Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL077C1421406542e-89
Kwal_23.58041411284711e-61
YIL051C (MMF1)1451354651e-60
Sklu_2193.31281264613e-60
KLLA0C08349g1401404521e-58
Scas_715.531281264492e-58
CAGL0M12386g1421404442e-57
Scas_704.341481304424e-57
YER057C (HMF1)1291044292e-55
Kwal_23.28071291071712e-16
Kwal_47.165901261051601e-14
Kwal_55.212471341011495e-13
KLLA0B14817g131981355e-11
KLLA0E03894g1371011331e-10
CAGL0M04521g688105993e-05
AGL164W68676983e-05
YLR143W68582959e-05
KLLA0D16984g69696800.009
YJL194W (CDC6)51351660.57
Kwal_47.1797249849622.1
CAGL0M04455g71195595.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL077C
         (140 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL077C [1664] [Homologous to ScYIL051C (MMF1) - SH; ScYER057C (...   256   2e-89
Kwal_23.5804                                                          186   1e-61
YIL051C (MMF1) [2616] chr9 complement(257842..258279) Protein im...   183   1e-60
Sklu_2193.3 YIL051C, Contig c2193 5846-6232 reverse complement        182   3e-60
KLLA0C08349g 731629..732051 highly similar to sp|P40185 Saccharo...   178   1e-58
Scas_715.53                                                           177   2e-58
CAGL0M12386g 1234993..1235421 similar to sp|P40037 Saccharomyces...   175   2e-57
Scas_704.34                                                           174   4e-57
YER057C (HMF1) [1487] chr5 complement(270735..271124) Protein th...   169   2e-55
Kwal_23.2807                                                           70   2e-16
Kwal_47.16590                                                          66   1e-14
Kwal_55.21247                                                          62   5e-13
KLLA0B14817g 1301705..1302100 similar to sp|Q8XCD0 Escherichia c...    57   5e-11
KLLA0E03894g complement(364475..364888) some similarities with s...    56   1e-10
CAGL0M04521g 496157..498223 similar to tr|Q12429 Saccharomyces c...    43   3e-05
AGL164W [4148] [Homologous to ScYLR143W - SH] complement(388842....    42   3e-05
YLR143W (YLR143W) [3552] chr12 (427330..429387) Protein containi...    41   9e-05
KLLA0D16984g 1439669..1441759 similar to sgd|S0004133 Saccharomy...    35   0.009
YJL194W (CDC6) [2731] chr10 (69337..70878) Protein that regulate...    30   0.57 
Kwal_47.17972                                                          28   2.1  
CAGL0M04455g complement(489048..491183) weakly similar to sp|P42...    27   5.3  

>ADL077C [1664] [Homologous to ScYIL051C (MMF1) - SH; ScYER057C
           (HMF1) - SH] (549526..549954) [429 bp, 142 aa]
          Length = 142

 Score =  256 bits (654), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 127/140 (90%), Positives = 127/140 (90%)

Query: 1   MRRLTQTATVLARSMSSLXXXXXXXXXXXXXSYSQAMRANGMVFVSGQIPYTPDNKPVEG 60
           MRRLTQTATVLARSMSSL             SYSQAMRANGMVFVSGQIPYTPDNKPVEG
Sbjct: 1   MRRLTQTATVLARSMSSLTPVRTTAAPPPAASYSQAMRANGMVFVSGQIPYTPDNKPVEG 60

Query: 61  SVADKTEQVIANVRNVLEASNSGLDRVAKVNVFLADMAYFAEFNSVYAKYFGEHKPARSC 120
           SVADKTEQVIANVRNVLEASNSGLDRVAKVNVFLADMAYFAEFNSVYAKYFGEHKPARSC
Sbjct: 61  SVADKTEQVIANVRNVLEASNSGLDRVAKVNVFLADMAYFAEFNSVYAKYFGEHKPARSC 120

Query: 121 VAVRALPLNVDLEMEVIALE 140
           VAVRALPLNVDLEMEVIALE
Sbjct: 121 VAVRALPLNVDLEMEVIALE 140

>Kwal_23.5804
          Length = 141

 Score =  186 bits (471), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 88/128 (68%), Positives = 102/128 (79%)

Query: 13  RSMSSLXXXXXXXXXXXXXSYSQAMRANGMVFVSGQIPYTPDNKPVEGSVADKTEQVIAN 72
           RSMS+L             SYSQAMR N MVFVSGQIPYT +NK VEG++ADK EQVI N
Sbjct: 12  RSMSTLTPVRTQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENKRVEGTIADKAEQVIQN 71

Query: 73  VRNVLEASNSGLDRVAKVNVFLADMAYFAEFNSVYAKYFGEHKPARSCVAVRALPLNVDL 132
           VRN+LE +NSGLD++ KVN+FLAD+  FAEFN VY KYF EHKPARSCVAV+ALPL+VDL
Sbjct: 72  VRNILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHKPARSCVAVKALPLDVDL 131

Query: 133 EMEVIALE 140
           EMEV+A+E
Sbjct: 132 EMEVVAVE 139

>YIL051C (MMF1) [2616] chr9 complement(257842..258279) Protein
           important for maintenance of mitochondrial DNA, may be
           involved in isoleucine-dependent transaminase activity,
           member of the p14.5 family [438 bp, 145 aa]
          Length = 145

 Score =  183 bits (465), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 103/135 (76%)

Query: 6   QTATVLARSMSSLXXXXXXXXXXXXXSYSQAMRANGMVFVSGQIPYTPDNKPVEGSVADK 65
           +TA VL R +++L             SYSQAM+AN  V+VSGQIPYTPDNKPV+GS+++K
Sbjct: 9   RTAPVLRRGITTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVQGSISEK 68

Query: 66  TEQVIANVRNVLEASNSGLDRVAKVNVFLADMAYFAEFNSVYAKYFGEHKPARSCVAVRA 125
            EQV  NV+N+L  SNS LD + KVNVFLADM  FAEFNSVYAK+F  HKPARSCV V +
Sbjct: 69  AEQVFQNVKNILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVAS 128

Query: 126 LPLNVDLEMEVIALE 140
           LPLNVDLEMEVIA+E
Sbjct: 129 LPLNVDLEMEVIAVE 143

>Sklu_2193.3 YIL051C, Contig c2193 5846-6232 reverse complement
          Length = 128

 Score =  182 bits (461), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 101/126 (80%)

Query: 15  MSSLXXXXXXXXXXXXXSYSQAMRANGMVFVSGQIPYTPDNKPVEGSVADKTEQVIANVR 74
           MS+L             SYSQA++ N MVFVSGQIPYT +NKPVEGS+ADK EQVI NV+
Sbjct: 1   MSTLTPVRTQLAPPPAASYSQAIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVK 60

Query: 75  NVLEASNSGLDRVAKVNVFLADMAYFAEFNSVYAKYFGEHKPARSCVAVRALPLNVDLEM 134
           N+LE +NS L+++ KVNVFLAD+  FAEFN VYAKYF EHKPARSCVAV++LPLNVDLEM
Sbjct: 61  NILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEM 120

Query: 135 EVIALE 140
           EVIA+E
Sbjct: 121 EVIAVE 126

>KLLA0C08349g 731629..732051 highly similar to sp|P40185
           Saccharomyces cerevisiae YIL051c MMD1 required for
           maintenance of mitochondrial DNA, start by similarity
          Length = 140

 Score =  178 bits (452), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 105/140 (75%), Gaps = 2/140 (1%)

Query: 1   MRRLTQTATVLARSMSSLXXXXXXXXXXXXXSYSQAMRANGMVFVSGQIPYTPDNKPVEG 60
           M R    +TV  R M++L             SYSQA++ N ++FVSGQIPYT +NKPVEG
Sbjct: 1   MFRQALKSTV--RRMNTLTPVKTQLAPPPAASYSQAIKVNNLIFVSGQIPYTAENKPVEG 58

Query: 61  SVADKTEQVIANVRNVLEASNSGLDRVAKVNVFLADMAYFAEFNSVYAKYFGEHKPARSC 120
           S+ADK EQVI NV+N+L  +NS LD++ KVN+FLAD+  FAEFNSVYAKYF  HKPARSC
Sbjct: 59  SIADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHKPARSC 118

Query: 121 VAVRALPLNVDLEMEVIALE 140
           VA +ALPLNVDLEMEVIA+E
Sbjct: 119 VAAKALPLNVDLEMEVIAVE 138

>Scas_715.53
          Length = 128

 Score =  177 bits (449), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 99/126 (78%)

Query: 15  MSSLXXXXXXXXXXXXXSYSQAMRANGMVFVSGQIPYTPDNKPVEGSVADKTEQVIANVR 74
           M++L             SYS AM+AN ++F+SGQIP T +NKPVEGS+ADK EQVI N++
Sbjct: 1   MTTLTPVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIK 60

Query: 75  NVLEASNSGLDRVAKVNVFLADMAYFAEFNSVYAKYFGEHKPARSCVAVRALPLNVDLEM 134
           NVLEASNS L+++ KVN+FLAD+  FAEFN+VYAKYF  HKPARSCVAV ALPLN DLEM
Sbjct: 61  NVLEASNSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEM 120

Query: 135 EVIALE 140
           EVIA+E
Sbjct: 121 EVIAVE 126

>CAGL0M12386g 1234993..1235421 similar to sp|P40037 Saccharomyces
           cerevisiae YER057c HIG1 Heat-shock induceable Inhibiter
           of cell Growth, hypothetical start
          Length = 142

 Score =  175 bits (444), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 85/140 (60%), Positives = 101/140 (72%)

Query: 1   MRRLTQTATVLARSMSSLXXXXXXXXXXXXXSYSQAMRANGMVFVSGQIPYTPDNKPVEG 60
           M  L   + ++ R +S L             SYS AM+ N +++VSGQIPYT DNKPVEG
Sbjct: 1   MFGLKARSLIMTRQLSKLTPVISANAPPAAASYSHAMKVNNLIYVSGQIPYTKDNKPVEG 60

Query: 61  SVADKTEQVIANVRNVLEASNSGLDRVAKVNVFLADMAYFAEFNSVYAKYFGEHKPARSC 120
           S++DK EQVI NV+N+L+ SNS L+R+ KVN+FLADM  FAEFN VYAKYF  HKPARSC
Sbjct: 61  SISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADMNNFAEFNKVYAKYFNVHKPARSC 120

Query: 121 VAVRALPLNVDLEMEVIALE 140
           VAV ALPL VDLEMEVIA E
Sbjct: 121 VAVAALPLGVDLEMEVIATE 140

>Scas_704.34
          Length = 148

 Score =  174 bits (442), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 79/130 (60%), Positives = 100/130 (76%)

Query: 11  LARSMSSLXXXXXXXXXXXXXSYSQAMRANGMVFVSGQIPYTPDNKPVEGSVADKTEQVI 70
           + RS+++L             SYSQAM+AN  V+VSGQIPYTP+NKPVEG+++DK EQV 
Sbjct: 14  IVRSLTTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPENKPVEGTISDKAEQVF 73

Query: 71  ANVRNVLEASNSGLDRVAKVNVFLADMAYFAEFNSVYAKYFGEHKPARSCVAVRALPLNV 130
            N++N+L+ S S +D++ KVNVFLAD+  F EFN VYAKYF  HKPARSCVAV+ LPLNV
Sbjct: 74  QNIKNILKESGSSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHKPARSCVAVKDLPLNV 133

Query: 131 DLEMEVIALE 140
           DLE+EVIA+E
Sbjct: 134 DLEVEVIAVE 143

>YER057C (HMF1) [1487] chr5 complement(270735..271124) Protein that
           inhibits cell growth and contributes to cell death at
           high temperature, member of the p14.5 family [390 bp,
           129 aa]
          Length = 129

 Score =  169 bits (429), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 89/104 (85%)

Query: 37  MRANGMVFVSGQIPYTPDNKPVEGSVADKTEQVIANVRNVLEASNSGLDRVAKVNVFLAD 96
           M+ N ++F+SGQIP TPDNK VEGS+ADK EQVI N++NVLEASNS LDRV KVN+FLAD
Sbjct: 24  MKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIKNVLEASNSSLDRVVKVNIFLAD 83

Query: 97  MAYFAEFNSVYAKYFGEHKPARSCVAVRALPLNVDLEMEVIALE 140
           + +FAEFNSVYAKYF  HKPARSCVAV ALPL VD+EME IA E
Sbjct: 84  INHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEMEAIAAE 127

>Kwal_23.2807
          Length = 129

 Score = 70.5 bits (171), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 64/107 (59%), Gaps = 9/107 (8%)

Query: 36  AMRANGMVFVSGQIPYTPDNKPVEGSVADKTEQVI----ANVRNVLEASNSGLDRVAKVN 91
           A ++N +VF SG +       PV G++ +  EQ I     N++NVL AS S L+RV KV 
Sbjct: 25  ASKSNDLVFTSGCV----GTDPVTGNLPEDLEQQIINALENLKNVLHASGSSLERVLKVL 80

Query: 92  VFLADMAYFAEFNSVYAKYFGEHKPARSCVAVRALPLNVDLEMEVIA 138
           +F++D +Y +  N VY++YF  + PARSC+ V      + +E+E IA
Sbjct: 81  LFVSDASYASTVNEVYSRYF-PNAPARSCIVVAFPAPALKVELECIA 126

>Kwal_47.16590
          Length = 126

 Score = 66.2 bits (160), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 51/105 (48%), Gaps = 1/105 (0%)

Query: 34  SQAMRANGMVFVSGQIPYTPDNKPVEGSVADKTEQVIANVRNVLEASNSGLDRVAKVNVF 93
           S    +NG VF SG I        V   + D+    I N+  VL A  S L +V KV +F
Sbjct: 20  SPGYVSNGHVFTSGIIGANYGTGEVPHEIEDQVHLAIKNLETVLVAGGSSLSKVFKVTMF 79

Query: 94  LADMAYFAEFNSVYAKYFGEHKPARSCVAVRALPLNVDLEMEVIA 138
           ++   Y    N +Y  YF  HKPARSCV V  +   +  E+E IA
Sbjct: 80  ISHADYSKVVNEIYGHYF-PHKPARSCVVVAFMDAAIKYELEAIA 123

>Kwal_55.21247
          Length = 134

 Score = 62.0 bits (149), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 57/101 (56%), Gaps = 9/101 (8%)

Query: 42  MVFVSGQIPYTPDNKPVEGSVADKTEQ----VIANVRNVLEASNSGLDRVAKVNVFLADM 97
           +VF SG +       PV G +    EQ     + N++NVL AS S L++V KV +F++D 
Sbjct: 30  LVFTSGCV----GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDG 85

Query: 98  AYFAEFNSVYAKYFGEHKPARSCVAVRALPLNVDLEMEVIA 138
           +Y    N VY++YF    PARSC+ V     ++ +E+E IA
Sbjct: 86  SYAPAVNKVYSEYF-PGAPARSCIVVSFPNASLKVELECIA 125

>KLLA0B14817g 1301705..1302100 similar to sp|Q8XCD0 Escherichia coli
           O157:H7 Orf, hypothetical protein, start by similarity
          Length = 131

 Score = 56.6 bits (135), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 54/98 (55%), Gaps = 10/98 (10%)

Query: 41  GMVFVSGQIPYTPDNKPVEGSVADKTEQVIANVRNVLEASNSGLDRVAKVNVFLADMAYF 100
           G   ++G+IP           +  +    + N+  VL+ASNS  D V K+ +F+AD +Y 
Sbjct: 39  GSDLLTGEIP---------EDLEKQVRNALDNLGRVLKASNSSFDDVLKILLFVADGSYA 89

Query: 101 AEFNSVYAKYFGEHKPARSCVAVRALPLNVDLEMEVIA 138
           +  N+VY +YF E +PARSC+ V      + +E+E +A
Sbjct: 90  STVNAVYKEYFPE-RPARSCIVVSFPDPTLKVELECVA 126

>KLLA0E03894g complement(364475..364888) some similarities with
           sp|Q87LF6 Vibrio parahaemolyticus Conserved hypothetical
           protein, hypothetical start
          Length = 137

 Score = 55.8 bits (133), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 57/101 (56%), Gaps = 3/101 (2%)

Query: 39  ANGMVFVSGQIPYTPDNKPVEGSVADKTEQVIANVRNVLEASNSGLDRVAKVNVFLADMA 98
            N ++F SG +   P    +   +  +    + N++ VLE S S +D V K+ +F++D +
Sbjct: 28  GNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGS 87

Query: 99  YFAEFNSVYAKYFGEHKPARSCVAVRALPLN-VDLEMEVIA 138
           Y    N V+ ++F  ++PARSC+ V A P N + +E+E IA
Sbjct: 88  YAGIVNKVFKEFF-PNQPARSCIVV-AFPNNKLKVELECIA 126

>CAGL0M04521g 496157..498223 similar to tr|Q12429 Saccharomyces
           cerevisiae YLR143w, hypothetical start
          Length = 688

 Score = 42.7 bits (99), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 51/105 (48%), Gaps = 10/105 (9%)

Query: 38  RANGMVFVSGQIPYTPDNKPVEGSVADKTEQVIANVRNVLEASNSGLDRVAKVNVFLADM 97
           R   ++++S   P   D     G+V ++ + V+  + N+L+ ++     V   ++ L DM
Sbjct: 318 RIGNLLYISNIQPQYKD-----GTVQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDM 372

Query: 98  AYFAEFNSVYAKYF-----GEHKPARSCVAVRALPLNVDLEMEVI 137
           + FA  N  Y+K+F     G   PAR+C+    +     L++ V+
Sbjct: 373 SLFASVNQEYSKFFDIWKNGPLPPARACIESNIINDGSALQLSVV 417

>AGL164W [4148] [Homologous to ScYLR143W - SH]
           complement(388842..390902) [2061 bp, 686 aa]
          Length = 686

 Score = 42.4 bits (98), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 12/76 (15%)

Query: 74  RNVLEASNSGLDR--VAKVNVF-----LADMAYFAEFNSVYAKYF-----GEHKPARSCV 121
           R+V +  N  L R  V K  V      LADM  FAE N+ Y  YF     G   P+R+C+
Sbjct: 334 RDVFDQLNESLTRHGVVKAQVLSSVLLLADMGTFAEINTAYNGYFSIQEIGPLPPSRACI 393

Query: 122 AVRALPLNVDLEMEVI 137
             ++L   + L++ V+
Sbjct: 394 ESKSLAPGIGLQLSVV 409

>YLR143W (YLR143W) [3552] chr12 (427330..429387) Protein containing
           an endoribonuclease L-PSP domain and a DUF71 domain of
           unknown function, has moderate similarity to
           uncharacterized C. albicans Orf6.3850p [2058 bp, 685 aa]
          Length = 685

 Score = 41.2 bits (95), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 16/82 (19%), Positives = 44/82 (53%), Gaps = 5/82 (6%)

Query: 61  SVADKTEQVIANVRNVLEASNSGLDRVAKVNVFLADMAYFAEFNSVYAKY-----FGEHK 115
           +V  ++E +   + ++L ++    + +   ++ + DM+ F + N +Y ++     +G   
Sbjct: 334 TVEKQSEDIFTELADILHSNQIPRNHILSASLLIRDMSNFGKINKIYNEFLDLSKYGPLP 393

Query: 116 PARSCVAVRALPLNVDLEMEVI 137
           P+R+CV  + LP +  +++ V+
Sbjct: 394 PSRACVGSKCLPEDCHVQLSVV 415

>KLLA0D16984g 1439669..1441759 similar to sgd|S0004133 Saccharomyces
           cerevisiae YLR143w, start by similarity
          Length = 696

 Score = 35.4 bits (80), Expect = 0.009,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 6/96 (6%)

Query: 47  GQIPYTPDNKPVEG-SVADKTEQVIANVRNVLEASNSGLDRVAKVNVFLADMAYFAEFNS 105
           G++ Y  +  P +G S+ +K   V + + ++L + +    ++   ++ L+DM  F E NS
Sbjct: 322 GKLLYISNIAPSKGESLKEKCLDVFSQLTSILSSRSIFACQILSSSLLLSDMNNFQEVNS 381

Query: 106 VYAKYF-----GEHKPARSCVAVRALPLNVDLEMEV 136
            Y +YF     G   PAR+CV    L   V L + V
Sbjct: 382 YYNEYFNVTKIGPLPPARACVESSFLKHPVQLSVVV 417

>YJL194W (CDC6) [2731] chr10 (69337..70878) Protein that regulates
           initiation of DNA replication, binds to origins of
           replication at the end of mitosis, directing the
           assembly and disassembly of MCM proteins and the
           pre-replication complex, member of the AAA+ family of
           ATPases [1542 bp, 513 aa]
          Length = 513

 Score = 30.0 bits (66), Expect = 0.57,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 4/51 (7%)

Query: 46  SGQIPYTPDNKPVEGSVADKTEQV----IANVRNVLEASNSGLDRVAKVNV 92
           S Q+P TP   PV+ S  +   ++    IA V +    +NS   R+AK+N+
Sbjct: 362 SAQVPLTPTTSPVKKSYPEPQGKIGLNYIAKVFSKFVNNNSTRTRIAKLNI 412

>Kwal_47.17972
          Length = 498

 Score = 28.5 bits (62), Expect = 2.1,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 4/49 (8%)

Query: 38  RANGMVFVSGQIPYTPDNK----PVEGSVADKTEQVIANVRNVLEASNS 82
           + NG+ +  GQ  +  +N     PVEG     TE++    +N++ A+ S
Sbjct: 129 KKNGVTYYKGQGAFEDENNIKVSPVEGIEGSVTEEITLEAKNIIVATGS 177

>CAGL0M04455g complement(489048..491183) weakly similar to sp|P42900
           Saccharomyces cerevisiae YLR139c SLS1 suppresses
           lethality of SSM4 deletion, hypothetical start
          Length = 711

 Score = 27.3 bits (59), Expect = 5.3,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 18/95 (18%)

Query: 57  PVEGSVADKTEQVIANVRNVLEASNSG----LDRVAKVNVFLADMAYFAEFNSVYAKYFG 112
           PV+G+   +   +   +  +L+A NS     L R+  ++ FL D+ YF E +       G
Sbjct: 453 PVKGT---RQHVISVTMGQLLKAGNSMIRTFLPRIPTISNFLMDLPYFEETHEGDLSVLG 509

Query: 113 EH---------KPARSCV--AVRALPLNVDLEMEV 136
           E+         KP  S +   +++ P N++L  E+
Sbjct: 510 ENDDYYVQLKFKPDLSSIPPGIKSYPPNMELWFEL 544

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.129    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,387,610
Number of extensions: 110843
Number of successful extensions: 309
Number of sequences better than 10.0: 23
Number of HSP's gapped: 305
Number of HSP's successfully gapped: 23
Length of query: 140
Length of database: 16,596,109
Length adjustment: 91
Effective length of query: 49
Effective length of database: 13,445,871
Effective search space: 658847679
Effective search space used: 658847679
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)