Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL078C126954306e-56
CAGL0M12408g128953882e-49
YIL052C (RPL34B)121953872e-49
YER056C-A (RPL34A)121953863e-49
Scas_715.54*125953552e-44
Scas_704.33*124953552e-44
KLLA0C08371g125953473e-43
Kwal_23.579969391697e-17
Scas_20.1*59211017e-07
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL078C
         (124 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL078C [1663] [Homologous to ScYIL052C (RPL34B) - SH; ScYER056C...   170   6e-56
CAGL0M12408g join(1236607..1236643,1237307..1237656) highly simi...   154   2e-49
YIL052C (RPL34B) [2615] chr9 complement(256224..256552,257025..2...   153   2e-49
YER056C-A (RPL34A) [1486] chr5 complement(269421..269749,270147....   153   3e-49
Scas_715.54*                                                          141   2e-44
Scas_704.33*                                                          141   2e-44
KLLA0C08371g join(732878..732914,733482..733822) highly similar ...   138   3e-43
Kwal_23.5799                                                           70   7e-17
Scas_20.1*                                                             44   7e-07

>ADL078C [1663] [Homologous to ScYIL052C (RPL34B) - SH;
          ScYER056C-A (RPL34A) - SH]
          (548697..549040,549209..549245) [381 bp, 126 aa]
          Length = 126

 Score =  170 bits (430), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 83/95 (87%)

Query: 1  MAQRVTFRRRNPFXXXXXXXXXXXXPGGVLRAQHVKKLATRHKCGDCGIALDGISSLRPR 60
          MAQRVTFRRRNPF            PGGVLRAQHVKKLATRHKCGDCGIALDGISSLRPR
Sbjct: 1  MAQRVTFRRRNPFNTKTNKIKVVKTPGGVLRAQHVKKLATRHKCGDCGIALDGISSLRPR 60

Query: 61 QYASVSKTHKTVSRPYGGSRCANCVKQRIVRAFLI 95
          QYASVSKTHKTVSRPYGGSRCANCVKQRIVRAFLI
Sbjct: 61 QYASVSKTHKTVSRPYGGSRCANCVKQRIVRAFLI 95

>CAGL0M12408g join(1236607..1236643,1237307..1237656) highly
          similar to sp|P40525 Saccharomyces cerevisiae YIL052c
          RPL34B or sp|P87262 Saccharomyces cerevisiae YER056BC
          RPL34A
          Length = 128

 Score =  154 bits (388), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 74/95 (77%), Positives = 80/95 (84%)

Query: 1  MAQRVTFRRRNPFXXXXXXXXXXXXPGGVLRAQHVKKLATRHKCGDCGIALDGISSLRPR 60
          MAQRVTFRRRNP+            PGG+LRAQHVKKLATR KCGDCGIAL GI++LRPR
Sbjct: 1  MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGIALPGIATLRPR 60

Query: 61 QYASVSKTHKTVSRPYGGSRCANCVKQRIVRAFLI 95
          QYAS+SKTHKTVSR YGGSRCANCVK+RIVRAFLI
Sbjct: 61 QYASISKTHKTVSRVYGGSRCANCVKERIVRAFLI 95

>YIL052C (RPL34B) [2615] chr9
          complement(256224..256552,257025..257061) Ribosomal
          protein L34 (rat L34), nearly identical to Rpl34Ap [366
          bp, 121 aa]
          Length = 121

 Score =  153 bits (387), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 74/95 (77%), Positives = 79/95 (83%)

Query: 1  MAQRVTFRRRNPFXXXXXXXXXXXXPGGVLRAQHVKKLATRHKCGDCGIALDGISSLRPR 60
          MAQRVTFRRRNP+            PGG+LRAQHVKKLATR KCGDCG AL GIS+LRPR
Sbjct: 1  MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPR 60

Query: 61 QYASVSKTHKTVSRPYGGSRCANCVKQRIVRAFLI 95
          QYA+VSKTHKTVSR YGGSRCANCVK+RIVRAFLI
Sbjct: 61 QYATVSKTHKTVSRAYGGSRCANCVKERIVRAFLI 95

>YER056C-A (RPL34A) [1486] chr5
          complement(269421..269749,270147..270183) Ribosomal
          protein L34 (rat L34), nearly identical to Rpl34Bp [366
          bp, 121 aa]
          Length = 121

 Score =  153 bits (386), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 73/95 (76%), Positives = 79/95 (83%)

Query: 1  MAQRVTFRRRNPFXXXXXXXXXXXXPGGVLRAQHVKKLATRHKCGDCGIALDGISSLRPR 60
          MAQRVTFRRRNP+            PGG+LRAQHVKKLATR KCGDCG AL GIS+LRPR
Sbjct: 1  MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPR 60

Query: 61 QYASVSKTHKTVSRPYGGSRCANCVKQRIVRAFLI 95
          QYA+VSKTHKTVSR YGGSRCANCVK+RI+RAFLI
Sbjct: 61 QYATVSKTHKTVSRAYGGSRCANCVKERIIRAFLI 95

>Scas_715.54*
          Length = 125

 Score =  141 bits (355), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 68/95 (71%), Positives = 76/95 (80%)

Query: 1  MAQRVTFRRRNPFXXXXXXXXXXXXPGGVLRAQHVKKLATRHKCGDCGIALDGISSLRPR 60
          MAQRVTFRRRNP             PGG+LRAQHVKK A+R KCGDCGI L G+++LRPR
Sbjct: 1  MAQRVTFRRRNPCNTKSNKIKVVKTPGGILRAQHVKKQASRPKCGDCGIPLPGVAALRPR 60

Query: 61 QYASVSKTHKTVSRPYGGSRCANCVKQRIVRAFLI 95
          QYAS+SKT KTVSR YGGSRC+NCVK+RIVRAFLI
Sbjct: 61 QYASISKTSKTVSRVYGGSRCSNCVKERIVRAFLI 95

>Scas_704.33*
          Length = 124

 Score =  141 bits (355), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 68/95 (71%), Positives = 76/95 (80%)

Query: 1  MAQRVTFRRRNPFXXXXXXXXXXXXPGGVLRAQHVKKLATRHKCGDCGIALDGISSLRPR 60
          MAQRVTFRRRNP             PGG+LRAQHVKK A+R KCGDCGI L G+++LRPR
Sbjct: 1  MAQRVTFRRRNPCNTKSNKIKVVKTPGGILRAQHVKKQASRPKCGDCGIPLPGVAALRPR 60

Query: 61 QYASVSKTHKTVSRPYGGSRCANCVKQRIVRAFLI 95
          QYAS+SKT KTVSR YGGSRC+NCVK+RIVRAFLI
Sbjct: 61 QYASISKTSKTVSRVYGGSRCSNCVKERIVRAFLI 95

>KLLA0C08371g join(732878..732914,733482..733822) highly similar
          to sp|P40525 Saccharomyces cerevisiae YIL052c RPL34B
          ribosomal protein or sp|P87262 Saccharomyces cerevisiae
          YER056ca ribosomal protein, start by similarity
          Length = 125

 Score =  138 bits (347), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 74/95 (77%)

Query: 1  MAQRVTFRRRNPFXXXXXXXXXXXXPGGVLRAQHVKKLATRHKCGDCGIALDGISSLRPR 60
          MAQRVTFRRRNP+            PGG LR+QHVKKLATR KCGD G+ L G+S+LRPR
Sbjct: 1  MAQRVTFRRRNPYNTKSNKIKVVKTPGGALRSQHVKKLATRPKCGDTGVPLQGVSTLRPR 60

Query: 61 QYASVSKTHKTVSRPYGGSRCANCVKQRIVRAFLI 95
          QYA+VS+T KTVSR YGGS+ AN VK+RIVRAFLI
Sbjct: 61 QYATVSRTKKTVSRAYGGSKSANAVKERIVRAFLI 95

>Kwal_23.5799
          Length = 69

 Score = 69.7 bits (169), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (89%)

Query: 57 LRPRQYASVSKTHKTVSRPYGGSRCANCVKQRIVRAFLI 95
          +RPR+YA+VSKTHKTVSR YGG  CAN VK+RIVRAFLI
Sbjct: 1  MRPREYATVSKTHKTVSRAYGGVLCANAVKERIVRAFLI 39

>Scas_20.1*
          Length = 59

 Score = 43.5 bits (101), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%)

Query: 74 RPYGGSRCANCVKQRIVRAFL 94
          R YGGSRCANCVK+RIVRAFL
Sbjct: 39 RAYGGSRCANCVKERIVRAFL 59

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.138    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,199,785
Number of extensions: 58255
Number of successful extensions: 158
Number of sequences better than 10.0: 9
Number of HSP's gapped: 158
Number of HSP's successfully gapped: 9
Length of query: 124
Length of database: 16,596,109
Length adjustment: 89
Effective length of query: 35
Effective length of database: 13,515,107
Effective search space: 473028745
Effective search space used: 473028745
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 55 (25.8 bits)