Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL076W1131113626e-46
CAGL0J02926g127972013e-21
Sklu_2193.41021011941e-20
YER058W (PET117)1071021907e-20
Scas_715.52107991908e-20
Kwal_23.5805102951872e-19
KLLA0C08327g1031001811e-18
YLR454W262830592.8
Kwal_0.32233232583.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL076W
         (111 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL076W [1665] [Homologous to ScYER058W (PET117) - SH] complemen...   144   6e-46
CAGL0J02926g 281301..281684 similar to sp|Q02771 Saccharomyces c...    82   3e-21
Sklu_2193.4 YER058W, Contig c2193 6568-6876                            79   1e-20
YER058W (PET117) [1488] chr5 (271766..272089) Protein involved i...    78   7e-20
Scas_715.52                                                            78   8e-20
Kwal_23.5805                                                           77   2e-19
KLLA0C08327g complement(730884..731195) similar to sp|Q02771 Sac...    74   1e-18
YLR454W (YLR454W) [3828] chr12 (1043995..1051881) Protein of unk...    27   2.8  
Kwal_0.322                                                             27   3.5  

>ADL076W [1665] [Homologous to ScYER058W (PET117) - SH]
           complement(550058..550399) [342 bp, 113 aa]
          Length = 113

 Score =  144 bits (362), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 76/111 (68%)

Query: 1   MLSQTVRAKHTTPMSRASKIXXXXXXXXXXXXXXXXXXXQEMERDALKQGPIKDALRTXX 60
           MLSQTVRAKHTTPMSRASKI                   QEMERDALKQGPIKDALRT  
Sbjct: 1   MLSQTVRAKHTTPMSRASKITLALCTAASAATVVTVHLVQEMERDALKQGPIKDALRTAE 60

Query: 61  XXXXXXXXXXXXXXKMLNASEHELQLELRRKYAAMQPLSGEVVTQDGDVVE 111
                         KMLNASEHELQLELRRKYAAMQPLSGEVVTQDGDVVE
Sbjct: 61  KRAERDADPEAARKKMLNASEHELQLELRRKYAAMQPLSGEVVTQDGDVVE 111

>CAGL0J02926g 281301..281684 similar to sp|Q02771 Saccharomyces
           cerevisiae YER058w PET117, start by similarity
          Length = 127

 Score = 82.0 bits (201), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 54/97 (55%), Gaps = 2/97 (2%)

Query: 14  MSRASKIXXXXXXXXXXXXXXXXXXXQEMERDALKQGPIKDALRTXXXXXXXXXXXXXXX 73
           MSRASKI                   QE+ER+ L QGPIKDA R                
Sbjct: 32  MSRASKITFGVSCAVTLATIIGVHYVQELERETLHQGPIKDAKRVAEKKKLMPAGTDEK- 90

Query: 74  XKMLNASEHELQLELRRKYAAMQPLSGEVVTQDGDVV 110
            K+LN SEHELQ ELR+KY +MQPLSGEVVTQDG+ V
Sbjct: 91  -KLLNRSEHELQQELRKKYESMQPLSGEVVTQDGERV 126

>Sklu_2193.4 YER058W, Contig c2193 6568-6876
          Length = 102

 Score = 79.3 bits (194), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 46/101 (45%), Positives = 54/101 (53%), Gaps = 3/101 (2%)

Query: 14  MSRASKIXXXXXXXXXXXXXXXXXXXQEMERDALKQGPIKDALRTXXXXXXXXXXX---X 70
           MSRASKI                   Q+MER  L QGPIKDA R                
Sbjct: 1   MSRASKITLALSCLLTTTTVIGVHIVQDMERQTLHQGPIKDAKRVAEKKLAKEEQNQDPS 60

Query: 71  XXXXKMLNASEHELQLELRRKYAAMQPLSGEVVTQDGDVVE 111
               K++N  EHELQ ELR+KY AMQPLSGEV+T+DG+VV+
Sbjct: 61  KQRMKLVNKGEHELQQELRKKYEAMQPLSGEVLTKDGEVVK 101

>YER058W (PET117) [1488] chr5 (271766..272089) Protein involved in
           assembly of cytochrome oxidase [324 bp, 107 aa]
          Length = 107

 Score = 77.8 bits (190), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 51/102 (50%), Gaps = 5/102 (4%)

Query: 14  MSRASKIXXXXXXXXXXXXXXXXXXXQEMERDALKQGPIKDALRTXXXXXXXXXXX---- 69
           MSRASKI                   QEMER+ L QGPIKDA R                
Sbjct: 1   MSRASKITFAASCLITAATVVGVHYVQEMERETLHQGPIKDAKRVEEKRLRKTNGVASLD 60

Query: 70  -XXXXXKMLNASEHELQLELRRKYAAMQPLSGEVVTQDGDVV 110
                 +  N SEHE Q ELR+KY  MQPLSGEVVT+DG+VV
Sbjct: 61  PTKERKRYFNMSEHEEQKELRKKYETMQPLSGEVVTKDGEVV 102

>Scas_715.52
          Length = 107

 Score = 77.8 bits (190), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 51/99 (51%), Gaps = 2/99 (2%)

Query: 14  MSRASKIXXXXXXXXXXXXXXXXXXXQEMERDALKQGPIKDALRTXXXXXXXXXXXXXXX 73
           MSRASKI                   Q MERD L QGPIKDA R                
Sbjct: 1   MSRASKITFALTCVFTITTTVGVHYVQGMERDTLHQGPIKDAKRVAEKKRLKESGLDPAK 60

Query: 74  XK--MLNASEHELQLELRRKYAAMQPLSGEVVTQDGDVV 110
            K  M N SEHELQ EL+++Y   QPLSGEVVT+DG+VV
Sbjct: 61  EKKRMFNQSEHELQKELKKQYEQQQPLSGEVVTKDGEVV 99

>Kwal_23.5805
          Length = 102

 Score = 76.6 bits (187), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 50/95 (52%), Gaps = 4/95 (4%)

Query: 14  MSRASKIXXXXXXXXXXXXXXXXXXXQEMERDALKQGPIKDALRTXXXXXXXXXXXXXXX 73
           MS ASKI                   QE+ERD L QGPIKDA R                
Sbjct: 1   MSTASKITLALSCVLTTATVIGVHYVQELERDTLHQGPIKDAKRIADRKAEMENERK--- 57

Query: 74  XKMLNASEHELQLELRRKYAAMQPLSGEVVTQDGD 108
            K  N SEHELQ ELRRKY A+QPLSGEV+T+DG+
Sbjct: 58  -KRFNESEHELQQELRRKYEALQPLSGEVLTKDGE 91

>KLLA0C08327g complement(730884..731195) similar to sp|Q02771
           Saccharomyces cerevisiae YER058w PET117 cytochrome c
           oxidase assembly factor singleton, start by similarity
          Length = 103

 Score = 74.3 bits (181), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 52/100 (52%), Gaps = 2/100 (2%)

Query: 14  MSRASKIXXXXXXXXXXXXXXXXXXXQEMERDALKQGPIKDALRTXXXXXXXXXXX--XX 71
           MSRASKI                   QE+ER  L QGPIKDA R                
Sbjct: 1   MSRASKITLGLTTLFTATIVVGVHHVQELERQTLHQGPIKDAQRVAEKKLARQNGVDPEK 60

Query: 72  XXXKMLNASEHELQLELRRKYAAMQPLSGEVVTQDGDVVE 111
              +M+N +EHE QLELR+KY  MQPLSGEV T+D +++E
Sbjct: 61  ERQRMVNKNEHEYQLELRKKYEQMQPLSGEVRTKDNELIE 100

>YLR454W (YLR454W) [3828] chr12 (1043995..1051881) Protein of unknown
            function, has low similarity to uncharacterized C.
            albicans Orf6.6103p [7887 bp, 2628 aa]
          Length = 2628

 Score = 27.3 bits (59), Expect = 2.8,   Method: Composition-based stats.
 Identities = 11/30 (36%), Positives = 21/30 (70%)

Query: 80   SEHELQLELRRKYAAMQPLSGEVVTQDGDV 109
            +E++  L +RR+   ++ L+G+VV QD D+
Sbjct: 1737 TEYQAGLNVRRRVMKLKFLAGDVVCQDVDI 1766

>Kwal_0.322
          Length = 332

 Score = 26.9 bits (58), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 20/32 (62%)

Query: 75  KMLNASEHELQLELRRKYAAMQPLSGEVVTQD 106
           K+LN S  ++ +E R ++ A+ P SGEV   D
Sbjct: 245 KLLNDSLDDIGVENRLRFRAVYPNSGEVYHGD 276

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.125    0.325 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 1,930,065
Number of extensions: 35782
Number of successful extensions: 44
Number of sequences better than 10.0: 9
Number of HSP's gapped: 36
Number of HSP's successfully gapped: 9
Length of query: 111
Length of database: 16,596,109
Length adjustment: 81
Effective length of query: 30
Effective length of database: 13,792,051
Effective search space: 413761530
Effective search space used: 413761530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 54 (25.4 bits)