPTNAISNAKYNAITFLPIVLYEQ 211
              T     + EL + + ++ +  D     +K    YP N I   KY  +TFLP  +  Q
Sbjct: 160 TDETGMRNKADELRNIYFNQPLPQDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQ 219

Query: 212 FKFFFNLYFLLVSLSQSIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNN 271
           F  F N+YFL++ +  +     +       VPL  ++++T  K+ ++D +R   D E NN
Sbjct: 220 FHNFANIYFLILIILGAFQIFGVTNPGFSAVPLIVIIIITAIKDGIEDSRRTVLDLEVNN 279

Query: 272 ELYEVL 277
               VL
Sbjct: 280 TKTHVL 285

>Scas_636.16
          Length = 1554

 Score =  338 bits (867), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 255/942 (27%), Positives = 456/942 (48%), Gaps = 140/942 (14%)

Query: 286  KNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNL-- 343
            KN+RVGD+V++H +  IPAD+ILL +S+  G  +V+T  LDGE++ K+R +   T  +  
Sbjct: 378  KNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRN 437

Query: 344  TQDEMLTKVHITASAPEKSIHMFTGKLTYKGS------SAPLSVDNTLWANTVLASSGTC 397
            ++D   TK  + +  P  +++++ G L +  S      + P++++N L     L ++   
Sbjct: 438  SRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWA 497

Query: 398  VACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVV--------- 448
            +  V++TG DT+  +N   +  K   +  E+N    I  + +F L ++  V         
Sbjct: 498  MGIVVFTGDDTKTMINAGVTPTKKSRISRELNFSVLINFVFLFILCLIAGVANGAYYRKK 557

Query: 449  -----------IGGLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSI 497
                       I G      +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 558  PRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVLL 617

Query: 498  PDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSY--------- 542
             +  +      ++ +I +DLG+IEY+ SDKTGTLTQN M+ +K  +  VSY         
Sbjct: 618  YNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 677

Query: 543  --------------------TMETMDMVTDYIQTLTSPANMGAAGVAVT---------GS 573
                                  +  +++ D ++ +++ +      +            G+
Sbjct: 678  GLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQDLLGN 737

Query: 574  RKEVSQ-RVRDLVVTLATCHNV--TPNFED-NELAYQAASPDEIAIVKFTERVGLSLFKR 629
              EV Q R +  ++ LA CH+V   P+  D N+L   A SPDE A+V     +G S   +
Sbjct: 738  NGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGK 797

Query: 630  DRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVR-----DRTKNEIWFLQKGADTV 684
             +  L +  E  G+  ++ IL++  F S  KRM  IV+     ++ +     + KGAD+V
Sbjct: 798  TKQGLLV--EVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSV 855

Query: 685  M-SKIVQSNDWLEE--------EVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLS 735
            + S++ +   + +E         +   A EGLRTL + ++++S   Y++++++Y  A+ S
Sbjct: 856  IYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAAS 915

Query: 736  MLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVET 795
            +  R+E ++ V    +E +L LLG T +ED+LQ  V  SI LL  AG+K+W+LTGDKVET
Sbjct: 916  LAGREEELDHVADL-IERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVET 974

Query: 796  ARCVCVSAKLISRGQYVHTITKLTRRD---------------------------GALSRL 828
            A  +  S  L++    +  I K T  D                           G+   L
Sbjct: 975  AINIGFSCNLLNTDMELLVI-KTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEEL 1033

Query: 829  EYLKANRNS-----CLLIDGDSLAIYMSH--YRAEFFEIVICLPVVIACRCTPQQKADVA 881
               K + +       ++IDG++L I ++    + +F  +      V+ CR +P QKA V 
Sbjct: 1034 AAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVV 1093

Query: 882  LLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLL 941
             L+++        IGDG NDV+MIQ ADVGVGI G+EG+QA + +DY+I QF ++T+L+L
Sbjct: 1094 KLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVL 1153

Query: 942  WHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPV 1001
             HG+  YKR A++     ++ ++ ++    Y + ++     L++   +  Y   +T  PV
Sbjct: 1154 VHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPV 1213

Query: 1002 FSL-TLDHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFI-- 1058
              L  LD D+  +++   P+LY+     +  +   F  ++   ++Q  +   F  L    
Sbjct: 1214 IFLGILDQDVSATVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRK 1273

Query: 1059 -------GVGSEVFKKMVALSFTALVINEL-IMVALEIYTWN 1092
                   G+G +  +  V +  T + +      V +E Y W+
Sbjct: 1274 TNIITQNGLGLD-HRYYVGIPVTGIAVTSCNFYVLMEQYRWD 1314

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 7/120 (5%)

Query: 162 HSIELTDQHVDREIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFL 221
           H++ L D+     ++ D  PI +   YP N I   KY  +TF P  +  QF  F N+YFL
Sbjct: 149 HNMPLPDEM----LYEDGLPIME---YPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFL 201

Query: 222 LVSLSQSIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQ 281
           ++ +  +     +       VPL  ++++T  K+A++D +R   D E NN    +L   +
Sbjct: 202 IMIILGAFQIFGVTNPGLAAVPLIVIIILTAIKDAIEDSRRTLLDMEVNNTRTHILQGPE 261

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score =  338 bits (866), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 247/889 (27%), Positives = 441/889 (49%), Gaps = 132/889 (14%)

Query: 286  KNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQ 345
            K++ VGD+V++H +  IPAD+ILL SS+  G  +V+T  LDGET+ K+R +   +  +  
Sbjct: 444  KSVSVGDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLDGETNLKVRQSLKCSHMIRN 503

Query: 346  DEMLT--KVHITASAPEKSIHMFTGKLTYKG------SSAPLSVDNTLWANTVLASSGTC 397
               +T  K  + +  P  +++ + G L +         + P++++N L     L ++   
Sbjct: 504  SRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTKWA 563

Query: 398  VACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDKW 457
            +  V++TG DT+  +N   +  K   +  E+N    +     F L  +L    G+ +  +
Sbjct: 564  MGIVVFTGPDTKIMLNAGVTPTKVSRISRELN----LSVFMNFALLFVLCFAAGIVNGVY 619

Query: 458  Y------------------------VDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIES 493
            Y                        V     LIL+ +++P+SL +++++ K+  A  I  
Sbjct: 620  YRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALFIYG 679

Query: 494  DKSIPDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSY----- 542
            D ++ +  +      ++ TI +DLG+IEY+ SDKTGTLTQN M+ +K  +  VSY     
Sbjct: 680  DVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 739

Query: 543  ------------------TMETMDMVTDY------IQTLTSPANMGAAGVA--------- 569
                               +E   +  D       ++ L   + +    V          
Sbjct: 740  EALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKEFVQD 799

Query: 570  VTGSRKEVSQRV-RDLVVTLATCHNV--TPNFEDNE-LAYQAASPDEIAIVKFTERVGLS 625
              G+  E  ++   + ++ LA CH V    N +D E + ++A SPDE A+V     +G S
Sbjct: 800  TAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGFS 859

Query: 626  LFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKN-----EIWFLQKG 680
               R ++ + +  +  GV  +Y +L+V  F S  KRM  I++  ++N         + KG
Sbjct: 860  FVGRTKNGVIV--DIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKG 917

Query: 681  ADTVM-SKIVQSND--WLEE---EVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASL 734
            AD+++ S++ ++ND   LE+    +   A EGLRTL IA+++LS + Y++++++++ A+ 
Sbjct: 918  ADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAA 977

Query: 735  SMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVE 794
            ++++R++ M E V   +E  L LLG T +ED+LQ  V  SI  L  AG+K+W+LTGDKVE
Sbjct: 978  ALVDREDEM-EKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVE 1036

Query: 795  TARCVCVSAKLIS--------------------------RGQYVHTITKLTRRDGALSRL 828
            TA  +  S  L++                          +   +  + +  +  G+   L
Sbjct: 1037 TAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEEL 1096

Query: 829  EYLK-----ANRNSCLLIDGDSLAIYMSH--YRAEFFEIVICLPVVIACRCTPQQKADVA 881
            E  K        N  ++IDGD+L + + +   + EF  +      V+ CR +P QKA V 
Sbjct: 1097 EEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVV 1156

Query: 882  LLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLL 941
             L++         IGDG NDV+MIQ AD+GVGI G+EG+QA +++DY+I QF +LT+L+L
Sbjct: 1157 KLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLVL 1216

Query: 942  WHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPV 1001
             HGR SYKR A++     ++ ++ ++    Y + +N     L++   +  +   +T  PV
Sbjct: 1217 VHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLPV 1276

Query: 1002 FSL-TLDHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAV 1049
              L  LD D+++ ++   P+LY+        +   F++++  +++Q  +
Sbjct: 1277 IFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVI 1325

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 52/111 (46%)

Query: 188 YPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPALRIGYLSSYIVPLAFV 247
           YP N I   KY  +TF P  +  QFK   N+YFL++ +        +       VPL  +
Sbjct: 240 YPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVI 299

Query: 248 LVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQLVPSKNLRVGDLVKLHK 298
           +V+T  K+A++D +R   D E NN    +L   + V   N +V    K  K
Sbjct: 300 VVLTSFKDAIEDSRRTILDMEVNNAPTHILKGVENVNVSNDKVSLWRKFKK 350

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score =  215 bits (547), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 136/365 (37%), Positives = 199/365 (54%), Gaps = 15/365 (4%)

Query: 697  EEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLE 756
            E++ + + EGLRTL+ A K +S   +EQ+   Y +A  S+  R + ++EV    +E  L 
Sbjct: 963  EDIESFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKTSLSERKQKIDEV-GAQIEDELY 1021

Query: 757  LLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTIT 816
            LLG T +EDKLQ+ V  +IE +R AG+K+WMLTGDK ETA  +  S KLI    Y   + 
Sbjct: 1022 LLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIH--DYSTVVI 1079

Query: 817  KLTRRDGALSRL-----EYLKANRNSCLL-IDGDSLAIYMSH--YRAEFFEIVICLPVVI 868
              T  +  +S++     E    N   C++ IDG +LA++  +    + F E+      V+
Sbjct: 1080 LTTSDENIISKMNAISQEVDSGNVAHCVIVIDGATLAMFEDNPTLMSVFTELCTKTDSVV 1139

Query: 869  ACRCTPQQKADVALLIREMTGKRVC--CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAA 926
             CR +P QKA +   IR  T K +    IGDG ND++MIQ AD+GVGI GKEG QAS +A
Sbjct: 1140 CCRASPAQKALMVSNIRN-TDKSIVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSA 1198

Query: 927  DYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQG 986
            DYSI QF  + KLLL HGR +Y R+AK      ++ L   + Q +Y   +     +LY+ 
Sbjct: 1199 DYSIGQFRFILKLLLVHGRYNYIRTAKFILCTFYKELTFYLTQLIYQRYTMFSGTSLYEP 1258

Query: 987  WLMVGYATCYTMAPVFSLTL-DHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLF 1045
            W +  Y T +T  PV  + + + D+      T PELY      ++ ++  F  WV L   
Sbjct: 1259 WSLSMYNTLFTSLPVLCVGMFEKDLKPVTLLTVPELYSMGRLSKAFNWSIFAEWVFLGTA 1318

Query: 1046 QGAVI 1050
               +I
Sbjct: 1319 NALII 1323

 Score =  186 bits (472), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 138/470 (29%), Positives = 231/470 (49%), Gaps = 83/470 (17%)

Query: 162 HSIELTDQH-VDREIHLDTTPIYDKR---KYPTNAISNAKYNAITFLPIVLYEQFKFFFN 217
           HS  ++D + VDR  +L      D+R    Y  N I++++Y  I+F P  LY QF    N
Sbjct: 98  HSSAISDIYPVDRHGNL-----VDERYGYAYCNNLITSSRYTIISFFPRQLYAQFSKLAN 152

Query: 218 LYFLLVSLSQSIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVL 277
           +YF +V++ Q IP        + IVPL   + ++M++EA DD +R + D+E NN+L +VL
Sbjct: 153 VYFFIVAILQMIPGWSTTGTYTTIVPLCVFMAISMAREAYDDYRRHKLDKEENNKLTKVL 212

Query: 278 --------------NNSQLVPS-----------------------------KNLRVGDLV 294
                         NN+Q   +                             K++RVGD V
Sbjct: 213 QILHEREDNDLDLENNAQHSANNPESISNLYFNNFDLLAKKYNVRIVEKKWKDIRVGDFV 272

Query: 295 KLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQDE---MLTK 351
            L +D  +PAD+++L S   + E F++T  LDGET+ K +V       LT+         
Sbjct: 273 LLQQDDWVPADILILTSDGDNSEVFIETMALDGETNLKGKVPHPEINKLTKSASGLANIN 332

Query: 352 VHITASAPEKSIHMFTGKLTYKGSSA-----PLSVDNTLWANTVLASSGTCVACVIYTGT 406
             +T   P   ++ F G L     S+     PL  DN ++  +++ ++  CV  VI+TG 
Sbjct: 333 AQVTVEDPNNDLYNFEGNLELNSGSSSKKKYPLGPDNVIYRGSIIRNTRNCVGMVIFTGE 392

Query: 407 DTRQAMNTSKSS-VKTGLLELEINSLSKIL-----CICVFT-LSILLVVIGGLDDDK-WY 458
           +++  MN  ++   K   L+ +IN +   +     C+ +F+ L   + +   ++++K WY
Sbjct: 393 ESKIRMNALRNPRTKAPKLQRKINMIVVFMVFVVACMSLFSYLGHTIQIKRYVNNNKAWY 452

Query: 459 V---------DIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESD------KSIPDTIVR 503
           +          IM ++I+++TIIP+SL V ++L K   +R +E D      +S     VR
Sbjct: 453 LLQEDAGTAPTIMSFIIMYNTIIPLSLYVTMELIKVAQSRMMEWDIDMYHAESDTPCAVR 512

Query: 504 TSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVTDY 553
           T+TI E+LG++ Y+ SDKTGTLT N M  RK+     S+       ++++
Sbjct: 513 TATILEELGQVSYIFSDKTGTLTDNKMLFRKLSFCGTSWVHNATQDISEF 562

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 64/121 (52%), Gaps = 14/121 (11%)

Query: 578 SQRVRDLVVTLATCHNVTP------NFEDNELAYQAASPDEIAIVKFTERVGLSLFKRDR 631
           +++ +  +++LA CH   P      N ED+ + YQ++SPDE+A+V     +G  ++ R+ 
Sbjct: 672 AKKAKMFILSLAICHICLPKRTEEGNDEDDIIEYQSSSPDELALVTAARDMGYIVYNRNA 731

Query: 632 HSLTL------FHEYSGVNLQYDILHVFPFTSDTKRMGIIVR-DRTKNEIWFLQKGADTV 684
           + LTL      F E       ++IL +  F S  KRM +IVR    K+ +    KGAD V
Sbjct: 732 NILTLKTFPDGFDELPRFE-NFEILELVDFNSQRKRMSVIVRVPEEKDRVLLFCKGADNV 790

Query: 685 M 685
           +
Sbjct: 791 I 791

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score =  213 bits (543), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 132/369 (35%), Positives = 206/369 (55%), Gaps = 17/369 (4%)

Query: 687  KIVQSNDWLEEEVSN----MAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEA 742
            K++++ +++ E+  N     + EGLRTL+ + K +    Y+ +  +Y +A  S+ NR   
Sbjct: 928  KLIKNEEFILEKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRSTQ 987

Query: 743  MNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVS 802
            + EV   H+E +LELLG T +EDKLQ+ V  +I+ +R AG+K+WMLTGDK ETA  +  +
Sbjct: 988  IAEV-GGHIETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYA 1046

Query: 803  AKLISRGQYVHTITKLTRRDGALSRLEYLKANRNS------CLLIDGDSLAIYMSH--YR 854
             KLI     V  + K    D  +S++  L    ++       L+IDG SLA++ ++    
Sbjct: 1047 CKLIYDYSTVVILKK--NDDNLISKMTALGEELDTGKIAHCVLVIDGASLAVFENNPTMM 1104

Query: 855  AEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVC-CIGDGGNDVSMIQCADVGVG 913
            + F E+      VI CR +P QKA +   IR      V   IGDG ND++MIQ AD+GVG
Sbjct: 1105 SVFIELCTKTDSVICCRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAMIQSADIGVG 1164

Query: 914  IVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIHRGLLISVCQAVYS 973
            I GKEG QAS ++DYSI QF +L KLL  HGR +Y R++K      ++ +L  + Q +Y 
Sbjct: 1165 ITGKEGLQASRSSDYSIAQFRYLLKLLFVHGRYNYVRTSKFVLCTFYKEVLFYLTQMIYQ 1224

Query: 974  ISSNLKPIALYQGWLMVGYATCYTMAPVFSLTL-DHDIDESLTKTYPELYKELTEGRSLS 1032
              +     +LY+ W +  + T +T  PV  + + + D+        PELY    + ++ +
Sbjct: 1225 RQTMFSGTSLYEPWSLSMFNTLFTSLPVICIGMFEKDLKPMTLLAVPELYTMGQKCQAFN 1284

Query: 1033 YKTFFVWVI 1041
             K F VW++
Sbjct: 1285 LKIFLVWML 1293

 Score =  127 bits (318), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 89/286 (31%), Positives = 154/286 (53%), Gaps = 26/286 (9%)

Query: 286 KNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVA-PSLTQNLT 344
           K+L+VG+ V L+ D  +PAD++LL +   + E FV+T  LDGET+ K +   P L + +T
Sbjct: 275 KDLKVGEFVLLNSDDWVPADILLLSTDGENNEAFVETMALDGETNLKSKNPLPELAKRMT 334

Query: 345 QDEMLT--KVHITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVACVI 402
               L+      T   P   ++ F G +   G   PL  DN ++  ++L ++ + V  VI
Sbjct: 335 SATGLSMHSATTTLEDPNNDLYNFEGTVEIDGELYPLGSDNVVYRGSILRNTQSIVGIVI 394

Query: 403 YTGTDTRQAMNTSKS-SVKTGLLELEINSLSKILCICVFTLSIL------LVVIGGLDDD 455
           +TG +T+  MN  K+   K   L+ +IN +   +   V  +++       ++    +D++
Sbjct: 395 FTGEETKIRMNAIKNPRTKAPKLQGKINLIVLFMVFVVAAMAMFSYLGQHILKKNYVDNN 454

Query: 456 K-WYV---------DIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSI----PDTI 501
           + WY+          IM ++I+++T+IP+SL V  ++ K++ ++ +E D  +     DT 
Sbjct: 455 RAWYLFQEDAGTAPTIMSFIIMYNTLIPLSLYVTTEIIKAMQSKLMEWDIDMYHIESDTP 514

Query: 502 V--RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTME 545
              RT+TI E+LG++ Y+ SDKTGTLT N M  RK  +   S+  E
Sbjct: 515 CESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSICGSSWLHE 560

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 57/92 (61%)

Query: 186 RKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPALRIGYLSSYIVPLA 245
           R Y  N I++++Y   +FLP  LY QF    N YFLLV++ Q IP+       + IVPL+
Sbjct: 114 RPYRDNVITSSRYTVYSFLPRQLYAQFSKLANAYFLLVAILQMIPSWSTTGTYTTIVPLS 173

Query: 246 FVLVVTMSKEAMDDIQRRRRDRETNNELYEVL 277
             L ++M++EA DD +R R D+E NN+  +VL
Sbjct: 174 IFLSISMAREAWDDFKRHRLDKEENNKSTKVL 205

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 69/133 (51%), Gaps = 9/133 (6%)

Query: 576 EVSQRVRDLVVTLATCHNVTPNFEDN---ELAYQAASPDEIAIVKFTERVGLSLFKRDRH 632
           E S R +  +++LA CH   P    +    + YQ++SPDE+A+V     +G  +  R+  
Sbjct: 664 EFSIRAKFFILSLALCHTCLPKKTHDGTDSILYQSSSPDELALVTAARDMGFVVTNRNSS 723

Query: 633 SLTLFHEYSGVNLQ-----YDILHVFPFTSDTKRMGIIVR-DRTKNEIWFLQKGADTVMS 686
           +L++    +G + Q     Y++L    F S  KRM + V+     + +  + KGAD V+ 
Sbjct: 724 TLSIATYPNGFDDQPIVEDYEVLEYINFDSQRKRMSVAVKMPNDDDRVLLICKGADNVIL 783

Query: 687 KIVQSNDWLEEEV 699
           + +++++  + +V
Sbjct: 784 ERLRNSELAQNKV 796

>Kwal_23.3556
          Length = 1597

 Score =  212 bits (540), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 134/365 (36%), Positives = 198/365 (54%), Gaps = 15/365 (4%)

Query: 697  EEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLE 756
            + + + +  GLRTL+ + K + +  YE++SK+Y  A  S+ NR E M+ V    +E +L 
Sbjct: 962  QAIEDFSTSGLRTLLYSYKWIPSEDYEKWSKKYHAAKTSLENRKEKMHSV-GELVETSLH 1020

Query: 757  LLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTIT 816
            LLG T +EDKLQ+ V  +I+ +R AG+K+WMLTGDK ETA  +  S  LI       T+ 
Sbjct: 1021 LLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLI---HDYSTVV 1077

Query: 817  KLTRRDGALSR------LEYLKANRNSCLL-IDGDSLAIYMSH--YRAEFFEIVICLPVV 867
             L+ +D  +S        E  + N   C++ IDG +L  + S+    + F E+      V
Sbjct: 1078 ILSAKDENISSKLTAVSQEIERGNIAHCVVVIDGSTLTTFESNPTLMSVFVELCTKTDSV 1137

Query: 868  IACRCTPQQKADVALLIREMTGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAA 926
            I CR +P QKA +   IR    K V   IGDG ND++MIQ AD+GVGI GKEG QAS ++
Sbjct: 1138 ICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSS 1197

Query: 927  DYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQG 986
            DYSI QF  L KLLL HGR +Y R+ K      ++ LL  + Q +Y   +     +LY+ 
Sbjct: 1198 DYSIAQFRFLLKLLLVHGRYNYVRTTKFVLCTFYKELLFYLTQMIYQRHTMFSGTSLYEP 1257

Query: 987  WLMVGYATCYTMAPVFSLTL-DHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLF 1045
            W +  + T +T  PV  + + + D+        PELY      +S + + F  W+ L+  
Sbjct: 1258 WSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLAIPELYSIGRLSQSFNLRVFLYWMFLAAL 1317

Query: 1046 QGAVI 1050
               +I
Sbjct: 1318 NSLII 1322

 Score =  122 bits (307), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 86/294 (29%), Positives = 152/294 (51%), Gaps = 46/294 (15%)

Query: 286 KNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWK-----------LR 334
           K+++VGD V L +D  +PADM++L  S+   E FV+T  LDGET+ K           ++
Sbjct: 268 KDIKVGDYVVLEQDEWVPADMLVLTCSDEKNECFVETMALDGETNLKNKQPLTEVSEVMK 327

Query: 335 VAPSLTQNLTQDEMLTKVHITASAPEKSIHMFTGKLTYKGSSAPLSV--DNTLWANTVLA 392
            A  LT+         K  +T   P   +H F G L   G +  L++  D+ ++  +++ 
Sbjct: 328 TAAGLTE--------FKAKVTVEDPNIDLHNFEGNLELLGENRKLTIGPDHIIYRGSIIR 379

Query: 393 SSGTCVACVIYTGTDTRQAMNTSKSS-VKTGLLELEINSLSKILCICVFTLSILLVVIGG 451
           ++   V  V++TG +T+  MN  K+  +K   L+  IN +   +   V +++ L  ++G 
Sbjct: 380 NTSNAVGMVVFTGEETKIRMNAIKNPRIKAPKLQRAINLIVLFMVFVVASMA-LFSLLGQ 438

Query: 452 LDDDKWYVD-----------------IMRYLILFSTIIPVSLRVNLDLGKSVYARQIESD 494
               K YVD                 +M ++I+++T+IP+SL V +++ K++ ++ +E D
Sbjct: 439 RIIKKKYVDNNRAWYLFNSDAGLAPTVMSFIIMYNTLIPLSLYVTMEIIKAMQSKLMEWD 498

Query: 495 ------KSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSY 542
                 ++      RT+TI E+LG++ Y+ SDKTGTLT N M  R + +   S+
Sbjct: 499 IDMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMVFRALSVCGSSW 552

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 76/158 (48%), Gaps = 3/158 (1%)

Query: 179 TTPIYDKRK---YPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPALRIG 235
           T  + D+R    Y +N I++++Y   TFLP  LY QF    N YF LV++ Q IP     
Sbjct: 96  TAKLTDERSGKPYISNLITSSRYTIYTFLPRQLYAQFSRLANAYFFLVAVLQMIPGWSTT 155

Query: 236 YLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQLVPSKNLRVGDLVK 295
              + IVPL   + ++MS+EA DD +R + DRE N++   VL  S    ++  R   L  
Sbjct: 156 GTYTTIVPLLIFMGISMSREAWDDFRRHKLDREENDKTARVLVKSSSPHTEFSRPNSLYS 215

Query: 296 LHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKL 333
           L +  +      +L +          T Q D  T+W L
Sbjct: 216 LPQWQQSATSTSMLTNPTLESTAEAATSQNDDHTNWDL 253

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 73/133 (54%), Gaps = 11/133 (8%)

Query: 578 SQRVRDLVVTLATCHNVTPNFE-----DNELAYQAASPDEIAIVKFTERVGLSLFKRDRH 632
           +++V   +++LA CH   P        ++ + YQA+SPDE+A+V     +G ++  R+  
Sbjct: 662 AKKVSFFILSLALCHACLPKSSSGVEGEDCVEYQASSPDELALVTAARDMGYAVMNRNSD 721

Query: 633 SLTLFHEYSGVNLQ-----YDILHVFPFTSDTKRMGIIVR-DRTKNEIWFLQKGADTVMS 686
            LT+    +G + +     Y+IL+   F+S  KRM ++VR    +N I  + KGAD V+ 
Sbjct: 722 VLTIKTYPNGFDAEPHLDKYEILNNIEFSSHRKRMSVLVRLPHEENRILLICKGADNVIL 781

Query: 687 KIVQSNDWLEEEV 699
           + + ++D   +++
Sbjct: 782 ERLHNSDLANQKI 794

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score =  209 bits (532), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 139/394 (35%), Positives = 204/394 (51%), Gaps = 16/394 (4%)

Query: 697  EEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLE 756
            + +   + EGLRTLV A K +    YE ++K Y  A  S+ +R   ++E     +E  L 
Sbjct: 1023 QAIDEFSTEGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKIKVDEA-GAEIEDGLN 1081

Query: 757  LLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTIT 816
            LLG+T +EDKLQ  V  +IE +R AG+K+WMLTGDK ETA  +  S  LI    Y   + 
Sbjct: 1082 LLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIK--DYSTVVI 1139

Query: 817  KLTRRDGALSRL-----EYLKANRNSCLL-IDGDSLAIYMSH--YRAEFFEIVICLPVVI 868
              T  +  +S++     E    N   C++ IDG ++A++  +  Y + F E+      VI
Sbjct: 1140 LTTTDENIISKMNAVSQEVDSGNIAHCVVVIDGATMAMFEGNPTYMSVFVELCTKTDSVI 1199

Query: 869  ACRCTPQQKADVALLIREMTGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAAD 927
             CR +P QKA +   IR      V   IGDG ND++MIQ AD+GVGI GKEG QAS  +D
Sbjct: 1200 CCRASPSQKALMVSNIRNTDPNLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRVSD 1259

Query: 928  YSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGW 987
            YSI QF  L KLL  HGR +Y R++K      ++ +     Q +Y   +     +LY+ W
Sbjct: 1260 YSIGQFRFLLKLLFVHGRYNYIRTSKFMLCTFYKEITFYFTQLIYQRYTMFSGSSLYEPW 1319

Query: 988  LMVGYATCYTMAPVFSLTL-DHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQ 1046
             +  + T +T  PV  + + + D+      T PELY      +  ++  F  WVIL+   
Sbjct: 1320 SLSMFNTLFTSLPVLCIGMFEKDLKPMTLLTVPELYSYGRLSQGFNWLIFMEWVILATTN 1379

Query: 1047 GAVIQGFSQLFIGVGSEVFKKMVAL---SFTALV 1077
              +I   + +  G+ S     M  L   +FTA+V
Sbjct: 1380 SLIITFLNVVMWGMSSLSDNTMYPLGLINFTAIV 1413

 Score =  164 bits (415), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 135/478 (28%), Positives = 215/478 (44%), Gaps = 100/478 (20%)

Query: 162 HSIELTDQHVDREIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFL 221
           ++IE       R+ HL        + Y  N I++++Y   +FLP  LY QF    N YF 
Sbjct: 114 NAIEYKQAATKRDGHLIDERF--NKPYCDNRITSSRYTFYSFLPRQLYAQFSKLANTYFF 171

Query: 222 LVSLSQSIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNN---------- 271
           +V++ Q IP        + I+PL   + ++M++EA DD +R R D+E NN          
Sbjct: 172 IVAVLQMIPGWSTTGTYTTIIPLCVFMGISMTREAWDDFRRHRLDKEENNKPVGVLVKDG 231

Query: 272 -----ELYEV--------------------------------------LNNSQLVPSK-- 286
                E+Y +                                       NN +L+ +K  
Sbjct: 232 NNDAQEVYTLPSSVVSSTAYLTKSAAAENNPPLNDDRNSSQGHFLDTHFNNFELLKNKYN 291

Query: 287 ---------NLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVA- 336
                     LRVGD V L +D  +PAD++LL     + E FV+T  LDGET+ K +   
Sbjct: 292 VHIHQKKWEKLRVGDFVLLTQDDWVPADLLLLTCDGENSECFVETMALDGETNLKSKQPH 351

Query: 337 PSLTQNLTQDEMLTKVH--ITASAPEKSIHMFTGKLTYKGS------SAPLSVDNTLWAN 388
           P L +       L  ++  +T   P   ++ F G L  K          PL  DN ++  
Sbjct: 352 PELNKLTKAASGLANINAQVTVEDPNIDLYNFEGNLELKNHRNDTIMKYPLGPDNVIYRG 411

Query: 389 TVLASSGTCVACVIYTGTDTRQAMNTSKSS-VKTGLLELEINSLSKILCICVFTLSILLV 447
           ++L ++   V  VI++G +T+  MN  K+   K   L+ +IN +   +   V T+S L  
Sbjct: 412 SILRNTQNVVGMVIFSGEETKIRMNALKNPRTKAPKLQRKINMIIVFMVFVVATIS-LFS 470

Query: 448 VIGGLDDDKWYVD-----------------IMRYLILFSTIIPVSLRVNLDLGKSVYARQ 490
            +G +   K Y+D                 IM ++I+++T+IP+SL V +++ K V ++ 
Sbjct: 471 YLGHVLHKKKYIDQNKAWYLFQADAGVAPTIMSFIIMYNTVIPLSLYVTMEIIKVVQSKM 530

Query: 491 IESD------KSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSY 542
           +E D      ++      RT+TI E+LG++ Y+ SDKTGTLT N M  RK  L   S+
Sbjct: 531 MEWDIDMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSLCGSSW 588

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 83/165 (50%), Gaps = 18/165 (10%)

Query: 578 SQRVRDLVVTLATCHNVTPNFEDNE------LAYQAASPDEIAIVKFTERVGLSLFKRDR 631
           SQ+ +   ++LA CH+  P    NE      + YQ++SPDE+A+V     +G  +  R+ 
Sbjct: 725 SQKAKFFFLSLALCHSCLPKKTHNESIGEDSIEYQSSSPDELALVTAARDLGYIVLNRNA 784

Query: 632 HSLTLFHEYSGVNLQ-----YDILHVFPFTSDTKRMGIIVR-DRTKNEIWFLQKGADTVM 685
             LT+     G + +     Y+IL+   F S  KRM ++VR     N++  + KGAD V+
Sbjct: 785 QILTIKTFPDGFDGEAKLENYEILNYIDFNSQRKRMSVLVRMPNQPNQVLLICKGADNVI 844

Query: 686 SKIVQSNDWLEEEVSNMA------REGLRTLVIARKKLSTRLYEQ 724
            + +   +   ++++++       ++    LV+ ++K   R+ ++
Sbjct: 845 MERLHDRELAAKKMADICTSTKERKDAEAELVLQQRKSLERMVDE 889

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score =  204 bits (518), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 126/364 (34%), Positives = 196/364 (53%), Gaps = 13/364 (3%)

Query: 697  EEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLE 756
            +++     EGLRTL+ + K +  + YE ++  Y  A  +++NR E M + V   +E +L 
Sbjct: 943  QDMDAFTTEGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQM-DTVGEIIERDLT 1001

Query: 757  LLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTIT 816
            LLG  G+EDKLQ+ V  +I+ LR AG+K+WMLTGDK ETA  +  S +LI    Y   I 
Sbjct: 1002 LLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIH--DYSTVII 1059

Query: 817  KLTRRDGALSRL-----EYLKANRNSCLL-IDGDSLAIYMSHYRAEFFEIVICLPV--VI 868
                 +   S++     E    N   C++ IDG +L I+  +       I +C     VI
Sbjct: 1060 LAPNDENMASKITTITQEIEAGNVAHCVVVIDGATLTIFEGNLTLMTLFIELCTKTDSVI 1119

Query: 869  ACRCTPQQKADVALLIREMTGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAAD 927
             CR +P QKA +   IR+   K V   IGDG ND++MIQ AD+GV I GKEG QAS ++D
Sbjct: 1120 CCRSSPSQKALMVTKIRKTDKKLVTLAIGDGANDIAMIQSADIGVDITGKEGLQASRSSD 1179

Query: 928  YSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGW 987
            YSI QF +L KLLL HGR +Y R++K      ++  +  + Q ++ I++     + Y+ W
Sbjct: 1180 YSIAQFRYLLKLLLVHGRYNYIRTSKFVLCTFYKEFVFYLTQLIFQINTMFSGTSQYEPW 1239

Query: 988  LMVGYATCYTMAPVFSLTL-DHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQ 1046
             +  + T +T  PV  + + + D+      + PELY    + ++ +   F  W+ ++   
Sbjct: 1240 CLTVFNTLFTSLPVLCIGMFEKDLKSVTLLSIPELYTTGRQSQAFNLVIFLRWMAIAALS 1299

Query: 1047 GAVI 1050
              +I
Sbjct: 1300 SVII 1303

 Score =  161 bits (407), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 125/415 (30%), Positives = 213/415 (51%), Gaps = 65/415 (15%)

Query: 188 YPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPALRIGYLSSYIVPLAFV 247
           Y  NAI++++Y+  +FLP  L  QF    N YF  +++ Q +P        + IVPL+  
Sbjct: 110 YIGNAITSSRYSVYSFLPRQLCAQFSKVVNSYFFGMAILQMVPNWSTTGQYTTIVPLSIF 169

Query: 248 LVVTMSKEAMDDIQRRRRDRETNNELYEVL---------NNSQLVPS------------- 285
           + +++++E  +D +R + DRE NN+L +VL         +N  +                
Sbjct: 170 MGISIAREGWEDFRRHKLDREENNKLVKVLAQAHDSEFGDNKDISAEARAASFTDFETLQ 229

Query: 286 ------------KNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKL 333
                       K++ VG+ V L++D  +PAD+ LL +   + E +V+T  LDGET+ K 
Sbjct: 230 ANHGVAVVEKQWKDVEVGEFVLLNQDDWVPADLFLLATDGDNNECYVETMALDGETNLKC 289

Query: 334 R-VAPSL-TQNLTQDEMLT-KVHITASAPEKSIHMFTGKLTYKGSSA-----PLSVDNTL 385
           + V P + +Q  T   + T +   T   P   ++ F GK+  +  S       + +DN L
Sbjct: 290 KHVLPKIASQTRTASGLATFRGMTTVEDPNIDLYNFEGKIEVETDSGEQQAYSIGLDNVL 349

Query: 386 WANTVLASSGTCVACVIYTGTDTRQAMNTSKSS-VKTGLLELEIN--SLSKILCICVFT- 441
           +  +++ ++ T V  V++TG +T+  MN  K+  +K+  L+ +IN   L  IL + +F+ 
Sbjct: 350 FRGSIIRNTQTVVGMVVFTGEETKIRMNAIKNPRIKSPKLQTQINLIVLFMILVVAIFSF 409

Query: 442 LSILLVVI---GGLDDDK-WY---VD------IMRYLILFSTIIPVSLRVNLDLGKSVYA 488
           LS  L        +D D+ WY   VD      IM ++I+++T+IP+SL V +++ K + +
Sbjct: 410 LSFGLQRFFKNREVDSDRAWYLMKVDAGLAPTIMSFIIMYNTLIPLSLYVTMEIIKDMQS 469

Query: 489 RQIESD------KSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHL 537
           R +E D      ++      RT+TI E+LG++ Y+ SDKTGTLT N M  RK   
Sbjct: 470 RLMEWDIDMYHLETNTGCTSRTATILEELGQVSYIFSDKTGTLTDNRMIFRKFSF 524

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 72/138 (52%), Gaps = 13/138 (9%)

Query: 578 SQRVRDLVVTLATCHNVTPNFED-------NELAYQAASPDEIAIVKFTERVGLSLFKRD 630
           SQR +  ++ LA CH   P           + + YQ++SPDE+A+V     +G  +  R+
Sbjct: 647 SQRAKFFILALALCHTCLPKKRQGADSGDFDSVEYQSSSPDELALVTAARDMGYVVLNRN 706

Query: 631 RHSLTL-----FHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNE-IWFLQKGADTV 684
              LT+       E   V  +Y++L+   F+SD KRM ++VR     E +  + KGAD V
Sbjct: 707 GDELTIKTYPDGFEADCVLEKYEVLNTIDFSSDRKRMSVLVRMHQHPEKVLLICKGADNV 766

Query: 685 MSKIVQSNDWLEEEVSNM 702
           + + + ++D  +++++ +
Sbjct: 767 ILERLHNSDLAQQKLNEI 784

>Scas_669.3
          Length = 1638

 Score =  196 bits (497), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 141/395 (35%), Positives = 211/395 (53%), Gaps = 18/395 (4%)

Query: 697  EEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLE 756
            + +   + EGLRTLV + K +  + Y+Q+   Y DA +S+ NR   + EV    +E +L+
Sbjct: 997  QAIDEFSTEGLRTLVYSYKWVDLQEYQQWEDRYHDAKISLTNRKSKIAEV-GEEIEQDLQ 1055

Query: 757  LLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTIT 816
            LLG T +EDKLQ+ V  +IE +R AG+KIWMLTGDK ETA  +  S KLI     V  + 
Sbjct: 1056 LLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKLIYDYSTVVILA 1115

Query: 817  K----LTRRDGALSRLEYLKANRNSC-LLIDGDSLAIYMSH--YRAEFFEIVICLPVVIA 869
            K    +  +  A+S+ E    N   C ++IDG +LA++  +    + F E+      VI 
Sbjct: 1116 KGDENIISKMNAISQ-EVDSGNVAHCVIIIDGSTLAMFEGNPTLMSVFIELCTKTDSVIC 1174

Query: 870  CRCTPQQKADVALLIREMTGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADY 928
            CR +P QK+ +   IR      V   IGDG ND++MIQ AD+G+GI GKEG QAS  ADY
Sbjct: 1175 CRASPSQKSLMVTNIRNSNKNLVTLAIGDGANDIAMIQSADIGIGIGGKEGLQASRTADY 1234

Query: 929  SITQFCHLTKLLLWHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWL 988
            SI QF  + KLLL HGR +Y R+AK       + +   + Q ++   +     +LY+ W 
Sbjct: 1235 SIAQFRFILKLLLVHGRYNYIRTAKFILCTFFKEITFYLTQLIFQRYTMFSGSSLYEPWS 1294

Query: 989  MVGYATCYTMAPVFSLTL-DHDIDESLTKTYPELYK--ELTEGRSLSYKTFFVWVILSLF 1045
            +  + T +T  PV  + + + D+      T PELY    L++G +L    F  WVI +  
Sbjct: 1295 LSMFNTLFTSLPVLCIGMFEKDLKPMTLLTIPELYSMGRLSQGFNLI--IFGEWVIQAAA 1352

Query: 1046 QGAVIQGFSQLFIG---VGSEVFKKMVALSFTALV 1077
               +I   + +  G   +       +  ++FTA+V
Sbjct: 1353 YALLITFLNIIIWGETALSDHTMYPLGVINFTAIV 1387

 Score =  167 bits (424), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 130/470 (27%), Positives = 221/470 (47%), Gaps = 87/470 (18%)

Query: 162 HSIELTDQHVDREIHLDTTPIYDKRK---YPTNAISNAKYNAITFLPIVLYEQFKFFFNL 218
           HS+    ++ + +   +   + D+R    Y  N I++++Y   +F P  LY QF    N+
Sbjct: 111 HSVAQFQRYTNTKHKKNAGLLIDERTSSVYCNNNITSSRYTIYSFFPKQLYAQFSKVANV 170

Query: 219 YFLLVSLSQSIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVL- 277
           YF +V++ Q IP        + IVPL   + ++M++EA DD +R R D+E NN+   +L 
Sbjct: 171 YFFVVAILQMIPGWSTTGTYTTIVPLCIFMGISMAREAWDDFRRHRLDKEENNKTCSILT 230

Query: 278 ---------NNSQLVPSK---------------------------------------NLR 289
                    +++QL PS+                                       NL 
Sbjct: 231 KEFSNKPMPDDAQL-PSRQNIDNLSNDSNTDYLNTKFNNFPFLEERHGVRIQETTWSNLH 289

Query: 290 VGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVA-PSLTQNLTQDEM 348
           VGD V L +D+ +PAD+++L S   + E FV+T  LDGET+ K++   P L +       
Sbjct: 290 VGDFVLLKQDNWVPADILVLTSDGDNNECFVETMALDGETNLKVKQPHPELNKLACSASG 349

Query: 349 LTKVH--ITASAPEKSIHMFTGKLTYKGSSA------PLSVDNTLWANTVLASSGTCVAC 400
           L  ++  IT   P   ++ F G L    ++       P+  DN  +  +++ ++   +  
Sbjct: 350 LANINALITVEDPNSDLYNFEGNLELTDNNNNSLKKYPVGPDNVAYRGSIIRNTDNVIGM 409

Query: 401 VIYTGTDTRQAMNT-SKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDK--- 456
           VIYTG +T+  MN  +    K   L+  IN +   +   V  +S+   +   L + K   
Sbjct: 410 VIYTGKETKIRMNALNNPRTKAPKLQKNINIIITFMVFVVAVISLFSYLGHVLQNKKAID 469

Query: 457 ----WYV---------DIMRYLILFSTIIPVSLRVNLDLGKSVYARQIE-------SDKS 496
               WY+          IM ++I+++TIIP+SL V +++ K++ ++ +E       S+ +
Sbjct: 470 ENQAWYLLTKDAGAAPTIMSFIIMYNTIIPLSLYVTMEIIKAMQSKMMEWDIDMYHSETN 529

Query: 497 IPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMET 546
            P    RT+TI E+LG++ Y+ SDKTGTLT N M  RK  +   S+   T
Sbjct: 530 TP-CESRTATILEELGQVSYMFSDKTGTLTDNKMIFRKFSICGSSWLHST 578

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 86/177 (48%), Gaps = 19/177 (10%)

Query: 578 SQRVRDLVVTLATCHNVTP---NFED---NELAYQAASPDEIAIVKFTERVGLSLFKRDR 631
           +++ +  +++LA CH   P   NF +   + + YQ++SPDE+A+V     +G  +  ++ 
Sbjct: 696 AKKAKFFILSLALCHTCLPKKSNFPEGGEDVIEYQSSSPDELALVTAARDLGYVVLNKNA 755

Query: 632 HSLTLFHEYSGVNLQ-----YDILHVFPFTSDTKRMGIIVRDRTK-NEIWFLQKGADTVM 685
             LT+     G   +     Y IL+   F S  KRM ++V+   + N++  + KGAD ++
Sbjct: 756 DVLTIKTYPDGFENEPIFEDYQILNYIDFNSQRKRMSVLVKTPDEPNKVLLICKGADNMI 815

Query: 686 SKIVQSNDWLEEEVSNMAR------EGLRTLVIA-RKKLSTRLYEQFSKEYKDASLS 735
            + +Q  D   +++ ++ R      E    LVI  RK L    Y+   +     SLS
Sbjct: 816 LERLQDRDLAYQKMEDINRNTRERKELEAGLVIEQRKSLERMAYDDVPRNSFKTSLS 872

>Scas_505.4
          Length = 1025

 Score =  144 bits (363), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 87/298 (29%), Positives = 154/298 (51%), Gaps = 10/298 (3%)

Query: 163 SIELTDQHVDREIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLL 222
           ++  +D    REI+L+         Y  N IS  KYN  TFLP  L+++F  + NL+FL 
Sbjct: 212 NVGASDDGTPREIYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLC 271

Query: 223 VSLSQSIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLN--NS 280
            +  Q +P +      + +  L  VL+V+  KE+++DI+R   D+E NN   E+ +  N 
Sbjct: 272 TAAIQQVPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEENG 331

Query: 281 QLVPSK--NLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPS 338
             +  +  ++R GD++++  +  IPAD+I++ SSEP G  +++T  LDGET+ K++ A  
Sbjct: 332 DFIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARP 391

Query: 339 LTQNLTQDEMLT--KVHITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGT 396
            T  +     L   K  + +  P  S++ + G L +     PLS +  +     L ++  
Sbjct: 392 ETAEMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNNRKIPLSPEQMILRGATLRNTSW 451

Query: 397 CVACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDD 454
               VI+TG +T+   N + + +K   +E  IN    +  + +F + I+LV+I  L +
Sbjct: 452 MFGLVIFTGHETKLMRNATATPIKRTAVERVIN----LQIVALFGVLIVLVLISSLGN 505

 Score =  133 bits (335), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 93/325 (28%), Positives = 158/325 (48%), Gaps = 20/325 (6%)

Query: 838  CLLIDGDSLAIYMSHYRAEFFEIV--ICLPVVIACRCTPQQKADVALLIREMTGKRVCCI 895
             L+IDG SL+  +     ++   +  IC   V+ CR +P QKA V  +++  T   +  I
Sbjct: 559  ALVIDGKSLSYALESDLEDYLLALGKIC-KAVVCCRVSPLQKALVVKMVKRKTSSLLLAI 617

Query: 896  GDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLS 955
            GDG NDVSMIQ A VGVGI G EG QA+ +AD ++ QF  L KLLL HG  SY+R +   
Sbjct: 618  GDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLLLVHGSWSYQRISVAI 677

Query: 956  QFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDESL 1014
             +  ++   + + Q  +  ++     ++ + W M  Y   +T+ P F +   D  +   L
Sbjct: 678  LYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFPPFVIGVFDQFVSSRL 737

Query: 1015 TKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFIGVG---------SEVF 1065
             + YP+LYK   +G+  S + F+ W++   +  AV+   + LF   G         ++ +
Sbjct: 738  LERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYRYGMALNMHGEVADHW 797

Query: 1066 KKMVALSFTALVINELIMVALEIYTWNKTMAISEIVTFAIYVLSIPLLGEYFDLTSMLAL 1125
               +A+ +T+ ++  L   AL    W K    +   +F  +++  P+    F   ++   
Sbjct: 798  SWGIAV-YTSSILIVLGKAALVTNQWTKFTLFAIPGSFIFWMIFFPIYASVFPYANISRE 856

Query: 1126 PF------FIQLTIILTVSIFPVWA 1144
             F      +   T  LT+ + PV+A
Sbjct: 857  YFGVVKHTYGSGTFWLTLIVLPVFA 881

>Scas_665.30
          Length = 1439

 Score =  112 bits (281), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 182/801 (22%), Positives = 318/801 (39%), Gaps = 151/801 (18%)

Query: 267  RETNNELYEVLNNSQLVPSKNLRVGDLVKLHKDSR--IPADMILLQSSEPSGETFVKTDQ 324
            R   +E +  +N++ LVP      GD+ ++   S    P D +LL     SG+  V    
Sbjct: 330  RVFRDEFWTNVNSADLVP------GDIYEISDPSLTVFPCDSLLL-----SGDCIVNESM 378

Query: 325  LDGETD--WKLRVAPSLTQNLTQDEMLTKV--HITASAPEKSIHMFTGKLTYKGSSAPLS 380
            L GE+    K    P     L  D   T++  +++ S       +   ++ Y  S+A   
Sbjct: 379  LTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAM 438

Query: 381  VDNTLWANTVLASSGTCVACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVF 440
            V  T ++ T     G+ V  +++      +    S   +  G++ L        + +  F
Sbjct: 439  VVRTGFSTT----KGSLVRSMVFPKPTGFKFYEDSFKYI--GVMAL--------IALFGF 484

Query: 441  TLSILLVVIGGLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDT 500
            ++S +  +  GLD       I+R L + + ++P +L   L +G      +++       +
Sbjct: 485  SISCIQFIKIGLDKRTM---ILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCIS 541

Query: 501  IVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVS--YTMETMDMVTDYIQTLT 558
              R +      G+I+ L  DKTGTLT+N + +  + L   S   + +  D+V D  +   
Sbjct: 542  PTRVNI----GGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQDVHKLFP 597

Query: 559  SPANMGAAGVAVTGSRKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKF 618
                      ++         R ++  ++L TCH++     DNEL      P +  + +F
Sbjct: 598  K--------FSLNDCSSPRDYRAKNFFISLLTCHSL--RVVDNELI---GDPLDFKMFQF 644

Query: 619  T---------ERVGLSLFKRDRHSLTL----------FHEYSG--VNLQYD--------I 649
            T         E+   S ++  RH   L           H  S    N   D        I
Sbjct: 645  TKWSYEEDFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGI 704

Query: 650  LHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDW---LEEEVSNMAREG 706
            +  F F S+ +RM +IV+   ++  W   KGA  V+++I          EE ++    +G
Sbjct: 705  IRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKG 764

Query: 707  LRTLVIARKKL--STRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVE 764
             R +  A + L  +T LY Q                    +V +  +E N+E LG    E
Sbjct: 765  YRVIACAGRVLPRNTWLYSQ--------------------KVSREEVESNMEFLGFIIFE 804

Query: 765  DKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLI-SRGQYVHTITKL----- 818
            +KL+K+   +++ L+ A ++  M TGD V TA  V     LI S+  YV ++ ++     
Sbjct: 805  NKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQ 864

Query: 819  --------TRRDGALSRLEYLKANRNSC----LLIDGDSLAIYM---SHYRAEFFEIVIC 863
                       D  L     L  N +S     L I GD   I     ++  +E +   + 
Sbjct: 865  TSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVL 924

Query: 864  LPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQAS 923
            L   I  R +P +K ++   ++ +      C GDG ND   ++ ADVG+ +   E   AS
Sbjct: 925  LKGTIYARMSPDEKHELMEQLQRLNYTVGFC-GDGANDCGALKAADVGISLSEAE---AS 980

Query: 924  LAADYSITQF---CHLTKLLLWHGRNSYKRSAKLSQFV-IHRGLLISVCQAVYSISSNLK 979
            +AA ++   F   C L   ++  GR     S    Q++ ++  +       +YS  SNL 
Sbjct: 981  VAAPFTSQVFDISCVLD--VIKEGRACLVTSFSCFQYMSLYSAIQFITITVLYSRGSNLG 1038

Query: 980  -------------PIALYQGW 987
                         PIA++  W
Sbjct: 1039 DFQFLYIDLLLIVPIAIFMSW 1059

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score =  109 bits (273), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 181/789 (22%), Positives = 325/789 (41%), Gaps = 158/789 (20%)

Query: 283  VPSKNLRVGDLVKLHKDSR--IPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLT 340
            VPS +L  GD+ +L   S   +P D IL+     SG+  V    L GE+    +VA +  
Sbjct: 552  VPSSDLVPGDIYELTDPSLSLLPCDSILI-----SGDCLVNESMLTGESVPVSKVAATRE 606

Query: 341  Q--NLTQDEMLTKVHITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCV 398
                L  D M T++   +S   KS  +F G    +                V A++G  +
Sbjct: 607  TMLQLLDDFMDTQL---SSFVSKSF-LFNGTKLIR----------------VRATAGQSI 646

Query: 399  ACVIYTGTDTRQAMNTSKSSV--------KTGL--LELEINSLSKILCICVFTLSILLVV 448
            A     G   R   +T+K S+         TG    E     +  I  I +F  ++  + 
Sbjct: 647  AL----GMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQ 702

Query: 449  IGGLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIP 508
               L  DK  + I+R L + + ++P +L  +L +G      +++       +  R +   
Sbjct: 703  FLRLGLDKRTM-ILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNV-- 759

Query: 509  EDLGRIEYLLSDKTGTLTQNDMQLRKIHL-GTVSYTMETMDMVTDYIQTLTSPANMGAAG 567
               G+I+ +  DKTGTLT++ + +  +H+   +   M+   +VTD    L S        
Sbjct: 760  --GGKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTDVKDLLQS-------- 809

Query: 568  VAVTGSRKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKFTE------- 620
            ++++        + ++ +V+L TCH++     D EL      P +  +V+FT+       
Sbjct: 810  LSLSDCVSTRDMKAKNFLVSLLTCHSL--RMVDGELL---GDPFDFKMVQFTKWSDEEET 864

Query: 621  --RVGLSLFKRDRHSLTLFHEYS------------GVNLQYD------ILHVFPFTSDTK 660
              R   SL++ +RH  +   E S            G  ++ +      I+  F F S+ +
Sbjct: 865  GNRKVHSLYE-ERHDGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIGIVRSFEFLSNLR 923

Query: 661  RMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDW---LEEEVSNMAREGLRTLVIARKKL 717
            RM +IV+  ++N      KGA  V+ ++          E  + +    G R +  A KKL
Sbjct: 924  RMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKKL 983

Query: 718  STR--LYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSI 775
            + +  LY Q                    +V +  +E NLE LG    E+KL+   K ++
Sbjct: 984  TRQSWLYSQ--------------------KVSREEIESNLEFLGFIIFENKLKGTTKETL 1023

Query: 776  ELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQ-YVHTITKL-TRRDGALSRLEYLKA 833
            E L  A ++  M TGD V TA  V   A L+   + +V  I  + T ++G +   + +  
Sbjct: 1024 ESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVAN 1083

Query: 834  NRNS----------------CLLIDGDSLAIYMSHYRAEFFEIV--ICLPVVIACRCTPQ 875
            + ++                 L + G+   +     +++  E++  I L   I  R +P 
Sbjct: 1084 SSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPD 1143

Query: 876  QKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQF-- 933
            +K ++   ++ + G +V   GDG ND   ++ AD+G+ +   E   AS+AA ++   F  
Sbjct: 1144 EKHELVERLQSI-GYQVGFCGDGANDCGALKAADIGISLSEAE---ASVAAPFTSRLFEI 1199

Query: 934  -CHLTKLLLWHGRNSYKRSAKLSQFV-IHRGLLISVCQAVYSISSNLK------------ 979
             C L   ++  GR +   S    Q++ ++          +YS  SNL             
Sbjct: 1200 SCVLD--VMKEGRAALVTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDLFLI 1257

Query: 980  -PIALYQGW 987
             P+A++  W
Sbjct: 1258 VPLAVFMSW 1266

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score =  109 bits (272), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 183/791 (23%), Positives = 323/791 (40%), Gaps = 145/791 (18%)

Query: 267  RETNNELYEVLNNSQLVPSKNLRVGDLVKLHKDSRI--PADMILLQSSEPSGETFVKTDQ 324
            R   +  +  +N+S LVP      GDL ++   S +  P D +L+     SG+  V    
Sbjct: 541  RVYKDRFWTQVNSSDLVP------GDLFEISDPSLVVLPCDAVLI-----SGDCIVNESM 589

Query: 325  LDGETD--WKLRVAPSLTQNLTQDEMLTKVHITASAPEKSIHMFTGKLTYKGSSAPLSVD 382
            L GE+    K     +    L QD   ++V   +S   KS  +F G    +  + P    
Sbjct: 590  LTGESVPVSKYAATEATMAQLLQDFKSSQV---SSFVSKSF-LFNGTKIIRVRNQP---- 641

Query: 383  NTLWANTVLASSGTCVACVIYTG-TDTRQAMNTSKSSVKTGLLELEINSLSKI-----LC 436
                        G  +A VI TG + T+ ++  S    K    +   +S   I     + 
Sbjct: 642  ----------GQGMALALVIRTGFSTTKGSLVRSMVFPKPVGFKFYEDSFKYIGFMTLIA 691

Query: 437  ICVFTLSILLVVIGGLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKS 496
            +  F++S +  +  GL+   + V I+R L + + ++P +L   L +G S    +++    
Sbjct: 692  MFGFSISCIQFIRLGLE---YKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGI 748

Query: 497  IPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGT---VSYTMETMDMVTDY 553
               +  R +      G+++ +  DKTGTLT+  + +  IH       S  ++  D++TD 
Sbjct: 749  FCISPTRVNV----GGKVDMMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQLSDLITDC 804

Query: 554  IQTLTSPANMGAAGVAVTGSRKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEI 613
             + L          ++   S +E   + ++ +V+L TCH++     D EL      P ++
Sbjct: 805  DEVLQKHT------LSDCNSAEEF--KAKNFLVSLLTCHSL--KHIDGELL---GDPLDL 851

Query: 614  AIVKFTE---RVGLSLFK----RDRHSLT--LFHEYSGVNLQYD-------ILHVFPFTS 657
             + +FT+     G   +K     D+  ++  + H  S  N   +       ++  F F S
Sbjct: 852  KMFEFTKWAYEEGYESWKFKNAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLS 911

Query: 658  DTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDW---LEEEVSNMAREGLRTLVIAR 714
            + +RM +IV+   +N  W   KGA  V++ I           E + +    G R +  A 
Sbjct: 912  ELRRMSVIVKGFKENTYWSFTKGAPEVIADICNPATIPKDFHELLHHYTHNGFRIIACAG 971

Query: 715  KKL--STRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVK 772
            K L  S+ LY Q                    +V +  +E NLE LG    E+KL+   K
Sbjct: 972  KTLPKSSWLYSQ--------------------KVSREEVEDNLEFLGFIVFENKLKSRTK 1011

Query: 773  TSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITK---------LTRRD- 822
             +++ L+NA ++  M TGD V TA  V   + LIS  +                L+ RD 
Sbjct: 1012 AALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDV 1071

Query: 823  ---GALSRLEYLK----ANRNSCLLIDGDSLAIYMSHYR--AEFFEIVICLPVVIACRCT 873
               G++     LK      ++  L I GD   I   +     + +   + +   I  R +
Sbjct: 1072 DEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMS 1131

Query: 874  PQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQF 933
            P +K ++   ++++      C GDG ND   ++ A++G+ +   E   AS+AA ++   F
Sbjct: 1132 PDEKHELVEQLQKLDYNVGFC-GDGANDCGALKAANIGISLSEAE---ASVAAPFTSAVF 1187

Query: 934  ---CHLTKLLLWHGRNSYKRSAKLSQFV-IHRGLLISVCQAVYSISSNLK---------- 979
               C L   ++  GR S   S    Q++ ++  +       +YS  SNL           
Sbjct: 1188 DISCVLD--VIKEGRASLVTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLL 1245

Query: 980  ---PIALYQGW 987
               PIA+   W
Sbjct: 1246 LIVPIAISMSW 1256

>Kwal_26.9207
          Length = 1469

 Score =  103 bits (258), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 149/671 (22%), Positives = 272/671 (40%), Gaps = 127/671 (18%)

Query: 396  TCVACVIYTGTDT------RQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVI 449
            T +A V+ TG  T      R  +    S  K      +      ++ +  F++S +  + 
Sbjct: 664  TALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIALAGFSISCINFIR 723

Query: 450  GGLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDK--SIPDTIVRTSTI 507
             GL    + V I+R L + + ++P +L   L +G S    +++      I  T V  S  
Sbjct: 724  LGL---AYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVS-- 778

Query: 508  PEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVS--YTMETMDMVTDYIQTLTSPANMGA 565
                G+I+ +  DKTGTLT++ + +  +H+             ++T+ ++ L +  ++  
Sbjct: 779  ----GKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITN-VRGLFNKYSLND 833

Query: 566  AGVAVTGSRKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKFT------ 619
             G         +  + R+ +V+L TCH++     D EL      P +  + +FT      
Sbjct: 834  CG-------SPIDFKSRNFLVSLLTCHSL--RVVDGEL---LGDPLDFKMFQFTNWSYAE 881

Query: 620  --ERVGLSLFKRDRHSLTLFHEYSGV------------------NLQYDILHV---FPFT 656
              +         +R++ +   E +G+                  N  +++L V   F F 
Sbjct: 882  DFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFV 941

Query: 657  SDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDW---LEEEVSNMAREGLRTLVIA 713
            S+ +RM +IV+   +N  W   KGA  V+S+I   +      E+ +      G R +  A
Sbjct: 942  SELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACA 1001

Query: 714  RKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKT 773
             K L  R + +F++                 +V +  +E N+E LG    E+KL+     
Sbjct: 1002 GKTLPKRTW-RFAQ-----------------KVSREEVESNMEFLGFVVFENKLKPSTTP 1043

Query: 774  SIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQ-YVHTITKLTRRDGAL------- 825
            ++  L++AG++  M TGD V TA  V   + LI+    +V  I      +  L       
Sbjct: 1044 TLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVD 1103

Query: 826  --------SRLEYLKANRNSCLLIDGDSLAIYMSHYRA--EFFEIVICLPVVIACRCTPQ 875
                      LE +  + +  + + GD   +   +     E +  ++ L   I  R +P 
Sbjct: 1104 DCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPD 1163

Query: 876  QKADVALLIREMTGKR--VCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQF 933
            +K +   L+ ++ G    V   GDG ND   ++ ADVGV +   E   AS+AA ++ + F
Sbjct: 1164 EKHE---LVGQLQGLDYVVGFCGDGANDCGALKAADVGVSLSEAE---ASVAAPFTSSVF 1217

Query: 934  ---CHLTKLLLWHGRNSYKRSAKLSQFV-IHRGLLISVCQAVYSISSNLK---------- 979
               C L   ++  GR S   S    Q++ ++  +       +YS   NL           
Sbjct: 1218 EISCILD--VIKEGRASLTTSFSCFQYMSLYSAIQFVTVTMLYSRGINLGDFQFLYIDLF 1275

Query: 980  ---PIALYQGW 987
               PIA++  W
Sbjct: 1276 LIVPIAIFMSW 1286

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
            cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 97.4 bits (241), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 209/945 (22%), Positives = 360/945 (38%), Gaps = 181/945 (19%)

Query: 260  IQRRRRDRETNNELYEVLNNSQ-LVPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGET 318
            + R+R DR+    +  V + ++ L+   NL VGDL+KL     +PAD +L++     GE 
Sbjct: 150  LNRKREDRQ----VVVVRDAAESLISIHNLLVGDLLKLQTGDVVPADCVLVR-----GEC 200

Query: 319  FVKTDQLDGETDWKLRVAPSLTQNLTQDEMLTKVHITASAPEKSIHMFTGKLTYKGSSAP 378
                  L GE++                  + K+ +  +    S H          S A 
Sbjct: 201  ETDESALTGESN-----------------TIKKLPLADALEYHSAHGGRDIGDTSASGAS 243

Query: 379  LSVDNTLWANTVLAS-----SGTCVACVIYTGTDT--RQAMNTSKSSVKTGLLELEINSL 431
             + D++   + +L S     SG   A V   G ++   + M + K   +   L++ ++ L
Sbjct: 244  GAADDSRCPDCMLISGSRVLSGLASAIVTNVGVNSVHGKTMASLKEDSEDTPLQMRLSQL 303

Query: 432  SKILCI--CVFTLSILLVVIGG-----LDDDKWYVDI---------MRYLILFSTIIPVS 475
            +  + +  CV  +++ +V+        L     Y D+         M   I   T+I V+
Sbjct: 304  TDNISVYGCVAAITLFVVLFARYLSYILPSGGKYHDLPPAEKGSKFMDIFITAITVIVVA 363

Query: 476  LRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKI 535
            +   L L  ++      +  +    +VR     E +G    + SDKTGTLT+N M + + 
Sbjct: 364  VPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENIMTVVRG 423

Query: 536  HLGTVSYTMETMD----------MVTDYIQTL-----------------TSPANMGAAGV 568
             LG   +     D            +D ++T+                   P N  +   
Sbjct: 424  TLGRAGFDDIGADPSKSNLVFKKKCSDLLRTVIYDNIVLNSTAFENKDYKDPNNYNSI-- 481

Query: 569  AVTGSRKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKFTERVGLSLFK 628
                   + SQ  R +     T     P+ E+N LA+ A    E  I   TE   LSL +
Sbjct: 482  -------DDSQPRRLIRRITQTLQKKKPDDEENLLAHAAEGRQEPYIGSKTETALLSLAR 534

Query: 629  RDRH-SLTLFHEYSG----VNLQYDILHVFPFTSDTKRMGIIVRDRTKNE-----IWFLQ 678
            +           + G    +     I+ + PF S  K   I+V+  +  E          
Sbjct: 535  KSFGLKFGALQSFRGHPEKLPTVETIVQIIPFESSRKWSAIVVKLNSNKENEGKKFRLYV 594

Query: 679  KGADTVMSKIV---------------QSNDWLEEEVSNMAREGLRTLVIARKKLSTRLYE 723
            KGA  +++K                 +S D +EE++ ++A++ LR + +A   +   + E
Sbjct: 595  KGAAEIVAKACTLKNVCNEGISEIDQKSKDDIEEQIFSLAKDALRAISLAH--MDFDVNE 652

Query: 724  QFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGV 783
               KE  D   S       + +  K HLE  L L  + G++D L+++VK S+   + AGV
Sbjct: 653  WPPKELADPENSHEALAVKLIDPKKPHLE-GLTLDAIVGIQDPLRENVKNSVAQCQKAGV 711

Query: 784  KIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDG 843
             + M+TGD + TA+ +                    R  G LS     K+  +S   ++G
Sbjct: 712  TVRMVTGDNLLTAKAIA-------------------RNCGILSS----KSLNDSACAMEG 748

Query: 844  DSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVS 903
             +        R      +  L      R +P+ K  +   ++EM G+ V   GDG ND  
Sbjct: 749  PAFRKLSDSERKRILPKLRVL-----ARSSPEDKKILVRALKEM-GEVVAVTGDGTNDAP 802

Query: 904  MIQCADVG--VGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLSQF---V 958
             ++ ADVG  +GI G E  + +         F  +   + W GR       K  QF   V
Sbjct: 803  ALKLADVGFSMGITGTEVAREASDIILMTDDFSAIVNAIKW-GRCVAASIKKFIQFQLIV 861

Query: 959  IHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKTY 1018
                +L++   +V  ISS++K +      L V       M  + +L L  D      K  
Sbjct: 862  NVTAVLLTFVTSV--ISSDVKSVLTAVQLLWVN----LIMDTLAALALATD------KPD 909

Query: 1019 PELYKELTEGRSLSYKTFFVWVIL---SLFQGAVIQGF----SQLFIG------------ 1059
            P +     +GRS    T   W ++   ++ Q +V        +Q F G            
Sbjct: 910  PNIMDRKPKGRSTPLITPSTWKMIIGQAILQLSVTFTLYSHGAQYFFGKPKEDLPGHEHQ 969

Query: 1060 -VGSEVFKKMVALSFTALVINELIMVALEIYTWNKTMAISEIVTF 1103
             + + +F   V L +  L+++  +  A  I  W K +  S +  F
Sbjct: 970  QINAMIFNTFVWLQWFTLLVSRKLDEADGIKDWRKRLTASNLNFF 1014

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 143/633 (22%), Positives = 250/633 (39%), Gaps = 124/633 (19%)

Query: 434  ILCICVFTLSILLVVIGGLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIES 493
            ++ I  F +S +  +  GLD       I+R L + + ++P +L   L +G +    +++ 
Sbjct: 702  LIAIFGFCVSCVQFIKLGLDKKTM---ILRALDIITIVVPPALPATLTIGTNFALSRLKE 758

Query: 494  DKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVTDY 553
                  +  R +      G+I+ +  DKTGTLT++ + +  + +       E   +    
Sbjct: 759  KGIFCISPTRLNIS----GKIDVMCFDKTGTLTEDGLDVLGVQIS------EPNGVRGQK 808

Query: 554  IQTLTSPANMGAAGVAVTGSRKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEI 613
               L S         ++      +  + R+  ++L TCH++  + + N L      P + 
Sbjct: 809  FGELLSDIRQVFPKFSLNDCSSPLDFKSRNFFMSLLTCHSLR-SVDGNLL----GDPLDF 863

Query: 614  AIVKFT---------ERVGLSLFKRDRHSLTLFHEYSGV------------------NLQ 646
             + +FT         +R   SL++  RH   +F E S +                  N  
Sbjct: 864  KMFQFTGWSFEEDFQKRAFHSLYE-GRHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDP 922

Query: 647  YDILHV---FPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDW---LEEEVS 700
            ++ L V   F F S+ +RM +IV+    +  W   KGA  V+S+I   +      EE + 
Sbjct: 923  HNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLR 982

Query: 701  NMAREGLRTLVIARKKLSTR--LYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELL 758
                 G R +  A K L  R  LY Q                    +V +  +E NLE L
Sbjct: 983  CYTHNGYRVIACAGKTLPKRTWLYSQ--------------------KVSREEVESNLEFL 1022

Query: 759  GLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLIS----------- 807
            G    ++KL+K+   +++ L++A ++  M TGD + TA  V   A LI            
Sbjct: 1023 GFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSIND 1082

Query: 808  ---RGQYVHTITKLTRRDGAL--SRLEYLKANRNSC---------LLIDGDSLAIYMSHY 853
                G+ V     +   D  L    L+ +K   NS          L + GD   +     
Sbjct: 1083 TPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDE 1142

Query: 854  R--AEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVG 911
                E +   I L   I  R +P +K ++ + ++++      C GDG ND   ++ ADVG
Sbjct: 1143 NEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFC-GDGANDCGALKAADVG 1201

Query: 912  VGIVGKEGKQASLAADYSITQF---CHLTKLLLWHGRNSYKRSAKLSQFV-IHRGLLISV 967
            + +   E   AS+AA ++   F   C L   ++  GR +   S    Q++ ++  +    
Sbjct: 1202 ISLSEAE---ASVAAPFTSKIFNISCVLD--VIREGRAALVTSFACFQYMSLYSAIQFIT 1256

Query: 968  CQAVYSISSNLK-------------PIALYQGW 987
               +YS  SNL              PIA+   W
Sbjct: 1257 ITILYSRGSNLGDFQFLYIDLLLIVPIAICMSW 1289

>Kwal_23.3160
          Length = 1100

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 176/725 (24%), Positives = 290/725 (40%), Gaps = 155/725 (21%)

Query: 279 NSQLVPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQ--LDGET----DWK 332
           N + +PSK L  GDL  +     +PAD+ L++          +TD+  L GE+       
Sbjct: 143 NDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVN------FETDEALLTGESLPIAKEA 196

Query: 333 LRVAPSLTQNLTQDEM--------LTKVHITASAPEKSIHMFTGKL--TYKGSSAPLSVD 382
            +V P+       D +        ++K   T    +  ++   GK+  + KG ++ +S D
Sbjct: 197 SQVYPATEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKD 256

Query: 383 --NTLWANTVLASSGTCVACVI--YTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCIC 438
              T WAN     +G  +A  I  + GT T   ++                 LSK+  + 
Sbjct: 257 ENKTFWAN-----AGITLAATIGSFLGTTTGTPLH---------------RKLSKLAVLL 296

Query: 439 VFTLSILLVVIGGLDDDKWYV--DIMRYLILFS-TIIPVSLRVNLDLGKSVYARQIESDK 495
            F   +  +V+  +   K+ V  ++  Y I  + ++IP SL V L +  SV A+ + +  
Sbjct: 297 FFIAVVFAIVV--MATQKFVVNKEVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMATR- 353

Query: 496 SIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLG-----TVSYTMETMDMV 550
              + +VR     E LG +  + SDKTGTLTQ  M +++  +      TVS +    D  
Sbjct: 354 ---NVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPT 410

Query: 551 TDYIQTLT--SPANMGA-----AGVAVTGSRKEVSQRVRDLV--------VTLATCHNVT 595
              I+ +   SP           G+  +   K  + ++   +        +  A   N+ 
Sbjct: 411 DGGIELIPRFSPHQYKHDSTEDVGIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALANIA 470

Query: 596 PNFEDNELAYQAA--SPDEIAIVKFTERVGL---SLFKRDR------HSLTLFHEYSGVN 644
             ++D E     A   P EIAI  F  ++ +   +L   D+          L  + S V 
Sbjct: 471 HVYQDPETEEWKAHGDPTEIAIQVFAHKLDMPRNALTAEDKSDSESDEDAALGEKTSSVE 530

Query: 645 LQYDILHVFPFTSDTKRMGIIV---------RDRTKNEI---------WFLQKGADTVMS 686
             Y  +  FPF S  KRM  +          R  TK            W L  G +   +
Sbjct: 531 PHYKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKW-LPDGCNESDA 589

Query: 687 KIVQSNDWLE--EEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMN 744
           K +   D  E  + V  ++ EGLR L  A K  +     + S++ +       NRD    
Sbjct: 590 KPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRK------NRD---- 639

Query: 745 EVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAK 804
                 +E +L   GL G+ D  +++   +++    AG+ + MLTGD   TA+ +     
Sbjct: 640 -----FVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVG 694

Query: 805 LISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRAEFFEIVICL 864
           ++ R  Y                  Y K   +S ++      A        E  + ++ L
Sbjct: 695 ILPRNLY-----------------HYPKEVVDSMVMT-----AAQFDQLTDEEIDNLLLL 732

Query: 865 PVVIACRCTPQQKADV--ALLIREMTGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE- 918
           P+VIA RC PQ K  +  AL  RE    + C + GDG ND   ++ A+VG+  GI G + 
Sbjct: 733 PLVIA-RCAPQTKVRMIDALHRRE----KFCAMTGDGVNDSPSLKKANVGIAMGINGSDV 787

Query: 919 GKQAS 923
            K AS
Sbjct: 788 AKDAS 792

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 93.6 bits (231), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 147/555 (26%), Positives = 232/555 (41%), Gaps = 111/555 (20%)

Query: 470 TIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQND 529
           ++IP SL V L +  S  A+ + +       I+R     E LG +  + SDKTGTLTQ  
Sbjct: 323 SMIPSSLVVVLTITMSAGAKVMATRH----VIIRKLDSLEALGAVNDICSDKTGTLTQGK 378

Query: 530 MQLRKI---HLGTVSY--TMETMDMVTDYIQTLT--SPANMGA-----AGVAVTGSRKEV 577
           M  +++     GT++   + E  +     IQ +   SP           G+      K  
Sbjct: 379 MIAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPKFSPYQYKHDDEEDVGMITDFKSKYY 438

Query: 578 SQRVRDLVVTL-------ATCHNVTPNFEDNELAYQAA--SPDEIAIVKFTERVGLSLFK 628
           +  +  L V+L       AT  N+   F D E     A   P EIAI  F  R+ L    
Sbjct: 439 ADELGPLNVSLFTQWLYTATLANIATVFRDPETQDWKAHGDPTEIAIQVFATRMDLP--- 495

Query: 629 RDRHSLTLFHEYSGVNLQYDIL--HV--FPFTSDTKRMGIIVR--DRTKNEIW-FLQKGA 681
             R  LT        N+  DI   HV  +PF S  KRM  I +  +  K  I+    KGA
Sbjct: 496 --RRVLTGEDNDDEKNIHNDITFEHVAEYPFDSSVKRMSAIYKNVEEPKAPIYEVFTKGA 553

Query: 682 DTVMSKIVQS-NDW------------------LEEEVSNMAREGLRTLVIARKKLSTRLY 722
                +++Q  N W                  +++ V  ++ EGLR L  A+K  +    
Sbjct: 554 ---FERVLQCCNSWYTTPDGSPQPLTEEDLETVQKNVDTLSSEGLRVLAFAKKTFNE--- 607

Query: 723 EQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAG 782
            QF+          +N+D+ + E  +  +E+NL  LGL G+ D  +++   +++    AG
Sbjct: 608 SQFT----------INKDKLLKE--RDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAG 655

Query: 783 VKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLL-- 840
           + + MLTGD   TA+ +     ++    Y                  Y K   N  ++  
Sbjct: 656 INVHMLTGDFPGTAKSIAQEVGILPHNLY-----------------HYPKEVVNFMVMTA 698

Query: 841 IDGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCI-GDGG 899
            D D+L+        E  E+ + LP+VIA RC PQ K  V ++       R C + GDG 
Sbjct: 699 TDFDALS------DKEIDELPV-LPLVIA-RCAPQTK--VRMIEALHRRNRFCAMTGDGV 748

Query: 900 NDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLL--LWHGRNSYKRSAKLSQF 957
           ND   ++ A+VG+ + G  G   +  A   +    +   +L  +  GR   + S  + +F
Sbjct: 749 NDSPSLKIANVGIAM-GINGSDVAKDASDIVLSDDNFASILNAVEEGR---RMSDNIQKF 804

Query: 958 VIHRGLLISVCQAVY 972
           V+   L  +V QA+Y
Sbjct: 805 VLQL-LAENVAQALY 818

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 169/730 (23%), Positives = 303/730 (41%), Gaps = 127/730 (17%)

Query: 258 DDIQRRRR-----DRETNNELYEVLNNSQLVPS-KNLRVGDLVKLHKDSRIPADMILLQS 311
           +D Q+ R+      ++ + E+  V N  + V S  +L VGDL+ L     +P D IL++ 
Sbjct: 165 NDYQKERQFARLNRKKEDTEVVVVRNGDKHVISVHDLLVGDLLSLQTGDVVPVDCILVE- 223

Query: 312 SEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQDEMLTKVHITASAPEKSIHMFTGKLT 371
               G+       + GE+D   +V  SL  +L       +V+ T +A   S  + +    
Sbjct: 224 ----GKCECDESGITGESDTIKKV--SLAMSL-------QVYRTVAADNPSADIGSSDNG 270

Query: 372 YKGSSAPLSVDNTLWANTVLASSGTCVACVIYTGTDTRQAMNTSKSSVKTGLLELEINSL 431
           +     P+ +  +     +L+  G  V   +   +   + M   KS  +T  L+  +N+L
Sbjct: 271 HSLVPDPMLISGS----KLLSGIGHAVVTAVGPHSVHGKMMLALKSEPETTPLQERLNTL 326

Query: 432 SKILCICVFTLSILLVVI------GGLDDDKWYVDI------MRYLILFSTII------- 472
           +  + I     + LL V+        L   + Y D+       R++ +F T +       
Sbjct: 327 ADDISIYGSVAAFLLFVVLFLRFLSYLPKGRLYHDLPSARKGSRFMDIFITAVTVIVVAV 386

Query: 473 PVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQL 532
           P  L + + L  +    ++  D ++    VR     E +G    + SDKTGTLTQN M +
Sbjct: 387 PEGLPLAVTLALAFATTRMTKDGNL----VRVLRACETMGSATTVCSDKTGTLTQNKMVV 442

Query: 533 RKIHLGTVSYTMETMD---MVTDYIQTLTSPANMG--AAGVAVTGSRKEVSQRVRDLVVT 587
            K  LG+  +   + D     +D ++   S   +    A +A+  +  E +++V D V+T
Sbjct: 443 VKGFLGSSHFDDISEDSNCAQSDALRQDMSQHTLNDILANIALNSTAFE-NKQVADPVIT 501

Query: 588 LATCH----NVTPNFEDNELAYQAASPDEIAIVKF-----TERVGLSLFK-----RDRHS 633
               H    ++ P   +N+  Y A     +   +F     TE   LSL K         +
Sbjct: 502 ENPYHKPRRSLFPWSRNNKPKYPAPKDSSVQSAEFFIGSKTEAALLSLAKGSLGLESLQA 561

Query: 634 LTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSK---IVQ 690
           L     + G+     I+ + PF S  K  G++VR    N  +F++  ++T+      +  
Sbjct: 562 LRDDPHHIGI---ASIVQMIPFESSRKWAGLVVRLVDGNYRFFIKGASETIFKSCHYMRS 618

Query: 691 SND---WLEEE--------VSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDAS------ 733
           SND    L  +        ++N+A + LRT+ +A K   T +      E +DAS      
Sbjct: 619 SNDDVIKLSPQKHGEIFGLINNLASDALRTISLAHKDF-TDISSWPPAELRDASDPSTAS 677

Query: 734 LSMLNRDEAMNEVVKR-----HLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWML 788
             +L  DE +     R     +    L L G+ G+ D L+  VK S++  + +GV + M+
Sbjct: 678 PDLLLGDEYVPTATDRPSIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMI 737

Query: 789 TGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAI 848
           TGD + T R +  +  ++S  +Y                        + C + +G    +
Sbjct: 738 TGDNITTGRAIARACGILSESEYAD----------------------HECAM-EG---PV 771

Query: 849 YMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCA 908
           +    R +  +    L V+   R +P+ K     ++++M  + V   GDG ND   +  A
Sbjct: 772 FRKLSRRQMMDAAPKLKVL--ARSSPEDKRIFVDILKKMN-EVVAVTGDGTNDAPALTLA 828

Query: 909 DVG--VGIVG 916
           DVG  +GI G
Sbjct: 829 DVGFSMGISG 838

>Kwal_14.1498
          Length = 939

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 176/803 (21%), Positives = 332/803 (41%), Gaps = 170/803 (21%)

Query: 163 SIELTDQHV--DREIHLDTTPIYDKRK--YPTNAISNAKYNAITFLPIVLYEQF-KFFFN 217
           S+E T Q +  D +  L T  + ++R+  Y  N IS+ +          L+ +F   F  
Sbjct: 37  SVEETAQSLGTDTQNGLPTMSVVEERRAQYGKNEISSEEDEP-------LWWKFVTTFVG 89

Query: 218 LYFLLVSLSQSIPALRIGYLSSYI-VPLAFVLVVTM-------SKEAMDDIQRRRRDRET 269
              +L+ +  ++ +  +G +   + + LA V+VVT+       S+++++ + R   D+  
Sbjct: 90  DPLILLLIGSAVISFIMGNIDDAVSITLAIVIVVTVGFVQEYRSEKSLEALNRLVPDQ-- 147

Query: 270 NNELYEVLNNSQLVPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGET 329
              L      S+L+ S  L  GD+V+     RIPAD+ ++++ + S    ++   L GE 
Sbjct: 148 -CHLIRCGQESKLLASV-LVPGDVVRFRVGDRIPADLRIIEAVDLS----IEESNLTGEN 201

Query: 330 DWKLRVAPSLTQNLTQDEMLTKVHITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANT 389
           +   +   ++ +   ++ + + V ++    E+S   F G L  +G    + +        
Sbjct: 202 EPVHKSTATVNKEFYKENLGSIVPVS----ERSCIAFMGTLVREGHGRGIVI-------- 249

Query: 390 VLASSGTCVACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVI 449
                GT          +   A+   K+ ++T +     + L K L    F +  ++ +I
Sbjct: 250 -----GTAKNTAFGKVFEMMNAIEKPKTPLQTAM-----DKLGKDLSFMSFIVIGIICLI 299

Query: 450 GGLDDDKWY----VDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTS 505
           G +    W     + +   +      +P+ + V L LG    A++          I+R  
Sbjct: 300 GVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKR--------RAIIRRL 351

Query: 506 TIPEDLGRIEYLLSDKTGTLTQNDMQLRKI-HLGTVSYTMETMDMVTDYIQTLTSPANMG 564
              E LG +  + SDKTGTLT N M + K+  LG++S                 + +N+ 
Sbjct: 352 PSVETLGSVNVICSDKTGTLTANHMSVNKVWCLGSMS-----------------NKSNIL 394

Query: 565 AAGVAVTGS-RKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKFTERVG 623
               A +GS +K +++ +R  + T   C+N T + E    A    +P +IA+++   + G
Sbjct: 395 KLDKATSGSFKKNLTEDLRATLRTGNLCNNSTYSHEH---AKYLGNPTDIALLEVLHKFG 451

Query: 624 LSLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADT 683
           L   + +R  +T   E S             F S  K M + V++     +  ++   + 
Sbjct: 452 L---EDERPQVTRSDEIS-------------FNSKRKFMAVKVKEANGKFVVHVKGAYEK 495

Query: 684 VM----------SKIVQSNDWLEEEVSN----MAREGLRTLVIARKKLSTRLYEQFSKEY 729
           ++          +K+V+ +  L + +++    +A +GLRTL  A+ +LS           
Sbjct: 496 ILEKSTHFINAENKVVKLDSNLRQAITDSADALASDGLRTLAFAQLELS----------- 544

Query: 730 KDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLT 789
            + +   L  D+           + L   GL G+ D  +  VK ++E L    V I M+T
Sbjct: 545 -NGNSKKLTEDDI----------NGLTFAGLLGMNDPPRPSVKAAVERLSEGSVHIIMIT 593

Query: 790 GDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIY 849
           GD   TA  +     +      V+  T +   D    +L+++            D LA  
Sbjct: 594 GDAENTAVSIARQIGI----PVVNPETAVLTGD----KLDHMSE----------DQLASI 635

Query: 850 MSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCAD 909
           + H             V I  R TP+ K ++   +++  G  V   GDG ND   ++ AD
Sbjct: 636 IDH-------------VNIFARATPEHKLNIVRALQK-RGDIVAMTGDGVNDAPALKLAD 681

Query: 910 VGVGIVGKEGKQ-ASLAADYSIT 931
           +GV + GK G   A  A+D  +T
Sbjct: 682 IGVSM-GKMGTDVAKEASDMVLT 703

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 154/604 (25%), Positives = 257/604 (42%), Gaps = 115/604 (19%)

Query: 431 LSKILCICVFTLSILLVVIGGLDDDKWYVD--IMRYLILFS-TIIPVSLRVNLDLGKSVY 487
           LSK L + +F +++L  +I  +   K+ VD  +  Y I  + ++IP SL V L +  SV 
Sbjct: 283 LSK-LAVLLFWIAVLFAIIV-MASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVG 340

Query: 488 ARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKI---HLGTVSYTM 544
           A  + S     + IVR     E LG +  + SDKTGTLTQ  M  R+I     GT++ + 
Sbjct: 341 AAVMVSR----NVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISN 396

Query: 545 E---------TMDMVTDYIQTLTSPANMGAAGVAVTGS----RKEVSQRVR-DLV---VT 587
                      + ++  +     S    G  G+          K++ + +  DL    + 
Sbjct: 397 SDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLE 456

Query: 588 LATCHNVTPNFEDNEL-AYQA-ASPDEIAIVKFTERVGL------------SLFKRDRHS 633
            AT  N+   F+D+    ++A   P EIAI  F  ++ L               + D+ S
Sbjct: 457 TATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSS 516

Query: 634 LTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGA-DTVMS------ 686
           L+  +E  G + Q++ +  FPF S  KRM  +  +          KGA ++++S      
Sbjct: 517 LSQHNEKPG-SAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWY 575

Query: 687 -----KIVQSNDW----LEEEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSML 737
                KI    D     + + V +++ EGLR L  A K         F+K+        +
Sbjct: 576 GKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASK--------SFTKD-------QV 620

Query: 738 NRDEAMNEVVKRH-LEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETA 796
           N D+  N    R   E +L  LGL G+ D  + +   +++    AG+ + MLTGD V TA
Sbjct: 621 NDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTA 680

Query: 797 RCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRA- 855
           + +     ++    Y H   ++                         DS+ +  S +   
Sbjct: 681 KAIAQEVGILPTNLY-HYSQEIV------------------------DSMVMTGSQFDGL 715

Query: 856 --EFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCI-GDGGNDVSMIQCADVGV 912
             E  + +  LP+VIA RC+PQ K  V ++      K+ C + GDG ND   ++ A+VG+
Sbjct: 716 SEEEVDDLPVLPLVIA-RCSPQTK--VRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGI 772

Query: 913 GIVGKEGKQASLAADYSITQFCHLTKLL--LWHGRNSYKRSAKLSQFVIHRGLLISVCQA 970
            + G  G   S  A   +    +   +L  +  GR   + +  + +FV+   L  +V QA
Sbjct: 773 AM-GINGSDVSKEASDIVLSDDNFASILNAVEEGR---RMTDNIQKFVLQL-LAENVAQA 827

Query: 971 VYSI 974
           +Y I
Sbjct: 828 LYLI 831

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 90.1 bits (222), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 154/604 (25%), Positives = 257/604 (42%), Gaps = 115/604 (19%)

Query: 431 LSKILCICVFTLSILLVVIGGLDDDKWYVD--IMRYLILFS-TIIPVSLRVNLDLGKSVY 487
           LSK L + +F +++L  +I  +   K+ VD  +  Y I  + ++IP SL V L +  SV 
Sbjct: 283 LSK-LAVLLFWIAVLFAIIV-MASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVG 340

Query: 488 ARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKI---HLGTVSYTM 544
           A  + S     + IVR     E LG +  + SDKTGTLTQ  M  R+I     GT++ + 
Sbjct: 341 AAVMVSR----NVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISN 396

Query: 545 E---------TMDMVTDYIQTLTSPANMGAAGVAVTGS----RKEVSQRVR-DLV---VT 587
                      + ++  +     S    G  G+          K++ + +  DL    + 
Sbjct: 397 SDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLE 456

Query: 588 LATCHNVTPNFEDNEL-AYQA-ASPDEIAIVKFTERVGL------------SLFKRDRHS 633
            AT  N+   F+D+    ++A   P EIAI  F  ++ L               + D+ S
Sbjct: 457 TATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSS 516

Query: 634 LTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGA-DTVMS------ 686
           L+  +E  G + Q++ +  FPF S  KRM  +  +          KGA ++++S      
Sbjct: 517 LSQHNEKPG-SAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWY 575

Query: 687 -----KIVQSNDW----LEEEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSML 737
                KI    D     + + V +++ EGLR L  A K         F+K+        +
Sbjct: 576 GKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASK--------SFTKD-------QV 620

Query: 738 NRDEAMNEVVKRH-LEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETA 796
           N D+  N    R   E +L  LGL G+ D  + +   +++    AG+ + MLTGD V TA
Sbjct: 621 NDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTA 680

Query: 797 RCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRA- 855
           + +     ++    Y H   ++                         DS+ +  S +   
Sbjct: 681 KAIAQEVGILPTNLY-HYSQEIV------------------------DSMVMTGSQFDGL 715

Query: 856 --EFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCI-GDGGNDVSMIQCADVGV 912
             E  + +  LP+VIA RC+PQ K  V ++      K+ C + GDG ND   ++ A+VG+
Sbjct: 716 SEEEVDDLPVLPLVIA-RCSPQTK--VRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGI 772

Query: 913 GIVGKEGKQASLAADYSITQFCHLTKLL--LWHGRNSYKRSAKLSQFVIHRGLLISVCQA 970
            + G  G   S  A   +    +   +L  +  GR   + +  + +FV+   L  +V QA
Sbjct: 773 AM-GINGSDVSKEASDIVLSDDNFASILNAVEEGR---RMTDNIQKFVLQL-LAENVAQA 827

Query: 971 VYSI 974
           +Y I
Sbjct: 828 LYLI 831

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
           involved in Na+ and Li+ efflux, required for Na+
           tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 89.7 bits (221), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 154/604 (25%), Positives = 257/604 (42%), Gaps = 115/604 (19%)

Query: 431 LSKILCICVFTLSILLVVIGGLDDDKWYVD--IMRYLILFS-TIIPVSLRVNLDLGKSVY 487
           LSK L + +F +++L  +I  +   K+ VD  +  Y I  + ++IP SL V L +  SV 
Sbjct: 283 LSK-LAVLLFWIAVLFAIIV-MASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVG 340

Query: 488 ARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKI---HLGTVSYTM 544
           A  + S     + IVR     E LG +  + SDKTGTLTQ  M  R+I     GT++ + 
Sbjct: 341 AAVMVSR----NVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISN 396

Query: 545 E---------TMDMVTDYIQTLTSPANMGAAGVAVTGS----RKEVSQRVR-DLV---VT 587
                      + ++  +     S    G  G+          K++ + +  DL    + 
Sbjct: 397 SDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLE 456

Query: 588 LATCHNVTPNFEDNEL-AYQA-ASPDEIAIVKFTERVGL------------SLFKRDRHS 633
            AT  N+   F+D+    ++A   P EIAI  F  ++ L               + D+ S
Sbjct: 457 TATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSS 516

Query: 634 LTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGA-DTVMS------ 686
           L+  +E  G + Q++ +  FPF S  KRM  +  +          KGA ++++S      
Sbjct: 517 LSQHNEKPG-SAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWY 575

Query: 687 -----KIVQSNDW----LEEEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSML 737
                KI    D     + + V +++ EGLR L  A K         F+K+        +
Sbjct: 576 GKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASK--------SFTKD-------QV 620

Query: 738 NRDEAMNEVVKRH-LEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETA 796
           N D+  N    R   E +L  LGL G+ D  + +   +++    AG+ + MLTGD V TA
Sbjct: 621 NDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTA 680

Query: 797 RCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRA- 855
           + +     ++    Y H   ++                         DS+ +  S +   
Sbjct: 681 KAIAQEVGILPTNLY-HYSQEIV------------------------DSMVMTGSQFDGL 715

Query: 856 --EFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCI-GDGGNDVSMIQCADVGV 912
             E  + +  LP+VIA RC+PQ K  V ++      K+ C + GDG ND   ++ A+VG+
Sbjct: 716 SEEEVDDLPVLPLVIA-RCSPQTK--VRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGI 772

Query: 913 GIVGKEGKQASLAADYSITQFCHLTKLL--LWHGRNSYKRSAKLSQFVIHRGLLISVCQA 970
            + G  G   S  A   +    +   +L  +  GR   + +  + +FV+   L  +V QA
Sbjct: 773 AM-GINGSDVSKEASDIVLSDDNFASILNAVEEGR---RMTDNIQKFVLQL-LAENVAQA 827

Query: 971 VYSI 974
           +Y I
Sbjct: 828 LYLI 831

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 122/502 (24%), Positives = 204/502 (40%), Gaps = 97/502 (19%)

Query: 470 TIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQND 529
           ++IP SL V L +  S  A+ + +     + IVR     E LG +  + SDKTGTLTQ  
Sbjct: 323 SMIPSSLVVVLTITMSAGAKVMATR----NVIVRKLDSLEALGAVNDICSDKTGTLTQGK 378

Query: 530 MQLRKI---HLGTVSY---------TMETMDMVTDYIQTLTSPANMGAAGVAVTGSRKEV 577
           M  +++     GT++          T+  + ++  +        +    G+      K +
Sbjct: 379 MIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDFKSKYL 438

Query: 578 SQRVRDLVVTL-------ATCHNVTPNFEDNELAYQAA--SPDEIAIVKFTERVGLSLFK 628
           +  +  L V+L       AT  N+   F+D+E     A   P EIAI  F  R+ L    
Sbjct: 439 AGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMDLP--- 495

Query: 629 RDRHSLTLF----HEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTV 684
             RH LT       + +  N  ++ +  FPF S  KRM  I ++         +      
Sbjct: 496 --RHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTEDPATPIYEVFTKGA 553

Query: 685 MSKIVQSND-W------------------LEEEVSNMAREGLRTLVIARKKLSTRLYEQF 725
             +++Q  D W                  +++ V  ++ EGLR L  A+K  +   +   
Sbjct: 554 FERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESEFNA- 612

Query: 726 SKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKI 785
                       N+D+ + E  +  +E  L  LGL G+ D  +++   +++    AG+ +
Sbjct: 613 ------------NKDKLLKE--RDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINV 658

Query: 786 WMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDS 845
            MLTGD   TA+ +     ++    Y                  Y K   N  ++   D 
Sbjct: 659 HMLTGDFPGTAKSIAQEVGILPHNLY-----------------HYPKEVVNFMVMAATDF 701

Query: 846 LAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCI-GDGGNDVSM 904
            A  +S    +   +   LP+VIA RC PQ K  +   +   +  + C + GDG ND   
Sbjct: 702 DA--LSDQEIDDLRV---LPLVIA-RCAPQTKVRMIEALHRRS--KFCAMTGDGVNDSPS 753

Query: 905 IQCADVGV--GIVGKE-GKQAS 923
           ++ A+VG+  GI G +  K AS
Sbjct: 754 LKIANVGIAMGINGSDVAKDAS 775

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 176/766 (22%), Positives = 297/766 (38%), Gaps = 192/766 (25%)

Query: 213 KFFFNLY---FLLVSLSQSIPALRIGYLSSYI-VPLAFVLVVTMSKEAMDDIQRRRRDRE 268
           KF  N      +L+ +  +I ++ +G +   I + +A V+VVT+       +Q  R ++ 
Sbjct: 95  KFLSNFVEDRLILLLMGSAIISVFLGNIDDAISITMAIVIVVTVGF-----VQEYRSEKS 149

Query: 269 TNNELYEVLNNSQLVPSK---------------NLRVGDLVKLHKDSRIPADMILLQSSE 313
                 E LN  +LVP +               NL  GDLV+     RIPAD+ +++ ++
Sbjct: 150 -----LEALN--KLVPQECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECND 202

Query: 314 PSGETFVKTDQLDGETDWKLRVAPSLTQNLTQDEMLTKVHITASAPEKSIHMFTGKLTYK 373
            +    +    L GETD   +   +L+++   D+  + V +               + Y 
Sbjct: 203 LT----IDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPVAERT----------NIAYM 248

Query: 374 GSSAPLSVDNTLWANTVLASSGTCVACVIYTGTDTRQA----MNTSKSSVKTGLLELEIN 429
           G+               L   G     V+ TG +T       M +S    KT L +L ++
Sbjct: 249 GT---------------LVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPL-QLTMD 292

Query: 430 SLSKILCICVFTLSILLVVIGGLDDDKWY----VDIMRYLILFSTIIPVSLRVNLDLGKS 485
            L K L +  F +  ++ V+G +    W     + +   +      +P+ + V L LG  
Sbjct: 293 KLGKDLSLASFVVIGIICVVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVL 352

Query: 486 VYARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKI-HLGTVSYTM 544
             A++          IVR     E LG +  + SDKTGTLT N M + KI  LG+++   
Sbjct: 353 RMAKR--------KAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMA--- 401

Query: 545 ETMDMVTDYIQTLTSPANMGAAGVAVTGSRKEVSQRVRDLVVTLATCHNVTPNFE-DNEL 603
                  + +  L+   N G            +   + D V T   C N+  N     E 
Sbjct: 402 -------NKLNVLSLDKNKGG----------NLKNYLTDDVKTTLLCGNLCNNASYSQEH 444

Query: 604 AYQAASPDEIAIVKFTERVGLSLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMG 663
           A    +P ++A+++  ++                 E + V  +Y  +    F S  K M 
Sbjct: 445 AKYLGNPTDVALLEQLQK----------------FELADVRSEYTKVKELSFNSKRKMMA 488

Query: 664 IIVRDRTKNEIWFLQKGADTVMSKIVQSNDWLEEE-----------------VSNMAREG 706
             ++D  K    F++   + ++ K   S+ +L E+                  + +A EG
Sbjct: 489 TKIQDNEKKTTLFIKGAFERILDK---SSSYLTEKGKIEKLTAGHRETIIDCANTLASEG 545

Query: 707 LRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDK 766
           LR L  A++ ++            D+S  ++  D +           +L   GL G+ D 
Sbjct: 546 LRVLAFAKRAMT------------DSSSKLVEDDIS-----------DLVFTGLIGMNDP 582

Query: 767 LQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALS 826
            +  VK +I+     G+ I M+TGD   TA         I+R   +  I      D  LS
Sbjct: 583 PRSSVKFAIDQFLQGGIHIIMITGDSENTAVN-------IARQIGIPVI------DPKLS 629

Query: 827 RLEYLKANRNSCLLIDGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIRE 886
            L   K N      +  D LA  + H             V I  R TP+ K ++   +R 
Sbjct: 630 VLSGDKLNE-----MTDDQLANVIDH-------------VNIFARATPEHKLNIVRALRR 671

Query: 887 MTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQ-ASLAADYSIT 931
             G  V   GDG ND   ++ AD+GV + G+ G   A  A+D  +T
Sbjct: 672 -RGDVVAMTGDGVNDAPALKLADIGVSM-GRMGTDVAKEASDMILT 715

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 142/634 (22%), Positives = 251/634 (39%), Gaps = 134/634 (21%)

Query: 434  ILCICVFTLSILLVVIGGLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIES 493
            I+    F++S +  +  GLD       I+R L + + ++P +L   L +G S    +++ 
Sbjct: 690  IIAFFGFSISCINFIKLGLDKRTM---ILRALDIITIVVPPALPATLTIGTSFALNRLKE 746

Query: 494  DK--SIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETM--DM 549
                 I  T V         G+I+ +  DKTGTLT++ + +  + +   +   +    D+
Sbjct: 747  KGIFCIAPTRVNIG------GKIDVMCFDKTGTLTEDGLDVLGVRVSCAATRNKASFSDL 800

Query: 550  VTDYIQTLTSPANMGAAGVAVTGSRKEVSQ----RVRDLVVTLATCHNVTPNFEDNELAY 605
            ++D               +    S K+ S     + R+ +++L TCH++     D EL  
Sbjct: 801  ISD------------THDIFPKFSLKDCSNPDDYKRRNFLISLLTCHSL--RVVDGELL- 845

Query: 606  QAASPDEIAIVKFT--------ERVGLSLFKRDRHSLTLFHEYSGV-------------- 643
                P +  + +FT        +         +RH    F E + +              
Sbjct: 846  --GDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENNDIIPAIVHPNDSDERN 903

Query: 644  -------NLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQS----N 692
                   N    I+  F F S+ +RM +IV+   +N  W   KGA  V+  I       +
Sbjct: 904  KFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVIIDICNPATLPS 963

Query: 693  DWLEEEVSNMAREGLRTLVIARKKL--STRLYEQFSKEYKDASLSMLNRDEAMNEVVKRH 750
            D+ ++ ++     G R +  A K L  +T LY Q                    +V +  
Sbjct: 964  DY-DDILNFYTHSGYRVIACAGKTLPKNTWLYSQ--------------------KVRREE 1002

Query: 751  LEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQ 810
            +E N+E LG    ++KL+     ++  L+ A ++  M TGD V TA  V    +LI+  +
Sbjct: 1003 VESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDR 1062

Query: 811  -YVHTI-------------TKLTRRDGALSRLEYLKANRNS---CLLIDGDSLAIYMS-- 851
             YV T+              +++  +  L        +  S    L I G+   I  S  
Sbjct: 1063 VYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQ 1122

Query: 852  -HYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADV 910
             +Y  E+   ++ L   I  R +P +K ++   +++M      C GDG ND   ++ ADV
Sbjct: 1123 DNYSEEYVNEIL-LKGSIFARMSPDEKHELVEQLQKMDYTVGFC-GDGANDCGALKAADV 1180

Query: 911  GVGIVGKEGKQASLAADYSITQF---CHLTKLLLWHGRNSYKRSAKLSQFV-IHRGLLIS 966
            G+ +   E   AS+AA ++   F   C L   ++  GR S   S    Q++ ++  +   
Sbjct: 1181 GISLSEAE---ASVAAPFTSKIFDITCVLD--VIKEGRASLVTSFACFQYMSLYSAIQFI 1235

Query: 967  VCQAVYSISSNLK-------------PIALYQGW 987
                +YS  SNL              PIA+   W
Sbjct: 1236 SITILYSRGSNLGDFQFLYIDLLLIIPIAVTMSW 1269

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score = 83.2 bits (204), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 179/762 (23%), Positives = 298/762 (39%), Gaps = 182/762 (23%)

Query: 208 LYEQF-KFFFNLYFLLVSLSQSIPALRIGYLSSYI-VPLAFVLVVTMSKEAMDDIQRRRR 265
           L+++F   F     +L+ +  ++ +L +G +   + + LA  +VVT+       +Q  R 
Sbjct: 84  LFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSITLAIFIVVTVGF-----VQEYRS 138

Query: 266 DRETNNELYEVLNNSQLVPSK---------------NLRVGDLVKLHKDSRIPADMILLQ 310
           ++       E LN  +LVP++                L  GDLV      RIPAD+ +++
Sbjct: 139 EKS-----LEALN--KLVPAECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIE 191

Query: 311 SSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQDEMLTKVHITASAPEKSIHMFTGKL 370
           + + S    +    L GE +                     VH T+   EKS   F  + 
Sbjct: 192 AIDLS----IDESNLTGENE--------------------PVHKTSQTIEKS--SFNDQ- 224

Query: 371 TYKGSSAPLSVDNTLWANTVLASSGTCVACVIYTGTDTR-----QAMNTSKSSVKTGLLE 425
               S  P+S  + +     L   G     V+ TGT+T      + MN  +   KT L +
Sbjct: 225 --PNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKP-KTPL-Q 280

Query: 426 LEINSLSKILCICVFTLSILLVVIGGLDDDKWY----VDIMRYLILFSTIIPVSLRVNLD 481
           L ++ L K L +  F +  ++ ++G +    W     + +   +      +P+ + V L 
Sbjct: 281 LTMDKLGKDLSLVSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLA 340

Query: 482 LGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKI-HLGTV 540
           LG    A++          IVR     E LG +  + SDKTGTLT N M + K+  L ++
Sbjct: 341 LGVLRMAKR--------KAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSM 392

Query: 541 SYTMETMDMVTDYIQTLTSPANMGAAGVAVTGSRKEVSQRVRDLVVTLATCHNVTPNFED 600
           S  +  + +  +  +T  S  N+          +  +++ VR+ +     C+N + +   
Sbjct: 393 SNKLNVLSLDKNK-KTKNSNGNL----------KNYLTEDVRETLTIGNLCNNASFS--- 438

Query: 601 NELAYQAASPDEIAIVKFTERVGLSLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTK 660
            E A    +P ++A++   E++        R+++    E              PF S  K
Sbjct: 439 QEHAIFLGNPTDVALL---EQLANFEMPDIRNTVQKVQE-------------LPFNSKRK 482

Query: 661 RMGIIVRDRTKNEIWFLQKGA---------------DTVMSKIVQSNDWLEEEVSN-MAR 704
            M   + +   N+     KGA                    K+ ++      E +N MA 
Sbjct: 483 LMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMAS 542

Query: 705 EGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVE 764
           EGLR    A+  LS            D+S  +              L  +L   GL G+ 
Sbjct: 543 EGLRVFGFAKLTLS------------DSSTPL-----------TEDLIKDLTFTGLIGMN 579

Query: 765 DKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGA 824
           D  + +VK +IE L   GV I M+TGD   TA  +   AK I           +   D  
Sbjct: 580 DPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNI---AKQIG----------IPVIDPK 626

Query: 825 LSRLEYLKANRNSCLLIDGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLI 884
           LS L   K +  S      D LA  + H             V I  R TP+ K ++   +
Sbjct: 627 LSVLSGDKLDEMS-----DDQLANVIDH-------------VNIFARATPEHKLNIVRAL 668

Query: 885 REMTGKRVCCIGDGGNDVSMIQCADVGV--GIVGKE-GKQAS 923
           R+  G  V   GDG ND   ++ +D+GV  G +G +  K+AS
Sbjct: 669 RK-RGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEAS 709

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 189/830 (22%), Positives = 320/830 (38%), Gaps = 189/830 (22%)

Query: 279  NSQLVPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPS 338
            NS++V S ++  GDLV +     IPAD+ L+              Q + ETD  L    S
Sbjct: 133  NSEVVDSTDVVPGDLVVVKVGDTIPADLRLVS-------------QQNFETDEALLTGES 179

Query: 339  LTQNLTQDEMLT-------KVHITASAP------EKSIHMFTGKLTYKGSSAPLSVDNTL 385
            L  +   +E+         ++++  S+        + I + TG  T  G  A      +L
Sbjct: 180  LPVSKDANEIFDDETPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIA-----KSL 234

Query: 386  WANTVLASSGTCVACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSIL 445
                 L S              T++ +     + +   L  +++ L+ +L       +I+
Sbjct: 235  RGGNELISRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIV 294

Query: 446  LVVIGGLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTS 505
            ++     D D+  V I    +  S +IP SL V L +  SV A  + S     + I+R  
Sbjct: 295  VMASQKFDVDRG-VAIYAVCVALS-MIPSSLVVVLTITMSVGAAVMASR----NVIIRKL 348

Query: 506  TIPEDLGRIEYLLSDKTGTLTQNDMQLRKI---HLGTVSYT------------METMDMV 550
               E LG +  + SDKTGTLTQ  M  ++I     GT+               +  +  +
Sbjct: 349  DSLEALGAVNDICSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNL 408

Query: 551  TDYIQTLTSPANMGA--------AGVAVTGSRKEVSQRVRDLVVTLATCHNVTPNFEDNE 602
            + Y  +     ++G          G ++ G+      ++ D  +  A+  N+   F D E
Sbjct: 409  SPYEYSHNETEDVGIMQNFKDKYEGKSIPGN---CQYQLFDKWLETASLANIASVFTDPE 465

Query: 603  LAYQAA--SPDEIAIVKFTERVGLSLFKRDRHSLT-----------------LFHEYSGV 643
                 A   P EIAI  F  R+ L      RH LT                    + +  
Sbjct: 466  TKEWKAHGDPTEIAIQVFATRMDLP-----RHVLTGERDDMDEDEIMSSVSLSEKDATAA 520

Query: 644  NLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGA------------------DTVM 685
            N ++     FPF S  KRM  +   R         KGA                   TVM
Sbjct: 521  NAKFRHAAEFPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVM 580

Query: 686  SKIVQSNDWLEEEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNE 745
            +      D ++E + +M+ EGLR L  A            +K Y  + ++    +E + +
Sbjct: 581  TD--ADVDTIKENIDSMSSEGLRVLAFA------------NKSYPKSDVN----EEKLQK 622

Query: 746  VVKR--HLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSA 803
            ++K   + E  L  LGL G+ D  +++   +++    AG+ + MLTGD   TA+ +    
Sbjct: 623  ILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEV 682

Query: 804  KLISRGQY------VHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRAEF 857
             ++    Y      V  +    ++   LS  E              D+L +         
Sbjct: 683  GILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEI-------------DNLPV--------- 720

Query: 858  FEIVICLPVVIACRCTPQQKADV--ALLIREMTGKRVCCI-GDGGNDVSMIQCADVGVGI 914
                  LP+VIA RC+PQ K  +  AL  RE    + C + GDG ND   ++ A+VG+ +
Sbjct: 721  ------LPLVIA-RCSPQTKVRMIEALHRRE----KFCAMTGDGVNDSPSLKMANVGIAM 769

Query: 915  VGKEGKQASLAADYSITQFCHLTKLL--LWHGRNSYKRSAKLSQFVIHRGLLISVCQAVY 972
             G  G   +  A   +    +   +L  +  GR   + S  + +FV+   L  +V QA+Y
Sbjct: 770  -GINGSDVAKDASDIVLSDDNFASILNAVEEGR---RMSDNIQKFVLQL-LAENVAQALY 824

Query: 973  SI---------SSNLKPIALYQGWLMVGYATCYTMAPVFSLTLD---HDI 1010
             I           ++ P+A  +   ++   +C+   P   L L+   HD+
Sbjct: 825  LIVGLAFQDKEGKSVFPLAPVEVLWIIVVTSCF---PAMGLGLEKAAHDL 871

>Kwal_47.17547
          Length = 1240

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 176/807 (21%), Positives = 325/807 (40%), Gaps = 131/807 (16%)

Query: 247 VLVVTMSKEAMD---DIQRRRRDRETNNELYEVLNNS--QLVPSKNLRVGDLVKLHKDSR 301
           VLVV +   A D   ++Q  + + + N+    VL N    L+   ++ VGD++ L     
Sbjct: 158 VLVVILVGSANDYQKELQFSKLNDKKNDREVIVLRNGDEHLISIHDILVGDILSLQTGDV 217

Query: 302 IPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQDEMLTKVHITASAPEK 361
           +PAD IL++ S    E+      L GE         S T      ++  + +   SA + 
Sbjct: 218 VPADCILVKGSCECDES-----ALTGE---------SATIKKAAIDVCYEKYKQLSATDA 263

Query: 362 SIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVACVIYTGTDTRQA--MNTSKSSV 419
           +I +        G+     V + +  +     SG   A V   G ++     +   K   
Sbjct: 264 AIDI--------GTPGAEKVPDPMLISGSKLLSGLGRAVVTSVGVNSMHGRTLMALKVEA 315

Query: 420 KTGLLELEINSLSKILCICVFTLSILLVVI------------GGLDDDKWYVDIMRYLIL 467
           +T  L+  ++SL+  + +     ++LL  I            G L D        R++ +
Sbjct: 316 ETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLKKGGELHDLTPAQKGSRFMNI 375

Query: 468 FS---TIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGT 524
           F    T+I V++   L L  ++      +  +    +VR     E +G    + SDKTGT
Sbjct: 376 FIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNLVRVLRACETMGSATAVCSDKTGT 435

Query: 525 LTQNDMQLRKIHLGTVSY----TMETMDMVTDYIQTLTSPANMGA-----AGVAVTGSRK 575
           LT+N M + K  LG+  +    ++   D  TD    + +  +          + +  +  
Sbjct: 436 LTENRMTVVKGFLGSTFFDEAESVGPSDSETDVDLAIANECSEELKKDVLTNITLNSTAF 495

Query: 576 EVSQRVRDLVVTLATCH----NVTPNFEDN---------ELAYQAAS--PDEIAIVKFTE 620
           E  +   D V      H    ++ P   +N         EL   AA+  P E  +   TE
Sbjct: 496 ENKENEEDKVSNENPFHKPRKSLFPWSRNNKSKKPATAKELVENAAADQPKEPFLGSKTE 555

Query: 621 RVGLSLFKRDRHSLTLFH---EYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFL 677
              L+  +++     L H   E   + ++  I+ + PF S  K  GI+V+ +     +++
Sbjct: 556 TALLAFAQKNLGMQNLHHYRDEPDCLGIE-KIVQIIPFESSRKWGGIVVKYKNGLHRFYI 614

Query: 678 QKGADTVMSKIVQS------------NDWLEEE--VSNMAREGLRTLVIARKKLS----- 718
           +  A+ ++ + +Q              D+ EE   ++N+A E LR + +A +        
Sbjct: 615 KGAAELLLRRCMQKRASDSKLTLISQKDFDEESQTITNLAAEALRAISLAHRDYPNCPNW 674

Query: 719 --TRLYEQFSKEYKDASL---SMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKT 773
             + L ++   E     L     ++R ++++E  +  L   + L G+ G++D L+K V+ 
Sbjct: 675 PPSELQDEVEPEAASPDLLFGDEVSRSDSVSEPAQ-ELVSPMVLDGIVGIQDPLRKGVRK 733

Query: 774 SIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKA 833
           S+E  + AGV + M+TGD + TA  +     ++S  Q  +  + +   +G   R   L +
Sbjct: 734 SVEQCQKAGVTVRMVTGDNILTATAIAKKCSILSEEQAENPESSM---EG--PRFRKL-S 787

Query: 834 NRNSCLLIDGDSLAIYMSHYRAEFFEIVICLP-VVIACRCTPQQKADVALLIREMTGKRV 892
           N+                       E V  LP + +  R +P+ K  +   +++M G  V
Sbjct: 788 NK-----------------------ERVRILPNLRVLARSSPEDKRILVETLKKM-GDVV 823

Query: 893 CCIGDGGNDVSMIQCADVG--VGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKR 950
              GDG ND   ++ ADVG  +GI G E  + +         F  +   + W GR     
Sbjct: 824 AVTGDGTNDAPALKLADVGFSMGIAGTEVAREASDIILMTDDFSAIVNAIKW-GRCVSTS 882

Query: 951 SAKLSQFVIHRGLLISVCQAVYSISSN 977
             K  QF +   +   V   V +++S+
Sbjct: 883 IKKFIQFQLTVNVTAVVLTFVSAVASS 909

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
           Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 1280

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 155/713 (21%), Positives = 292/713 (40%), Gaps = 134/713 (18%)

Query: 279 NSQLVPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVA-- 336
           +  L+   +L VGD++ L     +PAD +L+     SG        L GE+D   +VA  
Sbjct: 248 DEHLISIHDLLVGDVISLQTGDVVPADAVLI-----SGSCECDESALTGESDTIKKVALK 302

Query: 337 PSLTQNLTQDEMLTKVHITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGT 396
           P+L +     E    + I +    + +              PL +  +     +L+  G 
Sbjct: 303 PALEKYKQIFEKDPTIDIGSHGVGEKV------------PDPLLISGS----KLLSGIGN 346

Query: 397 CVACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKIL----CICVFTLSILLVV--IG 450
            V   +   +   + M   K+  ++  L+  +++L+  +    C+    L I+L +  + 
Sbjct: 347 AVITSVGENSVNGRIMMALKTESESTPLQERLSNLADNISIYGCMAALVLFIILFIRFLT 406

Query: 451 GLDDDKWYVDI------MRYLILFSTII-------PVSLRVNLDLGKSVYARQIESDKSI 497
            L + K Y D+       +++ +F T +       P  L + + L  +    ++  D ++
Sbjct: 407 YLPNGKKYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNL 466

Query: 498 PDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVTDYIQTL 557
               VR     E +G    + SDKTGTLT+N M + K   G + +   T     +    +
Sbjct: 467 ----VRVLRACETMGSATAICSDKTGTLTENRMTVVKGFAGNLGFDDTTHAENKEIKSAV 522

Query: 558 TSPANMGAA-------GVAVTGS---RKEVSQRVRDL---------------VVTLATCH 592
              +N  A+        +++  +    KE   + +D+                    T  
Sbjct: 523 VLRSNCDASLLTDILSNISLNSTAFENKESQHKDKDVDENPYHKSRKSLFPWSRNNRTSQ 582

Query: 593 NVTPNFEDNELAYQAASPDEIAIVKFTERVGLSLFKRDRHSLTLFHEYSGVNLQYDILHV 652
            +    ++N+  +   S  E A++ F ++   SL  +D H L       G++    ++ V
Sbjct: 583 LIADAMKENDEQF-LGSKTETALLAFAQK---SLGMKDVHKLRTKPSDLGID---KVVQV 635

Query: 653 FPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSK-----------IVQSNDWLEEE--- 698
            PF S  K   I V+        F  KGA  ++ K           IV  N  L +E   
Sbjct: 636 IPFESSRKWGAIAVQLADNKGYRFYAKGAAEILLKVCSNQRNSDNSIVPMNQDLYDESFK 695

Query: 699 -VSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDAS-LSMLNRDEAM-NEVVKRHLE-HN 754
            + +MA   LRT+ +  +       E   KE+ D++  S+ + D  M +E+  ++L    
Sbjct: 696 KIQDMASHALRTISLVHRDFK----EWPPKEFADSTDPSIASPDLVMGHELDHKNLSSEG 751

Query: 755 LELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHT 814
           + L  + G++D L++ VK S+E  + AGV + M+TGD + TAR +  +  ++S   Y   
Sbjct: 752 MTLDAMVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNILSEEGY--- 808

Query: 815 ITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRAEFFEIVICLPVV-IACRCT 873
                              N   C + +G +        +  + +++  +P + +  R +
Sbjct: 809 -------------------NDPECAM-EGPTF------RKLPYKKMLRVIPKLRVLARSS 842

Query: 874 PQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVG--VGIVGKE-GKQAS 923
           P+ K  +   +++M G+ V   GDG ND   ++ ADVG  +GI G E  ++AS
Sbjct: 843 PEDKRILVETLKKM-GEVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREAS 894

>Scas_707.48*
          Length = 741

 Score = 79.7 bits (195), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 162/674 (24%), Positives = 269/674 (39%), Gaps = 155/674 (22%)

Query: 280 SQLVPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSL 339
           S LVP      GDLV      RIPAD+ ++++ + S    +    L GE +   + A  +
Sbjct: 167 SGLVP------GDLVHFKIGDRIPADLRIIEAVDLS----IDESNLTGENEPVHKSAKEV 216

Query: 340 TQNLTQDEMLTKVHITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVA 399
            ++   D+  + + I+    +++   + G L  +G    + V   +  NT   +    ++
Sbjct: 217 NKDSFNDQPNSIIPIS----DRTCVAYMGTLVKEGHGKGIVVG--IGKNTSFGAIFEMLS 270

Query: 400 CVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDKWY- 458
            +    T  + AM+                 L K L +  F +  L+ ++G L    W  
Sbjct: 271 NIEKPKTPLQNAMD----------------KLGKDLSLFSFIVIGLICLVGILQGRSWLE 314

Query: 459 ---VDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIE 515
              + +   +      +P+ + V L LG    A++          IVR     E LG + 
Sbjct: 315 MFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKR--------KAIVRRLPSVETLGSVN 366

Query: 516 YLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVTDYIQTLTSPANMGAAGVAVTGSRK 575
            + SDKTGTLT N M   KI      + +++M           + AN+ +   + +GS K
Sbjct: 367 VICSDKTGTLTSNHMTASKI------WCLDSM----------ANKANVLSLEKSKSGSLK 410

Query: 576 E-VSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKFTERVGLSLFKRDRHSL 634
             +++ V+  +     C+N +  F      Y   +P +IA+++      LS F       
Sbjct: 411 NYLTEDVKSTLTIGNICNNAS--FSQEHGKY-LGNPTDIALLE-----QLSKF------- 455

Query: 635 TLFHEYSGVNLQYDILHVFPFTSDTKRMGI-IVRDRTKNEIWFLQKGA-DTVMS------ 686
               + S +   +  +   PF S  K M + IV    K  +    KGA + V+S      
Sbjct: 456 ----DLSDIRPTFKKVQEIPFNSKRKFMAVKIVNSEGKYSLCV--KGAFEKVLSQCSHYL 509

Query: 687 -------KIVQSN-DWLEEEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLN 738
                  K+ Q   D + E  +++A EGLR L  A+  L               S ++L 
Sbjct: 510 NQKGKTEKLTQGQRDVIIETANSLASEGLRMLAFAKTTLPD-------------SPTLLT 556

Query: 739 RDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARC 798
            +E++ +++           GL G+ D  +  VK +IE L   GV I M+TGD   TA  
Sbjct: 557 -EESVGDLI---------FTGLIGMNDPPRPTVKPAIEQLLQGGVHIIMITGDSENTAVN 606

Query: 799 VCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRAEFF 858
                  I+R   +  +      D  LS L   K N  S      D LA  + H      
Sbjct: 607 -------IARQIGIPVL------DPKLSVLSGDKLNEMS-----DDQLANVIDH------ 642

Query: 859 EIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKE 918
                  V I  R TP+ K ++   +R+  G  V   GDG ND   ++ AD+GV + G+ 
Sbjct: 643 -------VNIFARATPEHKLNIVRALRK-RGDVVAMTGDGVNDAPALKLADIGVSM-GRM 693

Query: 919 GKQ-ASLAADYSIT 931
           G   A  A+D  +T
Sbjct: 694 GTDVAKEASDMVLT 707

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
           (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 141/594 (23%), Positives = 235/594 (39%), Gaps = 113/594 (19%)

Query: 435 LCICVFTLSILLVVIGGLDDDKWYV--DIMRYLILFS-TIIPVSLRVNLDLGKSVYARQI 491
           L + +F +++L  +I  +   K+ V  ++  Y I  + ++IP SL V L +  S  A+ +
Sbjct: 288 LALILFAIAVLFALIV-MATQKFIVNREVAIYAICVALSMIPSSLVVVLTITMSAGAKVM 346

Query: 492 ESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKI---HLGTV-------- 540
               S  + IVR     E LG +  + SDKTGTLTQ  M L+++     GTV        
Sbjct: 347 ----STRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVP 402

Query: 541 -SYTMETMDMVTDYIQTLTSPANMGAAGVAVTGSR--------KEVSQRVRDLVVTLATC 591
              T+  + ++  +             G+     +        K ++ R  +  +  AT 
Sbjct: 403 FDPTVGDVSLIPRFSPWEYQHDEEEDVGIIANFKQRWQSNSLPKGLNPRKFESWLHTATL 462

Query: 592 HNVTPNFEDNELAYQAA--SPDEIAIVKFTERVGLSLFKRDRHSLTLFH--EYSGVNLQY 647
            N+   F+D++     A   P EIAI  F  R+         H+LT     E S  + Q 
Sbjct: 463 ANIATVFKDSDSKEWRAHGDPTEIAIQVFATRM-----DHPHHALTTEQDEEDSDSSQQN 517

Query: 648 DILHV------FPFTSDTKRMGII---VRDRTKNEI---------------WFLQKGADT 683
           D   +      FPF S  KRM  +   +RD+    +               W L  G   
Sbjct: 518 DAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGV 577

Query: 684 VMSKIVQSNDWLEEEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAM 743
                    + +++ V  ++ EGLR L  A K +     E   +         L +D   
Sbjct: 578 THPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGER--------LTKD--- 626

Query: 744 NEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSA 803
               +  +E +L   GL G+ D  + +   +++    AG+ + MLTGD   TA+ +    
Sbjct: 627 ----RDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEV 682

Query: 804 KLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRAEFFEIVIC 863
            ++    Y                  Y K   +  ++      A        E  + +  
Sbjct: 683 GILPHNLY-----------------HYPKEVVDIMVMT-----ATQFDSLTDEELDQLPV 720

Query: 864 LPVVIACRCTPQQKADV--ALLIREMTGKRVCCI-GDGGNDVSMIQCADVGVGIVGKEGK 920
           LP+VIA RC PQ K  +  AL  RE    + C + GDG ND   ++ A+VG+ + G  G 
Sbjct: 721 LPLVIA-RCAPQTKVRMIDALHRRE----KFCAMTGDGVNDSPSLKKANVGIAM-GINGS 774

Query: 921 QASLAADYSITQFCHLTKLL--LWHGRNSYKRSAKLSQFVIHRGLLISVCQAVY 972
             +  A   +    +   +L  +  GR   + S  + +FV+   L  +V QA+Y
Sbjct: 775 DVAKDASDIVLSDDNFASILNAVEEGR---RMSDNIQKFVLQL-LAANVAQAIY 824

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
           complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 76.6 bits (187), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 156/675 (23%), Positives = 268/675 (39%), Gaps = 151/675 (22%)

Query: 280 SQLVPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSL 339
           S LVP      GDLV      RIPAD+ +++S++ S    +    L GET+         
Sbjct: 173 SCLVP------GDLVYFKVGDRIPADVRIIESTDLS----LDESTLTGETE--------- 213

Query: 340 TQNLTQDEMLTKVHITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVA 399
                       VH + +    + +         G   P+    ++     L   G    
Sbjct: 214 -----------PVHKSCTPVNSATYS-----DVPGGIIPIGERTSIAYMGTLVREGHGKG 257

Query: 400 CVIYTGTDTRQA----MNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDD 455
            V+ TG  T       M  S    KT L ++ +++L + L    F LS ++ ++G +   
Sbjct: 258 IVVATGKHTMFGAVFEMMNSIEKPKTPL-QMAMDTLRRDLSYVRFVLSGIIFLLGVIQGR 316

Query: 456 KWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIE 515
            W       + L    IP  L + + +  ++   ++ + K+I    VR     E LG + 
Sbjct: 317 SWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAI----VRRLPSVETLGSVN 372

Query: 516 YLLSDKTGTLTQNDMQLRKI-HLGTVSYTMETMDMVTDYIQTLTSPANMGAAGVAVTGSR 574
            + SDKTGTLT N M   KI  LG+++          + + +L + ++ G  G  +   +
Sbjct: 373 VICSDKTGTLTANHMTASKIWCLGSMAN--------KNNVLSLEAKSSGGLPG-KLPNLK 423

Query: 575 KEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKFTERVGLSLFKRDRHSL 634
             +S  V+  +   + C+N + + E  +      +P +IA+++  ++  L     +R + 
Sbjct: 424 NYLSDDVKATLRIGSICNNASFSHEHGKY---LGNPTDIALLEVLQKFDLV---DERPTT 477

Query: 635 TLFHEYSGVNLQYDILHVFPFTSDTKRMGIIV---RDRTKNEIW-------FLQKGADTV 684
           T   E +             F S  K M + V    +  K+ I+        L++ A  +
Sbjct: 478 TRVDELT-------------FNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFI 524

Query: 685 -----MSKIVQSNDWLEEEVS-NMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLN 738
                + K+  S+  L  + + ++A EGLRTL  A+ + ST      +K   D+++    
Sbjct: 525 GGAGKVEKLSDSHKSLINDCAKSLASEGLRTLAFAQLECST------NKPMNDSTI---- 574

Query: 739 RDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARC 798
                          NL  +GL G++D  +  V+ +IE L   GV + M+TGD   TA  
Sbjct: 575 --------------QNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVN 620

Query: 799 VCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRAEFF 858
           +   A+ I        I+ LT       RL+ +            D LA  + H      
Sbjct: 621 I---ARQIGIPVINPEISVLTG-----DRLDQMT----------DDQLAGVIDH------ 656

Query: 859 EIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGI---- 914
                  V I  R TP+ K ++   +++  G  V   GDG ND   ++ AD+GV +    
Sbjct: 657 -------VNIFARATPEHKLNIVRALQK-RGDIVAMTGDGVNDAPALKLADIGVAMGHMG 708

Query: 915 --VGKEGKQASLAAD 927
             V KE     L  D
Sbjct: 709 TDVAKEASDMVLTDD 723

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 153/681 (22%), Positives = 259/681 (38%), Gaps = 169/681 (24%)

Query: 283 VPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQN 342
           V + NL  GDLV+     RIPAD+ +++S +      V    L GE +            
Sbjct: 159 VLASNLVPGDLVRFKVGDRIPADLRIVESID----LCVDESNLTGENE------------ 202

Query: 343 LTQDEMLTKVHITASA--PEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVAC 400
                    VH ++ A  P+   H+        GS  P+   N +     L   G     
Sbjct: 203 --------PVHKSSGAVDPKNYSHI-------PGSIIPVGDRNCIGFMGTLVREGHGKGI 247

Query: 401 VIYTGTDT--------RQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGL 452
           VI TG  T           ++  K+ ++T +     + L + L    F L  ++ +IG +
Sbjct: 248 VIATGKHTVFGSVFEMMSGIDKPKTPLQTAM-----DKLGQDLSYMSFVLIGIICLIGII 302

Query: 453 DDDKWY----VDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIP 508
               W     + +   +      +P+ + V L LG    A++          IVR     
Sbjct: 303 QGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKR--------KAIVRRLPSV 354

Query: 509 EDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVTDYIQTLTSPANMGAAGV 568
           E LG +  + SDKTGTLT N M + KI      + + +M+  T+ +              
Sbjct: 355 ETLGSVNVICSDKTGTLTANHMTVSKI------WCLGSMENKTNCL-------------- 394

Query: 569 AVTGSRKEVSQRVRDLVVTL---ATCHNVTPNFEDNELAYQAASPDEIAIVKFTERVGLS 625
           A++  ++   +  +D+  TL     C+N T  +    L Y   +P +IAI++  +  G++
Sbjct: 395 ALSKVKERPIKMEQDVATTLRIGNICNNGT--YSQEHLKY-LGNPTDIAILESLQHFGIN 451

Query: 626 LFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVM 685
                R+S+   +E              PF S  K M +   D     + +++   + ++
Sbjct: 452 ---DCRNSVNKINE-------------IPFNSKRKFMAVKTIDANDKVVVYVKGAFEKIV 495

Query: 686 SKIV------------QSND--WLEEEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKD 731
            K +            + ND   + +    +A EGLRTL  A  ++S             
Sbjct: 496 EKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAELEVSAT----------- 544

Query: 732 ASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGD 791
                 + D+  NE     +   L   GL  + D  +  V+++IE L    V + M+TGD
Sbjct: 545 ------HGDKEFNE----DMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGD 594

Query: 792 KVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMS 851
              TA         I+R   +  I             EY   + +    +  D LA  + 
Sbjct: 595 AENTAVS-------IARQIGIPVINP-----------EYSVLSGDKLDQMTDDQLASVID 636

Query: 852 HYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVG 911
           H             V +  R TP+ K ++   +++  G  V   GDG ND   ++ AD+G
Sbjct: 637 H-------------VNVFARATPEHKLNIVRALQK-RGDIVAMTGDGVNDAPALKLADIG 682

Query: 912 VGIVGKEGKQ-ASLAADYSIT 931
           V + GK G   A  A+D  +T
Sbjct: 683 VSM-GKMGTDVAKEASDMVLT 702

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 161/747 (21%), Positives = 275/747 (36%), Gaps = 192/747 (25%)

Query: 215 FFNLYFLLVSLSQSIPALRIGYLSSYI-VPLAFVLVVTMSKEAMDDIQRRRRDRETNNEL 273
           F     +L+ +  ++ +  IG +   + + LA ++VVT+       IQ  R ++      
Sbjct: 102 FVEDRLILLLIGSAVLSFAIGQIDDAVSISLAILIVVTVGF-----IQEYRSEKS----- 151

Query: 274 YEVLNNSQLVPSK---------------NLRVGDLVKLHKDSRIPADMILLQSSEPSGET 318
            E LN  +LVP+K                L  GDLV+     RIPAD+ ++++ + S   
Sbjct: 152 LEALN--KLVPTKCHLIRYGRESNTLASELVPGDLVRFKIGDRIPADVRIIEAVDLS--- 206

Query: 319 FVKTDQLDGETDWKLRVAPSLTQNLTQDEMLTKVHITASAPEKSIHMFTGKLTYKGSSAP 378
            +    L GET+   + A ++                   PE+          Y   + P
Sbjct: 207 -IDESNLTGETEPLHKDAQTID------------------PEE----------YDNRNVP 237

Query: 379 LSVDNTLWANTVLASSGTCVACVIYTGTDTRQA----MNTSKSSVKTGLLELEINSLSKI 434
           +S  + +     L   G     VI TGT+T       M  S    KT L E    ++ ++
Sbjct: 238 VSERSCIAYMGTLVKEGHGKGIVIGTGTNTSYGAIFEMVNSIEKPKTPLQE----TMDRL 293

Query: 435 LCICVFTLSILLVVIGGLDDDKWYVDIMRYLILFSTII-------PVSLRVNLDLGKSVY 487
                +    ++ +I  +   +    +M + +  S  +       P+ + V L LG    
Sbjct: 294 GTELSYISFFIIAIISIVGIIRGNSLLMMFQVSVSLAVAAIPEGLPIIVTVTLALGVLRM 353

Query: 488 ARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETM 547
            +Q        + IVR     E LG +  + +DKTGTLT N M + K+     S T E  
Sbjct: 354 TKQ--------NAIVRRLPSVETLGSVNVICTDKTGTLTTNHMTVSKLFCLDSSGTYENA 405

Query: 548 DMVTDYIQTLTSPANMGAAGVAVTGSRKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQA 607
                      SP       V            V++ +     C+N   + E N      
Sbjct: 406 ----------ISPEEDSEFDVH--------DNDVKETLTIANICNNAKYSEEHN---LYI 444

Query: 608 ASPDEIAIVKFTERVGLSLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVR 667
            +P ++A+++   + G+   +RD H               + +    F S  K M I   
Sbjct: 445 GNPTDVALIEVLTKFGIP-DQRDSH---------------EKMEELSFNSKRKYMAIKSS 488

Query: 668 DRTKNEIWFLQKGADTVMSKIV--------------QSNDWLEEEVSNMAREGLRTLVIA 713
             +   + +++   + ++ K                 S   + E   + A +GLRT+  A
Sbjct: 489 KESGEHVLYIKGAFERILDKSSYYLDKAGEVREFDEHSKVMVLEAAHSCASDGLRTIACA 548

Query: 714 RKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKT 773
            K   +                        + V+     + L   GL G+ D  + +VK 
Sbjct: 549 FKPTDS------------------------DNVISEDDINGLTFTGLFGLADPPRPNVKA 584

Query: 774 SIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKA 833
           SIE L   GV I M+TGD V TA  V ++ K+   G  V                     
Sbjct: 585 SIEKLHRGGVHIIMITGDSVNTA--VSIAEKI---GLSVQ-------------------- 619

Query: 834 NRNSCLLIDGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVC 893
           +R S ++  GD ++       ++  +      V I  R TP+ K ++   +R+  G  V 
Sbjct: 620 DRESSVMT-GDKVSELTEDELSKVID-----KVNIFARATPENKLNIVKALRK-RGDIVA 672

Query: 894 CIGDGGNDVSMIQCADVGV--GIVGKE 918
             GDG ND   ++ AD+G+  GI G +
Sbjct: 673 MTGDGVNDAPALKLADIGIAMGISGTD 699

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
            Ca2+-transporting P-type ATPase, member of the cation
            transporting (E1-E2) P-type ATPase superfamily, functions
            to pump Ca2+ into the vacuole [3522 bp, 1173 aa]
          Length = 1173

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 112/470 (23%), Positives = 183/470 (38%), Gaps = 79/470 (16%)

Query: 649  ILHVFPFTSDTKRMGIIVR---DRTKNEIW-FLQKGADTVMSKIV----QSNDWLEE--- 697
            ++   PF S  K  G++V+    + K   + F  KGA  ++SK       S+D LEE   
Sbjct: 609  VVQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSDDTLEEINE 668

Query: 698  --------EVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKR 749
                    E+ N+A + LR + +A K             +    L    RD+    +   
Sbjct: 669  DNKKETDDEIKNLASDALRAISVAHKDFCE------CDSWPPEQL----RDKDSPNIAAL 718

Query: 750  HLEHN----LELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKL 805
             L  N    L L GL G++D L+  V+ S++  + AGV + M+TGD + TA+ +  +  +
Sbjct: 719  DLLFNSQKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAI 778

Query: 806  ISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRAEFFEIVICLP 865
            +S        +       A+   E+ K  +N                      E +  LP
Sbjct: 779  LSTDISSEAYS-------AMEGTEFRKLTKN----------------------ERIRILP 809

Query: 866  -VVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVG--VGIVGKEGKQA 922
             + +  R +P+ K  +   ++ M G  V   GDG ND   ++ ADVG  +GI G E  + 
Sbjct: 810  NLRVLARSSPEDKRLLVETLKGM-GDVVAVTGDGTNDAPALKLADVGFSMGISGTEVARE 868

Query: 923  SLAADYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIA 982
            +         F  +   + W GR       K  QF +   +   +   V S++S+ +   
Sbjct: 869  ASDIILMTDDFSAIVNAIKW-GRCVSVSIKKFIQFQLIVNITAVILTFVSSVASSDETSV 927

Query: 983  LYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKTYPELYKELTEGRSLSYKTFFVW-VI 1041
            L    L+       T+A   +L L  D      K  P +      GRS S  +   W +I
Sbjct: 928  LTAVQLLWINLIMDTLA---ALALATD------KPDPNIMDRKPRGRSTSLISVSTWKMI 978

Query: 1042 LSLFQGAVIQGFSQLFIGVGSEVFKKMVALSFTALVINELIMVALEIYTW 1091
            LS     +I  F   F   G E+F K      T+    +L  +    + W
Sbjct: 979  LSQATLQLIVTFILHF--YGPELFFKKHEDEITSHQQQQLNAMTFNTFVW 1026

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 79/376 (21%), Positives = 151/376 (40%), Gaps = 47/376 (12%)

Query: 196 AKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPA----LRIGYLSSYIVPLAFVLVVT 251
           A +N  T   + +     F   LY L +   Q  P      ++ ++    + +A  +VV 
Sbjct: 110 AAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGNKIKQVDWIEGVAIMIAVFVVVL 169

Query: 252 MSKEAMDDIQRR----RRDRETNNELYEVLNNSQ--LVPSKNLRVGDLVKLHKDSRIPAD 305
           +S  A +D Q+     + +++  N    V+ N Q  L+   ++ VGD++ L     +PAD
Sbjct: 170 VS--AANDYQKELQFAKLNKKKENRKIIVIRNDQEILISIHHVLVGDVISLQTGDVVPAD 227

Query: 306 MILLQSSEPSGETFVKTDQLDGETD--WKLRVAPSLTQNLTQDEMLTKVHITASAPEKSI 363
            +++     SG+       + GE++   K  V  SL      + + +  H   S P    
Sbjct: 228 CVMI-----SGKCEADESSITGESNTIQKFPVDNSLRDFKKFNSIDSHNH---SKP---- 275

Query: 364 HMFTGKLTYKGSSAPLSVDNTLWANT-VLASSGTCVACVIYTGTDTRQAMNTSKSSVKTG 422
            +  G +   G+      D  L + + +L+  G  V   +   +   Q M +  +  ++ 
Sbjct: 276 -LDIGDVNEDGNKI---ADCMLISGSRILSGLGRGVITSVGINSVYGQTMTSLNAEPEST 331

Query: 423 LLELEINSLSKILCI--CVFTLSILLVVIG--------------GLDDDKWYVDIMRYLI 466
            L+L ++ L+  + +  CV  + + LV+                 LD  +     M   I
Sbjct: 332 PLQLHLSQLADNISVYGCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFI 391

Query: 467 LFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLT 526
              T+I V++   L L  ++      +  +    +VR     E +G    + SDKTGTLT
Sbjct: 392 TSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKTGTLT 451

Query: 527 QNDMQLRKIHLGTVSY 542
           +N M + +   G   +
Sbjct: 452 ENVMTVVRGFPGNSKF 467

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 151/681 (22%), Positives = 261/681 (38%), Gaps = 155/681 (22%)

Query: 277 LNNSQLVPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGET----DWK 332
           +  ++L+P   + V  +V+  +DS +P D+IL+      G   V    L GE+       
Sbjct: 265 MQTNELLP---MDVVSVVRTAEDSALPCDLILV-----DGTCIVNEAMLSGESTPLLKES 316

Query: 333 LRVAPSLTQNLTQDEMLTKVHITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLA 392
           +R+ P   +   Q E   K+ +      K + + T + T K  S P              
Sbjct: 317 IRLRPGNEE--LQIEGTDKISVLHGG-TKVLQVTTPEKTGKVPSPP-------------- 359

Query: 393 SSGTCVACVIYTGTDTRQAMNTS---KSSVKTGLLELEINSLSKILCICVFTLSILLVVI 449
             G  +A V  TG +T Q         SS + G+   E  +L  IL + +F +       
Sbjct: 360 -DGGAIAIVTKTGFETSQGSLVRVMIYSSERVGVDNKE--ALYFILFLLIFAVVA----- 411

Query: 450 GGLDDDKWYV-------------DIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKS 496
                  WYV              I+  +++ ++++P  L + L +        + S  S
Sbjct: 412 ------SWYVWVEGTKMGRVQSKLILDCILIITSVVPPELPMELTMA-------VNSSLS 458

Query: 497 IPDTIVRTSTIPEDL---GRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVTDY 553
                    T P  +   GRI+    DKTGTLT  D+    +  G    + +  D     
Sbjct: 459 ALSKFYVYCTEPFRIPFAGRIDVCCFDKTGTLTGEDL----VFEGLAGLSSDPKD----- 509

Query: 554 IQTLTSPANMGAAGVAVTGSRKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEI 613
           I+ L S  +   +   V G+   +   VR                ED E+      P E 
Sbjct: 510 IRHLYSATDCPNSTSLVVGAAHAL---VR---------------LEDGEIV---GDPMEK 548

Query: 614 AIVKFTERVGLSLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNE 673
           A +K    +  ++ K D+    +F+E +G   Q  IL  F F+S  KR   +     K  
Sbjct: 549 ATLK---ALKWTVEKGDK----VFNEKNG---QVTILRRFQFSSALKRSSSVATHDGK-- 596

Query: 674 IWFLQKGA-DTVMSKIVQSNDWLEEEVSNMAREGLRTLVIARKKLSTRLYEQFSK-EYKD 731
           ++   KGA +T+  ++       +E   +  R G R L +A KKL     E+ S+ + +D
Sbjct: 597 LYSAVKGAPETIRERLFTIPANYDEIYKSFTRSGSRVLALASKKL-----EKMSQSQIED 651

Query: 732 ASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGD 791
           A               + H E +LE  G       L+ D   +I++L  +  +  M+TGD
Sbjct: 652 AD--------------REHFERDLEFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGD 697

Query: 792 KVETARCVCVSAKLISRGQYVHTITKLTRRDGALSR-------LEYLKANRNSC------ 838
              TA  V     ++     +  +      D  + R        E++  +++S       
Sbjct: 698 NPLTAVHVAKEVGIVKGETLIVDMVDNGNDDKLVFRNVEETLSFEFV-VSKDSFEKYGIF 756

Query: 839 ----LLIDGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCC 894
               L + G +L     H++ +     +     I  R +P QK  +   +++M  + + C
Sbjct: 757 DKYDLAVTGHALEALKGHHQLQ----DLIRHAWIYARVSPAQKEFILNNLKDMGYQTLMC 812

Query: 895 IGDGGNDVSMIQCADVGVGIV 915
            GDG NDV  ++ A VGV ++
Sbjct: 813 -GDGTNDVGALKQAHVGVALL 832

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 149/696 (21%), Positives = 259/696 (37%), Gaps = 178/696 (25%)

Query: 274 YEVLNNSQLVPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKL 333
           +++L  ++L+P   + V    +  +DS +  DMIL+      G   V    L GE+   L
Sbjct: 264 WQLLQTNELLPMDLISV---TRTDEDSALSCDMILV-----DGTCIVNEAMLSGESTPLL 315

Query: 334 RVAPSL--------TQNLTQDEML---TKVHITASAPEKSIHMFTGKLTYKGSSAPLSVD 382
           + +  L         + L ++ +L   TKV +  +APEK             SS P   D
Sbjct: 316 KESVKLRSSEEKLQVEGLDKNSVLHGGTKV-LQVTAPEKG-----------SSSIPAPPD 363

Query: 383 NTLWANTVLASSGTCVACVIYTGTDTRQA-----MNTSKSSVKTGLLELEINSLSKILCI 437
                       G  +A V  TG +T Q      M  S   V  G  E    +L  IL +
Sbjct: 364 ------------GGALAVVSKTGFETSQGALVRVMIYSSERVSVGNKE----ALYFILFL 407

Query: 438 CVFTLSILLVVIGGLDDDKWYV-------------DIMRYLILFSTIIPVSLRVNLDLGK 484
            +F ++             WYV              I+  +++ ++++P  L + L +  
Sbjct: 408 LIFAIAA-----------SWYVWVEGTRMGRVQSKLILDCILIITSVVPSELPMELTMA- 455

Query: 485 SVYARQIESDKSIPDTIVRTSTIPEDL---GRIEYLLSDKTGTLTQNDMQLRKIHLGTVS 541
                 + +  ++        T P  +   GRI+    DKTGTLT  D+           
Sbjct: 456 ------VNNSLAVLSKFYVYCTEPFRIPLAGRIDVCCFDKTGTLTGEDLVFE-------- 501

Query: 542 YTMETMDMVTDYIQTLTSPANMGAAGVAVTGSRKEVSQRVRDLVVTLAT-----CHNVTP 596
                                 G AG+A  G  + V+   +   V L T       +   
Sbjct: 502 ----------------------GLAGLA--GKNQPVNHLFKGTEVPLDTNLVIGAAHALV 537

Query: 597 NFEDNELAYQAASPDEIAIVKFTERVGLSLFKRDRHSLTLFHEYSGVNLQYDILHVFPFT 656
             +D+E+      P E A +  T   G  +  +D    +L +E  G      IL  F F+
Sbjct: 538 RLDDDEVV---GDPMEKATLAAT---GWKVGVKD----SLSNEKVG---DISILRRFQFS 584

Query: 657 SDTKRMGIIVRDRTKNEIWFLQKGA-DTVMSKIVQSNDWLEEEVSNMAREGLRTLVIARK 715
           S  KR   I     ++  +   KGA +T+  ++ Q     ++   +  R G R L +A K
Sbjct: 585 SALKRSSTIAVHNKQH--YSAVKGAPETIRERLSQVPTDYDQVYKSFTRAGSRVLALASK 642

Query: 716 KLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSI 775
           KL +   +Q  K  ++A                  +E +LE  G       L+ D   +I
Sbjct: 643 KLPSMSIKQIEKLEREA------------------VESDLEFKGFLVFHCPLKDDAIETI 684

Query: 776 ELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYV---------HTI-------TKLT 819
           ++L  +  +  M+TGD   TA  V     ++ R   +         H +       T + 
Sbjct: 685 KMLNESSHRCIMITGDNPLTAVHVAKEVAIVERETLILDEPIDGSSHALVFRNIEETIVN 744

Query: 820 RRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKAD 879
             +      E+ K      + + G +L +   H  ++  E++      +  R +P QK  
Sbjct: 745 PFNPEKDTFEHSKLFAKYDIAVTGHALQLLSGH--SQLNELI--RHTWVYARVSPAQKEF 800

Query: 880 VALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIV 915
           +   +++M  + + C GDG NDV  ++ A VG+ ++
Sbjct: 801 IMNSLKDMGYQTLMC-GDGTNDVGALKQAHVGIALL 835

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P-type
            ATPase of the plasma membrane, expression not detected
            under normal growth conditions [2844 bp, 947 aa]
          Length = 947

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 112/528 (21%), Positives = 184/528 (34%), Gaps = 119/528 (22%)

Query: 565  AAGVAVTGSRKEVSQR---VRDLVVTLATCHNVTPNFEDNELAY------QAASPDEIAI 615
            A G A    ++ + Q+   +  L      C + T     N+L+       +  SPD++ +
Sbjct: 376  AVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLML 435

Query: 616  VKF--TERVGLSLFKRDRHSLTLFHEYSGVN---LQYDILHVFPFTSDTKRMGIIVRDRT 670
                   R    L   D+  L    EY        +Y +L   PF   +K++  +V    
Sbjct: 436  TACLAASRKKKGLDAIDKAFLKSLIEYPKAKDALTKYKVLEFHPFDPVSKKVTAVVESPE 495

Query: 671  KNEIWFLQKGADTVMSKIVQSNDWLEEEV--------SNMAREGLRTLVIARKKLSTRLY 722
               I    KGA   + K V+ +  + E+V        + +A  G R L +ARK+      
Sbjct: 496  GERI-VCVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVARKRG----- 549

Query: 723  EQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAG 782
                                         E + E+LG+    D  + D   +I   RN G
Sbjct: 550  -----------------------------EGHWEILGVMPCMDPPRDDTAQTINEARNLG 580

Query: 783  VKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLID 842
            ++I MLTGD V  A+  C    L +       +      D   S L     N +      
Sbjct: 581  LRIKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGF---- 636

Query: 843  GDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDV 902
                        AE F               PQ K  V  +++   G  V   GDG ND 
Sbjct: 637  ------------AEVF---------------PQHKYRVVEILQN-RGYLVAMTGDGVNDA 668

Query: 903  SMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIHRG 962
              ++ AD G+ + G      S AAD           + L  G ++   + K S+ + HR 
Sbjct: 669  PSLKKADTGIAVEGATDAARS-AADI----------VFLAPGLSAIIDALKTSRQIFHR- 716

Query: 963  LLISVCQAVYSISSNLKPIALYQG-WLMVGYAT--------CYTMAPVFSLTLDHD---- 1009
                    VY I+ +L  + ++ G W+ +   +            A V +LT+ +D    
Sbjct: 717  ---MYSYVVYRIALSLH-LEIFLGLWIAILNNSLDINLIVFIAIFADVATLTIAYDNAPY 772

Query: 1010 IDESLTKTYPELYK-ELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQL 1056
              E +    P L+   +  G  L+  ++     + L  G +IQ F  +
Sbjct: 773  APEPVKWNLPRLWGMSIILGIVLAIGSWITLTTMFLPNGGIIQNFGAM 820

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 66/279 (23%), Positives = 119/279 (42%), Gaps = 55/279 (19%)

Query: 271 NELYEVLNNSQLVPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETD 330
           +EL + L N+  V    +R G L+++  +  +P +++ L+S                   
Sbjct: 199 DELKKTLANTATV----IRDGQLIEIPANEVVPGEILQLESG------------------ 236

Query: 331 WKLRVAPSLTQNLTQDEMLTKVHITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTV 390
               +AP+  + +T+D  L    I  SA           +T +  +A     + +++++ 
Sbjct: 237 ---TIAPADGRIVTEDCFL---QIDQSA-----------ITGESLAAEKHYGDEVFSSST 279

Query: 391 LASSGTCVACVIYTGTDT---RQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLV 447
           +  +G     V  TG +T   R A    ++S   G     +N +  IL + V   ++LLV
Sbjct: 280 V-KTGEAFMVVTATGDNTFVGRAAALVGQASGVEGHFTEVLNGIGIILLVLVIA-TLLLV 337

Query: 448 VIGGLDDDKWYVDIMRYLILFSTI-IPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTST 506
                      V I+RY +  + I +PV L   +    +V A  +   ++I    V+  +
Sbjct: 338 WTACFYRTVGIVSILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAI----VQKLS 393

Query: 507 IPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTME 545
             E L  +E L SDKTGTLT+N + L +       YT+E
Sbjct: 394 AIESLAGVEILCSDKTGTLTKNKLSLHE------PYTVE 426

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 69/316 (21%), Positives = 117/316 (37%), Gaps = 70/316 (22%)

Query: 646 QYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDWLEEEVSNMARE 705
           +Y +L   PF   +K++  IV +  + E     KGA   + K V+ N  + E+V      
Sbjct: 423 KYKVLEFHPFDPVSKKVTAIV-ESPEGERIVCVKGAPLFVLKTVEENHLIPEDV------ 475

Query: 706 GLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVED 765
                   ++    ++ E  S+ Y+               V ++  E + E+LG+    D
Sbjct: 476 --------KENYENKVAELASRGYRALG------------VARKRGEGHWEILGVMPCMD 515

Query: 766 KLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGAL 825
             + D   ++   R+ G+++ MLTGD V  A+  C    L +       +      D   
Sbjct: 516 PPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPG 575

Query: 826 SRLEYLKANRNSCLLIDGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIR 885
           S L     N +                  AE F               PQ K +V  +++
Sbjct: 576 SELADFVENADGF----------------AEVF---------------PQHKYNVVEILQ 604

Query: 886 EMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGR 945
           +  G  V   GDG ND   ++ AD G+ + G      S AAD           + L  G 
Sbjct: 605 Q-RGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARS-AADI----------VFLAPGL 652

Query: 946 NSYKRSAKLSQFVIHR 961
           ++   + K S+ + HR
Sbjct: 653 SAIIDALKTSRQIFHR 668

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 48/91 (52%), Gaps = 11/91 (12%)

Query: 459 VDIMRYLILFSTI-IPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYL 517
           V I+RY +  + + +PV L   +    +V A  +   K+I   + + S I E L  +E L
Sbjct: 301 VTILRYTLAITVVGVPVGLPAVVTTTMAVGAAYLAKKKAI---VQKLSAI-ESLAGVEIL 356

Query: 518 LSDKTGTLTQNDMQLRKIHLGTVSYTMETMD 548
            SDKTGTLT+N + L +       YT+E ++
Sbjct: 357 CSDKTGTLTKNKLSLHE------PYTVEGVE 381

>Scas_583.14*
          Length = 875

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 118/295 (40%), Gaps = 44/295 (14%)

Query: 649 ILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGA-DTVMSKIVQSNDWLEEEVSNMAREGL 707
           IL  F F+S  KR   +     K++++   KGA +T+  ++       +E   +  R G 
Sbjct: 230 ILRRFQFSSALKRSSSVASH--KDKLFTAVKGAPETIRERLAVVPKNYDEIYKSFTRSGS 287

Query: 708 RTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKL 767
           R L +A K L     +Q         L  L+RDE         +E  L   G       L
Sbjct: 288 RVLALASKSLPNLSSKQ---------LDDLDRDE---------IETGLTFNGFLVFHCPL 329

Query: 768 QKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSR 827
           + D   +I++L  +  +  M+TGD   TA  V     +++ G+ +      T  DG   +
Sbjct: 330 KPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVT-GETLILDKSETVGDG---K 385

Query: 828 LEYLKANRNSCLLIDG-----------DSLAIYMSHYRAEFFEIVICLPVVIA-----CR 871
           L +        +  D            D   I ++ Y     E    L  +I       R
Sbjct: 386 LLFFNVEETIKIPFDPASDKFDHRELFDKYDIAVTGYALNLLEDHSQLKDLIRHTWVYAR 445

Query: 872 CTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAA 926
            +P QK  +   ++EM  + + C GDG NDV  ++ A VGV ++   G + S+ A
Sbjct: 446 VSPSQKEFILNNLKEMGYQTLMC-GDGTNDVGALKQAHVGVALLN--GTEESMTA 497

>Scas_688.1
          Length = 913

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 72/324 (22%), Positives = 118/324 (36%), Gaps = 86/324 (26%)

Query: 646 QYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDWLEEE------- 698
           +Y +L   PF   +K++  +V       I    KGA   + K V+ +  + E+       
Sbjct: 437 KYKVLEFHPFDPVSKKVTAVVESPEGERI-ICVKGAPLFVLKTVEEDHPIPEDIHENYEN 495

Query: 699 -VSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLEL 757
            V+ +A  G R L +ARK+                                   E + E+
Sbjct: 496 KVAELASRGFRALGVARKRG----------------------------------EGHWEI 521

Query: 758 LGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITK 817
           LG+    D  + D   ++   R  G+++ MLTGD V  A+  C   + +  G  V+   +
Sbjct: 522 LGVMPCMDPPRDDTGETVAEARRLGLRVKMLTGDAVGIAKETC---RQLGLGTNVYNAER 578

Query: 818 LTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQK 877
           L    G                 + G  LA ++ +    F E+             PQ K
Sbjct: 579 LGLSGGG---------------DMPGSELADFVENADG-FAEVF------------PQDK 610

Query: 878 ADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLT 937
             V + I +  G  V   GDG ND   ++ AD G+ + G     A  AAD          
Sbjct: 611 YRV-VEILQTRGYLVAMTGDGVNDAPSLKKADTGIAVEGAT-DAARSAADI--------- 659

Query: 938 KLLLWHGRNSYKRSAKLSQFVIHR 961
            + L  G ++   + K S+ + HR
Sbjct: 660 -VFLAPGLSAIIDALKTSRQIFHR 682

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 46/88 (52%), Gaps = 11/88 (12%)

Query: 459 VDIMRYLILFSTI-IPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYL 517
           V I+RY +  + + +PV L   +    +V A  +   ++I   + + S I E L  +E L
Sbjct: 315 VRILRYTLGITIVGVPVGLPAVVTTTMAVGAAYLAKKQAI---VQKLSAI-ESLAGVEIL 370

Query: 518 LSDKTGTLTQNDMQLRKIHLGTVSYTME 545
            SDKTGTLT+N + L +       YT+E
Sbjct: 371 CSDKTGTLTKNKLSLHE------PYTVE 392

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 87/419 (20%), Positives = 148/419 (35%), Gaps = 100/419 (23%)

Query: 565 AAGVAVTGSRKEVSQR---VRDLVVTLATCHNVTPNFEDNELAY------QAASPDEI-- 613
           A G A    ++ + Q+   +  L      C + T     N+L+       +   PD++  
Sbjct: 328 AVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVDPDDLML 387

Query: 614 --AIVKFTERVGL-SLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRT 670
              +    ++ GL ++ K    SL  +        +Y +L   PF   +K++  IV +  
Sbjct: 388 TACLAASRKKKGLDAIDKAFLKSLISYPRAKAALTKYKLLEFHPFDPVSKKVTAIV-ESP 446

Query: 671 KNEIWFLQKGADTVMSKIVQSNDWLEEEV--------SNMAREGLRTLVIARKKLSTRLY 722
           + E     KGA   + K V+    + E+V        + +A  G R L +ARK+      
Sbjct: 447 EGERIICVKGAPLFVLKTVEEEHPIPEDVRENYENKVAELASRGFRALGVARKRG----- 501

Query: 723 EQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAG 782
                                        E + E+LG+    D  + D   ++   R+ G
Sbjct: 502 -----------------------------EGHWEILGVMPCMDPPRDDTAQTVNEARHLG 532

Query: 783 VKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLID 842
           +++ MLTGD V  A+  C    L +       +      D   S L     N +      
Sbjct: 533 LRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGF---- 588

Query: 843 GDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDV 902
                       AE F               PQ K +V  ++++  G  V   GDG ND 
Sbjct: 589 ------------AEVF---------------PQHKYNVVEILQQ-RGYLVAMTGDGVNDA 620

Query: 903 SMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIHR 961
             ++ AD G+ + G      S AAD           + L  G ++   + K S+ + HR
Sbjct: 621 PSLKKADTGIAVEGATDAARS-AADI----------VFLAPGLSAIIDALKTSRQIFHR 668

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 48/91 (52%), Gaps = 11/91 (12%)

Query: 459 VDIMRYLILFSTI-IPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYL 517
           V I+RY +  + + +PV L   +    +V A  +   ++I   + + S I E L  +E L
Sbjct: 301 VRILRYTLAITIVGVPVGLPAVVTTTMAVGAAYLAKKQAI---VQKLSAI-ESLAGVEIL 356

Query: 518 LSDKTGTLTQNDMQLRKIHLGTVSYTMETMD 548
            SDKTGTLT+N + L +       YT+E +D
Sbjct: 357 CSDKTGTLTKNKLSLHE------PYTVEGVD 381

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 87/419 (20%), Positives = 143/419 (34%), Gaps = 100/419 (23%)

Query: 565 AAGVAVTGSRKEVSQR---VRDLVVTLATCHNVTPNFEDNELAY------QAASPDEIAI 615
           A G A    ++ + Q+   +  L      C + T     N+L+       +  SPD++ +
Sbjct: 347 AVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLML 406

Query: 616 VKF--TERVGLSLFKRDRHSLTLFHEYSGVN---LQYDILHVFPFTSDTKRMGIIVRDRT 670
                  R    L   D+  L    +Y        +Y +L   PF   +K++  +V    
Sbjct: 407 TACLAASRKKKGLDAIDKAFLKSLKQYPKAKDALTKYKVLEFHPFDPVSKKVTAVVESPE 466

Query: 671 KNEIWFLQKGADTVMSKIVQSNDWLEEEV--------SNMAREGLRTLVIARKKLSTRLY 722
              I    KGA   + K V+ +  + E+V        + +A  G R L +ARK+      
Sbjct: 467 GERI-VCVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVARKRG----- 520

Query: 723 EQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAG 782
                                        E + E+LG+    D  + D   ++   R+ G
Sbjct: 521 -----------------------------EGHWEILGVMPCMDPPRDDTAQTVSEARHLG 551

Query: 783 VKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLID 842
           +++ MLTGD V  A+  C    L +       +      D   S L     N +      
Sbjct: 552 LRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGF---- 607

Query: 843 GDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDV 902
                       AE F               PQ K  V  +++   G  V   GDG ND 
Sbjct: 608 ------------AEVF---------------PQHKYRVVEILQN-RGYLVAMTGDGVNDA 639

Query: 903 SMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIHR 961
             ++ AD G+ + G      S AAD           + L  G ++   + K S+ + HR
Sbjct: 640 PSLKKADTGIAVEGATDAARS-AADI----------VFLAPGLSAIIDALKTSRQIFHR 687

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 117/279 (41%), Gaps = 55/279 (19%)

Query: 271 NELYEVLNNSQLVPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETD 330
           +EL + L N+ +V    +R G LV++  +  +P D++ L+               DG   
Sbjct: 170 DELKKTLANTAVV----IRDGQLVEIPANEVVPGDILQLE---------------DG--- 207

Query: 331 WKLRVAPSLTQNLTQDEMLTKVHITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTV 390
               V P+  + +T+D  L       +    ++    G             D T  ++TV
Sbjct: 208 ---TVIPTDGRIVTEDCFLQIDQSAITGESLAVDKHYG-------------DQTFSSSTV 251

Query: 391 LASSGTCVACVIYTGTDT---RQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLV 447
               G  V  V  TG +T   R A   +K++   G     +N +  IL + V   ++LLV
Sbjct: 252 KRGEGFMV--VTATGDNTFVGRAAALVNKAAGGQGHFTEVLNGIGIILLVLVIA-TLLLV 308

Query: 448 VIGGLDDDKWYVDIMRYLILFSTI-IPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTST 506
                      V I+RY +  + I +PV L   +    +V A  +   ++I   + + S 
Sbjct: 309 WTACFYRTNGIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAI---VQKLSA 365

Query: 507 IPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTME 545
           I E L  +E L SDKTGTLT+N + L +       YT+E
Sbjct: 366 I-ESLAGVEILCSDKTGTLTKNKLSLHE------PYTVE 397

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 95/424 (22%), Positives = 162/424 (38%), Gaps = 88/424 (20%)

Query: 512 GRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVTDYIQTLTSPANMGAAGVAVT 571
           GRI+    DKTGTLT  D+      L  +S   E        I+ L S A    + + V 
Sbjct: 479 GRIDVCCFDKTGTLTGEDLVFEG--LAGISADSEN-------IRHLYSAAEAPESTILVI 529

Query: 572 GSRKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKFTERVGLSLFKRDR 631
           G+   + +                   ED ++      P E A +K    VG ++ +++ 
Sbjct: 530 GAAHALVK------------------LEDGDIV---GDPMEKATLK---AVGWAVERKNS 565

Query: 632 HSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQ-KGA-DTVMSKIV 689
           +    + E +G   + DI+  F F+S  KR   I    + N+  F   KGA +T+  ++ 
Sbjct: 566 N----YREGTG---KLDIIRRFQFSSALKRSASIA---SHNDALFAAVKGAPETIRERLS 615

Query: 690 QSNDWLEEEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKR 749
                 +E   +  R G R L +A K L          +   + +  LNRD+        
Sbjct: 616 DIPKNYDEIYKSFTRSGSRVLALASKSLP---------KMSQSKIDDLNRDD-------- 658

Query: 750 HLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRG 809
            +E  L   G       L+ D   +I++L  +  +  M+TGD   TA  V     +    
Sbjct: 659 -VESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGI---- 713

Query: 810 QYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRA-EFFEIVICLPVVI 868
             V   T +  R G     + L  +    + I  D       H +  + ++I +    + 
Sbjct: 714 --VFGETLILDRAGKSDDNQLLFRDVEETVSIPFDPSKDTFDHSKLFDRYDIAVTGYALN 771

Query: 869 A-----------------CRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVG 911
           A                  R +P QK  +   +++M  + + C GDG NDV  ++ A VG
Sbjct: 772 ALEGHSQLRDLLRHTWVYARVSPSQKEFLLNTLKDMGYQTLMC-GDGTNDVGALKQAHVG 830

Query: 912 VGIV 915
           + ++
Sbjct: 831 IALL 834

>Kwal_47.17522
          Length = 899

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 86/419 (20%), Positives = 145/419 (34%), Gaps = 100/419 (23%)

Query: 565 AAGVAVTGSRKEVSQR---VRDLVVTLATCHNVTPNFEDNELAY------QAASPDEI-- 613
           A G A    ++ + Q+   +  L      C + T     N+L+       +   PD++  
Sbjct: 328 AVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEPDDLML 387

Query: 614 --AIVKFTERVGL-SLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRT 670
              +    ++ GL ++ K    SL  +        +Y +L   PF   +K++  +V    
Sbjct: 388 TACLAASRKKKGLDAIDKAFLKSLIQYPRAKNALTKYKVLDFHPFDPVSKKVTAVVESPE 447

Query: 671 KNEIWFLQKGADTVMSKIVQSNDWLEEEV--------SNMAREGLRTLVIARKKLSTRLY 722
              I    KGA   + K V+ +  + E+V        + +A  G R L +ARK+      
Sbjct: 448 GERI-ICVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVARKRG----- 501

Query: 723 EQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAG 782
                                        E + E+LG+    D  + D   ++   R  G
Sbjct: 502 -----------------------------EGHWEILGVMPCMDPPRDDTAQTVHEARRLG 532

Query: 783 VKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLID 842
           +++ MLTGD V  A+  C    L +       +      D   S L     N +      
Sbjct: 533 LRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGF---- 588

Query: 843 GDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDV 902
                       AE F               PQ K  V  ++++  G  V   GDG ND 
Sbjct: 589 ------------AEVF---------------PQHKYSVVEILQQ-RGYLVAMTGDGVNDA 620

Query: 903 SMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIHR 961
             ++ AD G+ + G      S AAD           + L  G ++   + K S+ + HR
Sbjct: 621 PSLKKADTGIAVEGATDAARS-AADI----------VFLAPGLSAIIDALKTSRQIFHR 668

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 48/91 (52%), Gaps = 11/91 (12%)

Query: 459 VDIMRYLILFSTI-IPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYL 517
           V I+RY +  + I +PV L   +    +V A  +   ++I   + + S I E L  +E L
Sbjct: 301 VRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAI---VQKLSAI-ESLAGVEIL 356

Query: 518 LSDKTGTLTQNDMQLRKIHLGTVSYTMETMD 548
            SDKTGTLT+N + L +       YT+E ++
Sbjct: 357 CSDKTGTLTKNKLSLHE------PYTVEGVE 381

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 93/433 (21%), Positives = 160/433 (36%), Gaps = 91/433 (21%)

Query: 512 GRIEYLLSDKTGTLTQNDM---QLRKIHLGTVSYTMETMDMVTDYIQTLTSPANMGAAGV 568
           GRI+    DKTGTLT  D+    L  +H G+    + T+    D  Q + S   +GAA  
Sbjct: 478 GRIDVCCFDKTGTLTAEDLVFEGLAGLHDGS---DIRTLKSANDASQEVLSA--IGAAHA 532

Query: 569 AVTGSRKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKFTERVGLSLFK 628
            V     E+     +     A+   V  +F+D     + A  D I I             
Sbjct: 533 LVKLDDGEIVGDPMEKATLKASSWTV--DFKD---VVKRAGADNIRI------------- 574

Query: 629 RDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGA-DTVMSK 687
                                L  F F+S  KR   I      N  +   KGA +T+  +
Sbjct: 575 ---------------------LRRFQFSSSLKRSASIASQ--SNRFFAAVKGAPETIRER 611

Query: 688 IVQSNDWLEEEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVV 747
           +       ++   +  R G R L +A K L          +  ++ +  ++RDE      
Sbjct: 612 LNSVPSDYDDIYKSFTRSGSRVLALAYKDLP---------KMSNSQIDNIDRDE------ 656

Query: 748 KRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLIS 807
              +E  L           L+ D   +I++L  +  +  M+TGD   TA  V     ++ 
Sbjct: 657 ---IETGLTFGAFLVFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVD 713

Query: 808 RGQYV------HTITKLTRRDGALSRLEYLKANRNSC----------LLIDGDSLAIYMS 851
           R   +       +   L  RD   + ++    + ++           L + G +L +   
Sbjct: 714 RETLILDEPIDGSSHALVMRDVNETIVKPFNPDADTFDEKEIFQKYDLAVTGHALKLLQG 773

Query: 852 HYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVG 911
           H +       +     I  R +P QK  + + +++M  + + C GDG NDV  ++ A VG
Sbjct: 774 HKQLR----DVIRHTWIYARVSPSQKEFILITLKDMGYQTLMC-GDGTNDVGALKQAHVG 828

Query: 912 VGIVGKEGKQASL 924
           + ++   G + SL
Sbjct: 829 IALLN--GTEDSL 839

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 59/279 (21%), Positives = 95/279 (34%), Gaps = 75/279 (26%)

Query: 646 QYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDWLEEEV------ 699
           +Y ++   PF   +K++  +V       I    KGA   + K V+ +  + E+V      
Sbjct: 426 KYKVIEFHPFDPVSKKVTAVVESPEGERI-VCVKGAPLFVLKTVEEDHPIPEDVHENYEN 484

Query: 700 --SNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLEL 757
             + +A  G R L +ARK+                                   E + E+
Sbjct: 485 KVAELASRGFRALGVARKRG----------------------------------EGHWEI 510

Query: 758 LGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITK 817
           LG+    D  + D   ++   R  G+++ MLTGD V  A+  C    L +       +  
Sbjct: 511 LGVMPCMDPPRDDTAETVNEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGL 570

Query: 818 LTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQK 877
               D   S L     N +                  AE F               PQ K
Sbjct: 571 GGGGDMPGSELADFVENADGF----------------AEVF---------------PQHK 599

Query: 878 ADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVG 916
             V  +++   G  V   GDG ND   ++ AD G+ + G
Sbjct: 600 YKVVEILQN-RGYLVAMTGDGVNDAPSLKKADTGIAVEG 637

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 45/88 (51%), Gaps = 11/88 (12%)

Query: 459 VDIMRYLILFSTI-IPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYL 517
           V I+R+ +  + I +PV L   +    +V A  +   ++I    V+  +  E L  +E L
Sbjct: 304 VKILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAI----VQKLSAIESLAGVEIL 359

Query: 518 LSDKTGTLTQNDMQLRKIHLGTVSYTME 545
            SDKTGTLT+N + L +       YT+E
Sbjct: 360 CSDKTGTLTKNKLSLHE------PYTVE 381

>Scas_710.41
          Length = 904

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 69/300 (23%), Positives = 107/300 (35%), Gaps = 82/300 (27%)

Query: 630 DRHSLTLFHEY-SGVNL--QYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMS 686
           DR  L   ++Y   +N   +Y IL   PF   +K++  +V+   + E     KGA   + 
Sbjct: 410 DRAFLKSLNQYPKAMNALPKYKILEFHPFDPVSKKVTAVVKS-PEGETITCVKGAPLFVL 468

Query: 687 KIVQSN--------DWLEEEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLN 738
           K V+ +        +  E +V+ +A  G R+L +ARK+                      
Sbjct: 469 KTVEEDHPVPEDVHENYENKVAELASRGFRSLGVARKR---------------------- 506

Query: 739 RDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARC 798
                        E   E+LG+    D  + D   +I   R  G+++ MLTGD V     
Sbjct: 507 ------------GEGYWEILGVMPCMDPPRDDTARTIAEARTLGLRVKMLTGDAV----- 549

Query: 799 VCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLID--GDSLAIYMSHYRAE 856
                           I K T R   L    Y           D  G  LA ++ +    
Sbjct: 550 ---------------GIAKETSRQLGLGVNIYNAEKLGLGGGGDMPGSELADFVENADG- 593

Query: 857 FFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVG 916
           F E+             PQ K  V  +++   G  V   GDG ND   ++ AD G+ + G
Sbjct: 594 FAEVF------------PQHKYKVVEILQN-RGYLVAMTGDGVNDAPSLKKADTGIAVEG 640

 Score = 34.3 bits (77), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 46/88 (52%), Gaps = 11/88 (12%)

Query: 459 VDIMRYLILFSTI-IPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYL 517
           V I+R+ +  + I +PV L   +    +V A  +   ++I   + + S I E L  +E L
Sbjct: 307 VMILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAI---VQKLSAI-ESLAGVEIL 362

Query: 518 LSDKTGTLTQNDMQLRKIHLGTVSYTME 545
            SDKTGTLT+N + L +       YT+E
Sbjct: 363 CSDKTGTLTKNKLSLHE------PYTVE 384

>Scas_227.0d
          Length = 307

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 37/82 (45%), Gaps = 12/82 (14%)

Query: 648 DILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQS------------NDWL 695
           +I  + PF S  K  GIIV+ +  N   F  KGA  ++S    S             D +
Sbjct: 184 EIAQIIPFESTRKWGGIIVKYKESNLYRFFIKGAAEIVSNNCHSKRNSDDSIVTLNKDQI 243

Query: 696 EEEVSNMAREGLRTLVIARKKL 717
            +E+ N+A + LR L +A +  
Sbjct: 244 NKEIENLANDALRALSLAHRDF 265

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 37.7 bits (86), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 18/117 (15%)

Query: 707 LRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDK 766
           + T+ I  KKL           + D SLS    D A + + + ++  +  L+G   + D+
Sbjct: 706 IHTITIGNKKL-----------FPDESLS----DIASSTLTESYVSIDGSLVGKFEISDR 750

Query: 767 LQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKL-ISRGQYVHTITKLTRRD 822
           +++D    +E L+N G+K  M+TGD  ++A  + V+ +L IS       +T   +RD
Sbjct: 751 VKEDAHFVVEYLQNLGIKCCMVTGDAHQSA--LKVAQQLGISANDVFSEVTPEQKRD 805

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (61%)

Query: 873 TPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGI 914
           TP+QK D+ + ++    +RV  +GDG ND   +  AD+G+ I
Sbjct: 799 TPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISI 840

>KLLA0D04092g complement(344666..348124) some similarities with
           sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
           copper-transporting ATPase P16.2.f2.1, hypothetical
           start
          Length = 1152

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%)

Query: 760 LTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVC 800
           +   +D+++ + K  I+ LR +G++ WM++GD   TAR V 
Sbjct: 924 MCAAKDEIRPEAKDVIKELRRSGIECWMISGDNEVTARAVA 964

>Scas_297.1
          Length = 800

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 7/74 (9%)

Query: 259 DIQRRRRDRETNNELYEVLNNSQ--LVPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSG 316
           ++Q  R +++  N    V+ NSQ  L    NL VGD++ L     IPAD +L++     G
Sbjct: 585 ELQFARLNKKKENRKIIVIRNSQELLTSIHNLLVGDIITLQTGDVIPADGVLVE-----G 639

Query: 317 ETFVKTDQLDGETD 330
           +  V    + GE+D
Sbjct: 640 QCEVDESSITGESD 653

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 47/111 (42%), Gaps = 4/111 (3%)

Query: 868 IACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVG--VGIVGKEGKQASLA 925
           +  R +P+ K  +   ++ M G  V   GDG ND   ++ ADVG  +GI G E  + +  
Sbjct: 51  VMARSSPEDKRLLVETLKGM-GDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASD 109

Query: 926 ADYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISS 976
                  F  +   + W GR       K  QF +   +   +   V SI+S
Sbjct: 110 IILMTDDFAAIVDAIKW-GRCVSISIKKFIQFQLIVNITAVILAFVSSIAS 159

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 40/80 (50%), Gaps = 11/80 (13%)

Query: 838  CLLIDGD-SLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCC-- 894
            C +I GD SLA       A    + + +  VIA    P+ KA+    IRE +G+ V    
Sbjct: 1038 CWMISGDNSLA-------ANAVALEVGIKHVIA-DVLPEGKAEKIQWIRETSGQGVAIAM 1089

Query: 895  IGDGGNDVSMIQCADVGVGI 914
            +GDG ND   I  ADVG+ +
Sbjct: 1090 VGDGMNDAPAIAAADVGISL 1109

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 22/40 (55%)

Query: 762  GVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCV 801
             V D+L+ + K  ++ L   G++ WM++GD    A  V +
Sbjct: 1015 AVRDELRPEAKEVVQALHERGIECWMISGDNSLAANAVAL 1054

>Scas_569.0d
          Length = 468

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 59/116 (50%), Gaps = 15/116 (12%)

Query: 864 LPVVIACRCTPQQKADV--ALLIREMTGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE 918
           LP+VIA RC+PQ K  +  AL  R+    + C + GDG ND   ++ A+VG+  GI G +
Sbjct: 101 LPLVIA-RCSPQTKVRMIEALHRRD----KFCAMTGDGVNDSPSLKMANVGIAMGINGSD 155

Query: 919 GKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSI 974
             + +     S   F  +   +   GR   + S  + +FV+   L  +V QA+Y I
Sbjct: 156 VAKDASDIVLSDDNFASILNAIE-EGR---RMSDNIQKFVLQL-LAENVAQALYLI 206

>Sklu_2437.5 YOL095C, Contig c2437 9395-11560
          Length = 721

 Score = 34.3 bits (77), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 30/70 (42%), Gaps = 8/70 (11%)

Query: 95  HSPSGVLTNQDTQPLISQDS-WDYGQVKRLRSGWLGPQSSWQRL----KSWVLPGAKAG- 148
           H   G L  Q+  PL+  DS W Y      R G +G  S+WQ+     K + L     G 
Sbjct: 644 HGRLGTLATQNALPLLHNDSFWQYYNKDLCRPGSVGAASNWQKYNLLQKKYGLASGVRGY 703

Query: 149 --APLLGVTA 156
              PLLG  A
Sbjct: 704 STVPLLGKVA 713

>Scas_716.37
          Length = 560

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 4/91 (4%)

Query: 479 NLDLGKSVYARQIES-DKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHL 537
           N D  ++   RQ+++ DK      V+T T PE   + +Y ++D T      D  LRK   
Sbjct: 244 NPDYNQAKLFRQLKNGDKPKYTCYVQTMT-PEQATKFKYSINDLTKIWPHKDFPLRK--F 300

Query: 538 GTVSYTMETMDMVTDYIQTLTSPANMGAAGV 568
           GT++ T    +   +  Q   SP+N    G+
Sbjct: 301 GTITLTENVENYFEEIEQVAFSPSNTCIPGI 331

>Scas_615.9
          Length = 942

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 738 NRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDK----V 793
           N D   ++  K ++  N  L+G   + D +++DV   I+ L+     I+M+TGD     +
Sbjct: 675 NSDNTSDDFTKSYVSINDTLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAM 734

Query: 794 ETARCVCVSAKLISRG 809
           + A+ V ++A  +  G
Sbjct: 735 KVAQQVGIAANNVYSG 750

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 8/88 (9%)

Query: 828 LEYLKANRNSCLLIDGDSLAIYMSHYRA-EFFEIVICLPVVIACRCTPQQKADVALLIRE 886
           + YL+ N     ++ GD+      H  A +  E+V   P  +    TP  K+     +RE
Sbjct: 773 IRYLRNNNYEVFMVTGDT------HKSAMKVAEMVDIPPNNVYSEVTPDGKSQTVEYLRE 826

Query: 887 MTGKRVCCIGDGGNDVSMIQCADVGVGI 914
             G+ +  IGDG ND   +  +D+G+ I
Sbjct: 827 -EGRVIAFIGDGINDSLALVTSDLGIAI 853

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 8/90 (8%)

Query: 765 DKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGA 824
           D+++ D K  I  LRN   +++M+TGD  ++A  V     +     Y          DG 
Sbjct: 763 DEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVYSE-----VTPDGK 817

Query: 825 LSRLEYLK-ANRNSCLLIDG--DSLAIYMS 851
              +EYL+   R    + DG  DSLA+  S
Sbjct: 818 SQTVEYLREEGRVIAFIGDGINDSLALVTS 847

>Scas_678.19
          Length = 298

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 1011 DESLTKTYPELYKELTEGRSLSYKTFFVWV--ILSLFQGAVIQGF 1053
            D  L KT  E+YKE   G+++S+ T F+ +  IL    G  ++G 
Sbjct: 43   DAKLKKTLAEMYKEENVGKTISFNTMFIEINKILGDVYGYELKGL 87

>Kwal_55.21575
          Length = 989

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/132 (15%), Positives = 61/132 (46%), Gaps = 20/132 (15%)

Query: 206 IVLYEQFKFFFNLYFLLVSLSQSIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRR 265
           ++L     F F+LY + +++++    +      + ++ + F+        ++  +   + 
Sbjct: 341 VLLSTLCSFAFSLYSIAMNVAKKSERMPNVIFDASVMLIGFI--------SVGKLLENKA 392

Query: 266 DRETNNELYEVLN------------NSQLVPSKNLRVGDLVKLHKDSRIPADMILLQSSE 313
             +TNN L ++++             ++ +P + L+VGD V++   ++IP D ++++   
Sbjct: 393 KSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEGES 452

Query: 314 PSGETFVKTDQL 325
              E+ +  + L
Sbjct: 453 EVDESLITGESL 464

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 35,683,919
Number of extensions: 1536532
Number of successful extensions: 4852
Number of sequences better than 10.0: 85
Number of HSP's gapped: 4779
Number of HSP's successfully gapped: 173
Length of query: 1145
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1032
Effective length of database: 12,684,275
Effective search space: 13090171800
Effective search space used: 13090171800
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)