Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL075W20720310861e-153
Kwal_23.58074651936936e-90
KLLA0C08305g4092056801e-88
Scas_704.354482036752e-87
CAGL0M12342g4572086667e-86
YIL050W (PCL7)2851955659e-73
Scas_715.513412065012e-62
YER059W (PCL6)4202574941e-60
KLLA0D01287g3451161731e-14
Scas_392.13031621677e-14
CAGL0E02541g3421581677e-14
Sklu_2373.43071491614e-13
ACR001C3461371615e-13
Kwal_56.224432801491589e-13
YOL001W (PHO80)2931101527e-12
YGL134W (PCL10)4331201458e-11
Scas_720.474731131281e-08
CAGL0E05918g4811611174e-07
Scas_706.34511171174e-07
CAGL0H08998g5471241159e-07
YPL219W (PCL8)4921241141e-06
KLLA0B02024g5271251122e-06
Kwal_56.241514801181103e-06
AFL115W3861061006e-05
CAGL0E02233g266115962e-04
YNL289W (PCL1)279161943e-04
KLLA0B05885g658116740.13
Kwal_47.19087405149710.34
KLLA0F05654g311115700.34
ABL200W789116710.37
AFR547W900107710.37
Kwal_34.1599623161690.39
Kwal_23.611789799661.5
Scas_598.1429491651.5
YJL109C (UTP10)1769147652.2
Kwal_23.5231256148623.1
YHR071W (PCL5)22994597.7
AEL195W23762597.9
Scas_647.14371126598.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL075W
         (203 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL075W [1666] [Homologous to ScYIL050W (PCL7) - SH; ScYER059W (...   422   e-153
Kwal_23.5807                                                          271   6e-90
KLLA0C08305g complement(728996..730225) some similarities with s...   266   1e-88
Scas_704.35                                                           264   2e-87
CAGL0M12342g complement(1232642..1234015) weakly similar to sp|P...   261   7e-86
YIL050W (PCL7) [2617] chr9 (258912..259769) Cyclin, associates w...   222   9e-73
Scas_715.51                                                           197   2e-62
YER059W (PCL6) [1489] chr5 (272622..273884) Cyclin that associat...   194   1e-60
KLLA0D01287g 112866..113903 some similarities with sp|P20052 Sac...    71   1e-14
Scas_392.1                                                             69   7e-14
CAGL0E02541g 244577..245605 similar to sp|P20052 Saccharomyces c...    69   7e-14
Sklu_2373.4 YOL001W, Contig c2373 11960-12883                          67   4e-13
ACR001C [1049] [Homologous to ScYOL001W (PHO80) - SH] (357962..3...    67   5e-13
Kwal_56.22443                                                          65   9e-13
YOL001W (PHO80) [4815] chr15 (325249..326130) Cyclin that intera...    63   7e-12
YGL134W (PCL10) [1853] chr7 (255666..256967) Cyclin that associa...    60   8e-11
Scas_720.47                                                            54   1e-08
CAGL0E05918g complement(585723..587168) some similarities with t...    50   4e-07
Scas_706.3                                                             50   4e-07
CAGL0H08998g 877952..879595 weakly similar to tr|Q08966 Saccharo...    49   9e-07
YPL219W (PCL8) [5230] chr16 (136749..138227) Cyclin that associa...    49   1e-06
KLLA0B02024g 176585..178168 some similarities with sp|P53124 Sac...    48   2e-06
Kwal_56.24151                                                          47   3e-06
AFL115W [3080] [Homologous to ScYPL219W (PCL8) - SH; ScYGL134W (...    43   6e-05
CAGL0E02233g 215697..216497 similar to sp|P24867 Saccharomyces c...    42   2e-04
YNL289W (PCL1) [4322] chr14 (87895..88734) G1/S-specific cyclin ...    41   3e-04
KLLA0B05885g complement(530762..532738) no similarity, hypotheti...    33   0.13 
Kwal_47.19087                                                          32   0.34 
KLLA0F05654g 552056..552991 some similarities with sgd|S0002338 ...    32   0.34 
ABL200W [392] [Homologous to ScYNL233W (BNI4) - SH] complement(3...    32   0.37 
AFR547W [3739] [Homologous to ScYPR160W (GPH1) - SH] complement(...    32   0.37 
Kwal_34.15996                                                          31   0.39 
Kwal_23.6117                                                           30   1.5  
Scas_598.14                                                            30   1.5  
YJL109C (UTP10) [2806] chr10 complement(211917..217226) Componen...    30   2.2  
Kwal_23.5231                                                           28   3.1  
YHR071W (PCL5) [2359] chr8 (237005..237694) Cyclin that associat...    27   7.7  
AEL195W [2311] [Homologous to ScYNL289W (PCL1) - SH] complement(...    27   7.9  
Scas_647.14                                                            27   8.7  

>ADL075W [1666] [Homologous to ScYIL050W (PCL7) - SH; ScYER059W
           (PCL6) - SH] complement(550944..551567) [624 bp, 207 aa]
          Length = 207

 Score =  422 bits (1086), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 203/203 (100%), Positives = 203/203 (100%)

Query: 1   MHCSQPEGVDQRIGHMDIAQFPTDKLLEMLTGLLYKIIKSNDRLKPFDQEKHDINNKYVA 60
           MHCSQPEGVDQRIGHMDIAQFPTDKLLEMLTGLLYKIIKSNDRLKPFDQEKHDINNKYVA
Sbjct: 1   MHCSQPEGVDQRIGHMDIAQFPTDKLLEMLTGLLYKIIKSNDRLKPFDQEKHDINNKYVA 60

Query: 61  HVLSFRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSY 120
           HVLSFRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSY
Sbjct: 61  HVLSFRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSY 120

Query: 121 NIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELIVSIQEL 180
           NIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELIVSIQEL
Sbjct: 121 NIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELIVSIQEL 180

Query: 181 QRYADLLYKFWHREHLAKASTNA 203
           QRYADLLYKFWHREHLAKASTNA
Sbjct: 181 QRYADLLYKFWHREHLAKASTNA 203

>Kwal_23.5807
          Length = 465

 Score =  271 bits (693), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 153/193 (79%), Gaps = 14/193 (7%)

Query: 16  MDIAQFPTDKLLEMLTGLLYKIIKSNDRL---KPFDQEK-----------HDINNKYVAH 61
           + IA FPTD+LL MLT LL KI+KSND+L   +PFD+++           +D      + 
Sbjct: 261 IQIATFPTDRLLSMLTALLDKIVKSNDQLNRDRPFDEDQFLASARTEDADNDTRPNIASE 320

Query: 62  VLSFRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYN 121
           +LSFRGKH+P ITL  YF RIQKYCP TNDVFLSLLVYFDRIAK CN    QLFVMDSYN
Sbjct: 321 ILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMDSYN 380

Query: 122 IHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELIVSIQELQ 181
           IHRLII+AVTVSTKFFSDFFYSNSRYARVGGISL+ELN LELQF +LCDFELI+S++ELQ
Sbjct: 381 IHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELIISVEELQ 440

Query: 182 RYADLLYKFWHRE 194
           +Y+DLL  FW+RE
Sbjct: 441 KYSDLLRDFWNRE 453

>KLLA0C08305g complement(728996..730225) some similarities with
           sp|P40038 Saccharomyces cerevisiae YER059w PCL6 cyclin
           like protein interacting with PHO85P, hypothetical start
          Length = 409

 Score =  266 bits (680), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 135/205 (65%), Positives = 150/205 (73%), Gaps = 25/205 (12%)

Query: 15  HMDIAQFPTDKLLEMLTGLLYKIIKSNDRL--KPFDQEKHDINNKYVAHVLSFRGKHIPT 72
           HMDIA FPT KLL+MLTGLL KIIKSND L   P  +     N   +  +LSFRGK +P 
Sbjct: 188 HMDIATFPTYKLLDMLTGLLTKIIKSNDSLGSTPNFETSQGKNIPLMREILSFRGKQVPG 247

Query: 73  ITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNAL---------------------- 110
           ITL  YF RIQKYCP TNDV LSLLV+FDRIAK+CNA+                      
Sbjct: 248 ITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDKTTASLAHQ 307

Query: 111 -DPQLFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILC 169
             PQLFVMDS+NIHRLIIAA+TVSTKF SDFFYSNSRYARVGGISL+ELN LELQF ILC
Sbjct: 308 SSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILC 367

Query: 170 DFELIVSIQELQRYADLLYKFWHRE 194
           DF LI+S++ELQRYADLLYKFW +E
Sbjct: 368 DFRLIISVEELQRYADLLYKFWDKE 392

>Scas_704.35
          Length = 448

 Score =  264 bits (675), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 129/203 (63%), Positives = 149/203 (73%), Gaps = 20/203 (9%)

Query: 16  MDIAQFPTDKLLEMLTGLLYKIIKSNDRLKPFDQEKHDI----------NNKYVAHVLSF 65
           ++IA+FPT+KLLEMLT LL KI+KSND+L         I          NN YV  +L+F
Sbjct: 224 INIAEFPTNKLLEMLTALLDKIVKSNDKLNVSSSNSESIDDILRSEDNSNNAYVGSILAF 283

Query: 66  RGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCN----------ALDPQLF 115
           RGKH+P I+L  YF RIQKYCP TNDVFLSLLVYFDRI+KRCN              QLF
Sbjct: 284 RGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQLF 343

Query: 116 VMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELIV 175
           VMDSYNIHRLIIA VTV TKFFSDFFYSNSRYARVGG+SL+ELN LELQF +LCDFEL++
Sbjct: 344 VMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELMI 403

Query: 176 SIQELQRYADLLYKFWHREHLAK 198
             +ELQRYADLL +FW  + L +
Sbjct: 404 PTEELQRYADLLSRFWSTQPLPE 426

>CAGL0M12342g complement(1232642..1234015) weakly similar to
           sp|P40038 Saccharomyces cerevisiae YER059w PCL6 cyclin
           like protein interacting with PHO85P, hypothetical start
          Length = 457

 Score =  261 bits (666), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 128/208 (61%), Positives = 153/208 (73%), Gaps = 29/208 (13%)

Query: 16  MDIAQFPTDKLLEMLTGLLYKIIKSNDRLKPFDQE--------------------KHDIN 55
           ++IA+FPTDKLLEMLT LL KIIKSND+++P+  +                    K    
Sbjct: 236 LNIAEFPTDKLLEMLTALLNKIIKSNDQMEPYKDKDKDEDHDDDESLTDSKLMSVKGTDK 295

Query: 56  NKYVAHVLSFRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDP--- 112
            KY+  +LSF+GKH+P ITL  YF RIQKYCP TNDVFLSLLVYFDRI+K+CN+ D    
Sbjct: 296 EKYLKSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESA 355

Query: 113 ------QLFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFS 166
                 QLFVMDSYNIHRL+IA VTV TKFFSDFFYSNSRYARVGGISL ELN LELQF 
Sbjct: 356 DTSPADQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFL 415

Query: 167 ILCDFELIVSIQELQRYADLLYKFWHRE 194
           +LCDFEL++S+ +LQRYA+LL +FW+ +
Sbjct: 416 VLCDFELLISVDKLQRYANLLLRFWNNQ 443

>YIL050W (PCL7) [2617] chr9 (258912..259769) Cyclin, associates with
           the Pho85p cyclin-dependent kinase, involved in
           utilization of alternate carbon sources [858 bp, 285 aa]
          Length = 285

 Score =  222 bits (565), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 143/195 (73%), Gaps = 9/195 (4%)

Query: 7   EGVDQRIGHMDIAQFPTDKLLEMLTGLLYKIIKSNDRLKPFDQEKHD-INNKYVAHVLSF 65
           E  D +I  ++IA FPTD+L+ M++ LL +II +ND      Q+  D   ++ +  +L+F
Sbjct: 93  EQTDVKI--LNIADFPTDELILMISALLNRIITANDETTDVSQQVSDETEDELLTPILAF 150

Query: 66  RGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRC------NALDPQLFVMDS 119
            GK++P I +  Y  RIQKYCP TND+FLSLLVYFDRI+K        N    QLFVMDS
Sbjct: 151 YGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDS 210

Query: 120 YNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELIVSIQE 179
            NIHRL+I  VT+ TKF SDFFYSNSRYA+VGGISL+ELN LELQF ILCDF+L+VS++E
Sbjct: 211 GNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLLVSVEE 270

Query: 180 LQRYADLLYKFWHRE 194
           +Q+YA+LLYKFW+ +
Sbjct: 271 MQKYANLLYKFWNDQ 285

>Scas_715.51
          Length = 341

 Score =  197 bits (501), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 142/206 (68%), Gaps = 30/206 (14%)

Query: 16  MDIAQFPTDKLLEMLTGLLYKIIKSNDRLKPFDQ----EKHDINN----KYVAHVLSFRG 67
           +DI +  T KL++M++ +L K+IKSND L+  ++    ++ D +N    K V  + SFRG
Sbjct: 127 IDITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRG 186

Query: 68  KHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAK-----RCNALDPQL-------- 114
           KHIP I L  YF RIQKYCP  N V L++L+YFDRI+K     + N  DP +        
Sbjct: 187 KHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLR 246

Query: 115 ---------FVMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQF 165
                    F++DSYNIHRLII+A+TVSTKF+SDFFYSNSRYA+VGGISL+E+N LELQF
Sbjct: 247 NYDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQF 306

Query: 166 SILCDFELIVSIQELQRYADLLYKFW 191
            ++ +F+LI+S +E+QRY+ LL KF+
Sbjct: 307 LLISNFDLIISSEEIQRYSGLLSKFY 332

>YER059W (PCL6) [1489] chr5 (272622..273884) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           utilization of alternative carbon and nitrogen sources
           [1263 bp, 420 aa]
          Length = 420

 Score =  194 bits (494), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 119/257 (46%), Positives = 144/257 (56%), Gaps = 72/257 (28%)

Query: 16  MDIAQFPTDKLLEMLTGLLYKIIKSNDRLKPFDQE-KHDINN-----------KYVAHVL 63
           ++IA+FPTDKLL+MLT LL KIIKSNDR    +     +I N           KY++ VL
Sbjct: 162 LNIAEFPTDKLLKMLTALLTKIIKSNDRTAATNPSLTQEIENGRCLALSDNEKKYLSPVL 221

Query: 64  SFRGKHIPTITLGDYFAR---------------------IQKYC------PITNDV---- 92
            FRGKH+P I L  YF R                     I K C      P TN      
Sbjct: 222 GFRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSVTTTPKTNTAKHES 281

Query: 93  --FLSLLVYFDRIAKRCNALD------------------------PQLFVMDSYNIHRLI 126
               S L   +R A + +A +                        PQ+FVMDS+NIHRLI
Sbjct: 282 PSNESSLDKANRGADKMSACNSNENNENDDSDDENTGVQRDSRAHPQMFVMDSHNIHRLI 341

Query: 127 IAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELIVSIQELQRYADL 186
           IA +TVSTKF SDFFYSNSRY+RVGGISL+ELN LELQF +LCDFEL++S+ ELQRYADL
Sbjct: 342 IAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELLISVNELQRYADL 401

Query: 187 LYKFWHREHLAKASTNA 203
           LY+FW+    AKA + A
Sbjct: 402 LYRFWNN---AKAQSQA 415

>KLLA0D01287g 112866..113903 some similarities with sp|P20052
           Saccharomyces cerevisiae YOL001w PHO80 cyclin,
           hypothetical start
          Length = 345

 Score = 71.2 bits (173), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 65/116 (56%), Gaps = 7/116 (6%)

Query: 52  HDINN--KYVAHVLSFRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNA 109
           +D NN       +  F  K  P+IT+  Y  R+ KY  + + V LS + Y D ++    A
Sbjct: 48  NDANNAGNQTMELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLS----A 103

Query: 110 LDPQLFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQF 165
           + P+ F ++S  +HR ++ A T+++K   D F +N+ Y++VGG+   ELN LE +F
Sbjct: 104 VYPE-FTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEF 158

>Scas_392.1
          Length = 303

 Score = 68.9 bits (167), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 86/162 (53%), Gaps = 14/162 (8%)

Query: 26  LLEMLTGLLYKIIKSNDRLKPFDQEKHDINNKYVAHVLSFRGKHIPTITLGDYFARIQKY 85
           L+ +++ +L  +I+SND          + ++    H+  F  +  P I++ +Y  R+ KY
Sbjct: 65  LVVLVSRMLVLLIQSND----MTSNTSNSSSDSNMHLTRFHSRIPPNISIFNYLFRLTKY 120

Query: 86  CPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNS 145
           C + + V LS++ Y D       A  P  F  +S   HR ++ A+TV+ K   D F + +
Sbjct: 121 CYVEHCVLLSIIYYIDLFT----AAYPT-FTFNSLTAHRFLLTAITVAGKGLCDSFCTTA 175

Query: 146 RYARVGGISLEELNRLELQFSILCDFELI-----VSIQELQR 182
           +YA++GG+  EELN LE  F  + ++ +I     V++ +L+R
Sbjct: 176 QYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLER 217

>CAGL0E02541g 244577..245605 similar to sp|P20052 Saccharomyces
           cerevisiae YOL001w PHO80 cyclin, start by similarity
          Length = 342

 Score = 68.9 bits (167), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 80/158 (50%), Gaps = 13/158 (8%)

Query: 17  DIAQFPTDKLLEMLTGLLYKIIKSNDRLKPFDQEKHDINNKYVAHVLSFRGKHIPTITLG 76
           D  + P   L+ ++  +L  II+ ND     ++ K+ +          F  K  P I++ 
Sbjct: 22  DFLKCPKGDLVILIARMLQFIIQINDSNIKENERKYGL--------TRFHSKIAPNISVF 73

Query: 77  DYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHRLIIAAVTVSTKF 136
           +YF R+ KY  + + V LS + Y D ++    A     F ++S   HR ++ A T+++K 
Sbjct: 74  NYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPA-----FNLNSLTAHRFLLTATTIASKG 128

Query: 137 FSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELI 174
             D F +N+ Y++VGG+   ELN LE +F    ++ +I
Sbjct: 129 LCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166

>Sklu_2373.4 YOL001W, Contig c2373 11960-12883
          Length = 307

 Score = 66.6 bits (161), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 79/149 (53%), Gaps = 15/149 (10%)

Query: 26  LLEMLTGLLYKIIKSNDRLKPFDQEKHDINNKYVAHVLSFRGKHIPTITLGDYFARIQKY 85
           L+ +++ +L  +I+ ND +        D N K    +  F  +  P I++ +Y  R+ KY
Sbjct: 61  LVVLISRMLSSLIQMNDSMC------KDKNLK----LTRFHSRVPPGISVYNYLIRLAKY 110

Query: 86  CPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNS 145
             +   V ++ + Y D ++    ++ P  F ++S  +HR ++ A TV++K  SD F +N 
Sbjct: 111 SSLEPAVLIAAVYYIDLLS----SVYPS-FTLNSLTVHRFLLTATTVASKGLSDSFCTNV 165

Query: 146 RYARVGGISLEELNRLELQFSILCDFELI 174
            YA+VGG+   ELN LE +F    ++ +I
Sbjct: 166 HYAKVGGVQCSELNVLETEFLKRVNYRII 194

>ACR001C [1049] [Homologous to ScYOL001W (PHO80) - SH]
           (357962..359002) [1041 bp, 346 aa]
          Length = 346

 Score = 66.6 bits (161), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 68/137 (49%), Gaps = 18/137 (13%)

Query: 29  MLTGLLYKIIKSNDRLKPFDQEKHDINNKYVAHVLSFRGKHIPTITLGDYFARIQKYCPI 88
           MLT L+       D+ KP               +  F  +  P I++ +Y  R+ KY  +
Sbjct: 37  MLTSLIGMNDAQGDKSKPIK-------------LTRFHSRVPPAISVYNYLIRLTKYSSL 83

Query: 89  TNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYA 148
            + V L+ + Y D +      + P+ F +DS  +HR ++ A TV++K   D F +N+ YA
Sbjct: 84  EHCVLLASVYYIDLLTN----VYPE-FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYA 138

Query: 149 RVGGISLEELNRLELQF 165
           +VGG+   ELN LE +F
Sbjct: 139 KVGGVQCSELNVLENEF 155

>Kwal_56.22443
          Length = 280

 Score = 65.5 bits (158), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 77/149 (51%), Gaps = 15/149 (10%)

Query: 17  DIAQFPTDKLLEMLTGLLYKIIKSNDRLKPFDQEKHDINNKYVAHVLSFRGKHIPTITLG 76
           D +Q     L+ +++ +L  + + ND + P D  K          +  F  +  P I++ 
Sbjct: 37  DFSQCSRTDLVILISRMLSFLTRINDSV-PKDDAKE---------LTRFHSRVPPQISVY 86

Query: 77  DYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHRLIIAAVTVSTKF 136
           DY  R+ +Y  +   V ++ + Y D ++    A+ P  F ++S  +HR ++ A TV++K 
Sbjct: 87  DYMMRLTRYSSLEPAVLVASVYYIDLLS----AMYPS-FSLNSLTVHRFLLTATTVASKG 141

Query: 137 FSDFFYSNSRYARVGGISLEELNRLELQF 165
             D F +NS YA+VGG+   EL+ LE +F
Sbjct: 142 LCDSFCTNSHYAKVGGVQCSELHVLESEF 170

>YOL001W (PHO80) [4815] chr15 (325249..326130) Cyclin that interacts
           with Pho85p cyclin-dependent kinase, regulates the
           phosphate pathway through phosphorylation of Pho4p [882
           bp, 293 aa]
          Length = 293

 Score = 63.2 bits (152), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 60/110 (54%), Gaps = 5/110 (4%)

Query: 65  FRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHR 124
           +  K  P I++ +YF R+ K+  + + V ++ L Y D +      + P  F ++S   HR
Sbjct: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL----QTVYPD-FTLNSLTAHR 121

Query: 125 LIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELI 174
            ++ A TV+TK   D F +N+ YA+VGG+   ELN LE  F    ++ +I
Sbjct: 122 FLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171

>YGL134W (PCL10) [1853] chr7 (255666..256967) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           glycogen accumulation [1302 bp, 433 aa]
          Length = 433

 Score = 60.5 bits (145), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 64/120 (53%), Gaps = 3/120 (2%)

Query: 64  SFRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRI--AKRCNALDPQLFVMDSYN 121
           +F  K  PT++  D+  RIQ  C     V+L      D +   +  N +      +    
Sbjct: 299 NFYMKSKPTLSSADFLKRIQDKCEYQPTVYLVATFLIDTLFLTRDGNNILQLKLNLQEKE 358

Query: 122 IHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSI-LCDFELIVSIQEL 180
           +HR+IIAAV +STK   DF +S+  +++V GIS   L +LE+   I +C+ +L+VS ++L
Sbjct: 359 VHRMIIAAVRLSTKLLEDFVHSHEYFSKVCGISKRLLTKLEVSLLICVCNTKLMVSNRKL 418

>Scas_720.47
          Length = 473

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 60/113 (53%), Gaps = 12/113 (10%)

Query: 64  SFRGKHIPTITLGDYFARIQKYCPITNDVFL-------SLLVYFDRIAKRCNALDPQLFV 116
           +F+ K  P+++  D+  RIQ  C     V+L       +LL+  +  +++        F 
Sbjct: 339 NFKMKSPPSLSYADFIQRIQNKCEYDPHVYLIATYLLQTLLLIREEHSRKLKLR----FK 394

Query: 117 MDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILC 169
            +  ++HRLIIA V ++TK   D  +S+  + +V GIS + L++LE+   +LC
Sbjct: 395 FEKSDVHRLIIATVRIATKLLEDHVHSHEYFCKVSGISKKLLSKLEVSL-LLC 446

>CAGL0E05918g complement(585723..587168) some similarities with
           tr|Q08966 Saccharomyces cerevisiae YPL219w PCL8,
           hypothetical start
          Length = 481

 Score = 49.7 bits (117), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 73/161 (45%), Gaps = 32/161 (19%)

Query: 50  EKHDINNKYVAHVLSFRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNA 109
           EK D N  Y  H  S   K  P+I+  D+  RIQ  C   + ++L    Y  +I      
Sbjct: 335 EKADNNENY--HYFSM--KSAPSISHHDFIQRIQNKCMFGSIIYLGA-TYLLQI------ 383

Query: 110 LDPQLFVMDSYN--------------IHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISL 155
               LF+   YN              +HR+I+  + ++TK   DF +S+    +V GIS 
Sbjct: 384 ----LFLTREYNDGPLRLKHKLQQNEVHRVIVGTIRIATKLLEDFVHSHQYICKVCGISK 439

Query: 156 EELNRLELQFSILC--DFELIVSIQELQRYADLLYKFWHRE 194
           + + +LEL   I C  D  L+++ ++L   A +L +   +E
Sbjct: 440 KLMTKLELAL-IFCLKDNNLLINSEKLSATACILEELKAQE 479

>Scas_706.3
          Length = 451

 Score = 49.7 bits (117), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 63/117 (53%), Gaps = 6/117 (5%)

Query: 69  HIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFV---MDSYNIHRL 125
           ++P+++  D+  RIQ  C     V++S    F  +    +  D  + +   +    +HR+
Sbjct: 322 NVPSLSYTDFINRIQSKCMFGAIVYMSATYLFQILLLDRDERDGPIKLKHKLQENEVHRM 381

Query: 126 IIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILC--DFELIVSIQEL 180
           IIA + V TK   DF +S+  + +V G+S + L++LE+   +LC    ++I++ +EL
Sbjct: 382 IIATIRVGTKLVEDFVHSHQYFCKVCGVSRKLLSKLEVTL-LLCLKHDKIIITTEEL 437

>CAGL0H08998g 877952..879595 weakly similar to tr|Q08966
           Saccharomyces cerevisiae YPL219w PCL8, hypothetical
           start
          Length = 547

 Score = 48.9 bits (115), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 64/124 (51%), Gaps = 6/124 (4%)

Query: 62  VLSFRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFV---MD 118
            L+F  K  P+++   +  RIQ  C     ++L+       +    +  D  + V   + 
Sbjct: 411 ALNFTMKSKPSVSAEIFLGRIQNKCEFGPIIYLAAAYLLQILFLTRDNPDSNIRVRLKLR 470

Query: 119 SYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILC--DFELIVS 176
              IHRLII+ V VS K   DF +S+  +++V G+S + L++LE+   I+C  +  L+++
Sbjct: 471 ENEIHRLIISTVRVSAKLVEDFVHSHEYFSKVCGVSKKLLSKLEVSL-IMCIKNERLMIT 529

Query: 177 IQEL 180
            Q+L
Sbjct: 530 KQKL 533

>YPL219W (PCL8) [5230] chr16 (136749..138227) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           control of glycogen accumulation [1479 bp, 492 aa]
          Length = 492

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 64/124 (51%), Gaps = 4/124 (3%)

Query: 63  LSFRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFV---MDS 119
           ++F  K+ P+++  D+  RIQ  C     V+L        +    + +D  + +   +  
Sbjct: 354 VNFVMKNPPSLSFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLTRDEMDGPIKLKAKLQE 413

Query: 120 YNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFE-LIVSIQ 178
              HR+II+ + ++TK   DF +S +   +V GIS   L +LE+ F    +F+ L+++ +
Sbjct: 414 DQAHRIIISTIRIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFMASVNFDGLMITCE 473

Query: 179 ELQR 182
           +L++
Sbjct: 474 KLEK 477

>KLLA0B02024g 176585..178168 some similarities with sp|P53124
           Saccharomyces cerevisiae YGL134w PCL10 cyclin like
           protein interacting with PHO85P, hypothetical start
          Length = 527

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 65/125 (52%), Gaps = 13/125 (10%)

Query: 65  FRGKHIPTITLGDYFARIQKYCPITNDVFLS----LLVY----FDRIAKRCNALDPQLFV 116
           F+ K  PT+++  Y  RI+  C     ++L+    L+ Y    FD  + + +  +P    
Sbjct: 392 FQMKSAPTLSISQYLDRIESKCSFPPIIYLTASFLLVTYCDIKFDTGSGKFHLENPITES 451

Query: 117 MDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFS-ILCDFELIV 175
           M     HRL+IA + ++ K   D  +S+S +++V GIS + L++LEL    IL D +  +
Sbjct: 452 M----THRLLIAFIRLAAKLLEDHVHSHSYFSKVCGISKKLLSKLELNLVLILQDTQDGL 507

Query: 176 SIQEL 180
            I EL
Sbjct: 508 LITEL 512

>Kwal_56.24151
          Length = 480

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 58/118 (49%), Gaps = 11/118 (9%)

Query: 61  HVLSFRGKHIPTITLGDYFARIQ---KYCPI---TNDVFLSLLVYFDRIAKRCNALDPQL 114
            + +F     PT+   +Y  R+     + PI   T    L  L    +  K C       
Sbjct: 344 QLATFNMDSTPTLAYEEYLQRLHCKFSFAPIVYLTAAHLLQSLFLTRKDNKLCCK----- 398

Query: 115 FVMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFE 172
           + +D+  +HRLIIA++ ++TK   D  +S++ ++R+ GIS + L +LE+ F    +FE
Sbjct: 399 YHLDNCQVHRLIIASIRLATKLLEDCVHSHTCFSRICGISKKLLTKLEIAFLNCINFE 456

>AFL115W [3080] [Homologous to ScYPL219W (PCL8) - SH; ScYGL134W
           (PCL10) - SH] complement(221235..222395) [1161 bp, 386
           aa]
          Length = 386

 Score = 43.1 bits (100), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 49/106 (46%), Gaps = 6/106 (5%)

Query: 65  FRGKHIPTITLGDYFARIQKYC---PITNDVFLSLLV--YFDRIAKRCNALDPQLFVMDS 119
           F  K   ++T   Y  RI   C   PI       LL+             +  +  + +S
Sbjct: 244 FEMKAPASVTYTQYLDRINAKCMFAPIVYQTAGCLLLRLTLKWPPSETGPVQIRWPIAES 303

Query: 120 YNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQF 165
           Y +HRLI+A + VSTK   D  +S+  +++V GIS + L RLEL  
Sbjct: 304 Y-VHRLIVALIRVSTKIVEDTVHSHEYFSKVCGISKKLLMRLELAL 348

>CAGL0E02233g 215697..216497 similar to sp|P24867 Saccharomyces
           cerevisiae YNL289w PCL1 cyclin, start by similarity
          Length = 266

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 59/115 (51%), Gaps = 8/115 (6%)

Query: 68  KHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHRLII 127
           +H+P+  L  +  R+ +Y  +     L+ + Y +++ +    + P+        IHRL +
Sbjct: 50  EHLPS--LMTFITRLVRYTNVYTPTLLATVCYLNKLKR----ILPKDATGLPSTIHRLFL 103

Query: 128 AAVTVSTKFFSDFFYSNSRYARV--GGISLEELNRLELQFSILCDFELIVSIQEL 180
           A + +S+K  +D    N  +AR   G  SLE++N +E Q   L ++++ VS  +L
Sbjct: 104 ACLILSSKCHNDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDINVSEDDL 158

>YNL289W (PCL1) [4322] chr14 (87895..88734) G1/S-specific cyclin
           that interacts with the Cdc28p-like kinase Pho85p [840
           bp, 279 aa]
          Length = 279

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 74/161 (45%), Gaps = 22/161 (13%)

Query: 23  TDKLLEMLTGLLYKIIKSNDRLKPFDQEKHDINNKYVAHVLSFRGKHIPTI-TLGDYFAR 81
           TD +++ LT    +++ S++               Y     S   KH+  + +L  +  R
Sbjct: 17  TDDIIKFLTDTTLRVVPSSN---------------YPTPPGSPGEKHLTRLPSLMTFITR 61

Query: 82  IQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHRLIIAAVTVSTKFFSDFF 141
           + +Y  +     L+   Y +++ +    + P+        IHR+ +A + +S KF +D  
Sbjct: 62  LVRYTNVYTPTLLTAACYLNKLKR----ILPRDATGLPSTIHRIFLACLILSAKFHNDSS 117

Query: 142 YSNSRYARV--GGISLEELNRLELQFSILCDFELIVSIQEL 180
             N  +AR   G  +LE++N +E Q   L +++L V+ ++L
Sbjct: 118 PLNKHWARYTDGLFTLEDINLMERQLLQLLNWDLRVNTEDL 158

>KLLA0B05885g complement(530762..532738) no similarity, hypothetical
           start
          Length = 658

 Score = 33.1 bits (74), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 54/116 (46%), Gaps = 19/116 (16%)

Query: 81  RIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHRLIIAAV---------- 130
           ++Q +C    ++   +   F++ A +CN  D  + + D YN+ +L I             
Sbjct: 364 KVQSWCI---ELITKMETQFNKDADKCNDEDALMNIKDKYNLAKLFINEFNDMLFSTRGV 420

Query: 131 ---TVSTKFFSDFF--YSNSRYARVGGISLEELNRLELQFS-ILCDFELIVSIQEL 180
              T++T+ ++D    ++NS   R+ G+   +L  L+   S +L + E   S++ L
Sbjct: 421 NMNTLATREYTDILTRFANSLETRMSGLFQRDLYSLQRSISFLLTESEFESSVKSL 476

>Kwal_47.19087
          Length = 405

 Score = 32.0 bits (71), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 64/149 (42%), Gaps = 22/149 (14%)

Query: 26  LLEMLTGLLYKIIKSNDRLKPFDQEKHDINNKYVAHVLSFRGKHIPTITLGDYFARIQKY 85
           + E +    Y + +S D L        DI  K V  VL      +P++T           
Sbjct: 127 MSEFVVKNAYIVFESTDALSRESSGVFDIFTKGVCSVL--NATRLPSVT----------- 173

Query: 86  CPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYN-IHRLIIAAVTVSTKFFSDFFYSN 144
                 VF++L      I+K    +D      DS N I++ ++ A+ ++ KF  D  ++N
Sbjct: 174 ------VFMALDFLCKYISKLPTGVD--AVGGDSVNVIYQNLMIALILANKFNDDKTFTN 225

Query: 145 SRYARVGGISLEELNRLELQFSILCDFEL 173
             ++   G+ L  +NRLE ++  + ++ L
Sbjct: 226 KSWSHATGMELAVINRLEREWLAVFEWRL 254

>KLLA0F05654g 552056..552991 some similarities with sgd|S0002338
           Saccharomyces cerevisiae YDL179w PCL9 cyclin like
           protein interacting with PHO85P, hypothetical start
          Length = 311

 Score = 31.6 bits (70), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 24/115 (20%), Positives = 51/115 (44%), Gaps = 6/115 (5%)

Query: 68  KHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHRLII 127
           +H  T++L D+   + ++  +     ++  VY  ++     ++ P          HR+ I
Sbjct: 39  RHGSTVSLVDFIKSLIRHSNVQTPTLMATTVYLTKL----RSILPHDVCGIETTRHRIFI 94

Query: 128 AAVTVSTKFFSDFFYSNSRYARV--GGISLEELNRLELQFSILCDFELIVSIQEL 180
             + ++ K  +D    N  +     G  +LE++N +E +   L  + L  S+QEL
Sbjct: 95  GCLILAAKNLNDSSPLNKHWTNYTDGLFTLEDVNTIERELLSLFSWNLNFSMQEL 149

>ABL200W [392] [Homologous to ScYNL233W (BNI4) - SH]
           complement(33854..36223) [2370 bp, 789 aa]
          Length = 789

 Score = 32.0 bits (71), Expect = 0.37,   Method: Composition-based stats.
 Identities = 35/116 (30%), Positives = 51/116 (43%), Gaps = 21/116 (18%)

Query: 17  DIAQFPT--------DKLLEMLTG-LLYKIIKSNDRLKPFDQEKHDINNKYVAHVLSFRG 67
           DIA+F          D  LE+ TG L YK +   D L+  D  + DI     +  L  R 
Sbjct: 567 DIAEFANIIDFGDEVDFDLELGTGDLKYKTLNPKDILQS-DTLRADIRITSSSEYL--RE 623

Query: 68  KHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIH 123
            H P   LGD   R+   C +T+D+ L  + Y+D        +D + F +D   +H
Sbjct: 624 AHEP---LGDEPRRVTIGCDLTHDLSLKTMDYYDE------DIDNEHFALDGEEMH 670

>AFR547W [3739] [Homologous to ScYPR160W (GPH1) - SH]
           complement(1419049..1421751) [2703 bp, 900 aa]
          Length = 900

 Score = 32.0 bits (71), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 48/107 (44%), Gaps = 19/107 (17%)

Query: 20  QFPTDKLLEMLTGLLYKIIKSNDRLKPFDQ----EKHDINNKYVAHVLSFRGK---HIPT 72
           QF   KL   LTG L + IKS D + P       +KH++  K       F+GK   H+ T
Sbjct: 22  QFRPRKLARRLTGFLPQEIKSIDSMIPLQSRELWKKHEV--KKFGDSEEFQGKFIQHVET 79

Query: 73  ITLG------DYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQ 113
            TL       D FA  Q       D   +L++ +++  +R  A DP+
Sbjct: 80  -TLARSLYNCDEFAAYQAASESVRD---NLVIDWNKTQQRITARDPK 122

>Kwal_34.15996
          Length = 231

 Score = 31.2 bits (69), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 14/61 (22%), Positives = 36/61 (59%)

Query: 124 RLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELIVSIQELQRY 183
           R+ +  + ++ KF +D  +S + + R+ G+S ++L+ +E       D+EL+++ + L  +
Sbjct: 127 RVYLCCLILAHKFLNDQTFSMNSWQRISGLSSKDLSTMERWCLSKLDYELLINDENLNSW 186

Query: 184 A 184
           +
Sbjct: 187 S 187

>Kwal_23.6117
          Length = 897

 Score = 30.0 bits (66), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 41/99 (41%), Gaps = 6/99 (6%)

Query: 50  EKHDINNKYVAHVLSFRGKHIPTITLGDYFARIQKYCPITNDVFLS--LLVYFDRIAKRC 107
           E + I  + V + + F  KH P  T+  Y            D  L     +  D   +R 
Sbjct: 319 EMNVILGREVGYSIRFEDKHTPGTTVLKYMTDGMLLREFMTDPELKKYACIMIDEAHERT 378

Query: 108 NALDPQLFVMDSYNIHR----LIIAAVTVSTKFFSDFFY 142
            A D  L ++     HR    LII++ T++   FS+FFY
Sbjct: 379 LATDVLLGLLKDILPHRKDLRLIISSATMNAAKFSNFFY 417

>Scas_598.14
          Length = 294

 Score = 29.6 bits (65), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/91 (21%), Positives = 44/91 (48%), Gaps = 6/91 (6%)

Query: 74  TLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHRLIIAAVTVS 133
           +L  +  R+ +Y  +     L+ + Y +++ +    + P+        IHR+ +A + +S
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTTVCYLNKLKR----ILPKDATGLPSTIHRIFLACLILS 109

Query: 134 TKFFSDFFYSNSRYARV--GGISLEELNRLE 162
            KF +D    N  + +   G  +LE++N +E
Sbjct: 110 AKFHNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>YJL109C (UTP10) [2806] chr10 complement(211917..217226) Component of
            U3 snoRNP (also called small subunit processome), which
            is required for 18S rRNA biogenesis [5310 bp, 1769 aa]
          Length = 1769

 Score = 29.6 bits (65), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 64/147 (43%), Gaps = 30/147 (20%)

Query: 41   NDRLKPFDQEKHDINNKYVAHV--------------LSFRGKHIPTITLGD--------- 77
            N+ +   +   H+I+N YV  +               +F G+ +    + +         
Sbjct: 1518 NNTISRIEASVHEISNSYVLKMNDKVFRPLFVILVRWAFDGEGVTNAGITETERLLAFFK 1577

Query: 78   YFARIQKYC-PITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHRLIIAAVTVSTKF 136
            +F ++Q+    I    F  LL   D + KR  + D     M++ N+ RL+I ++T S KF
Sbjct: 1578 FFNKLQENLRGIITSYFTYLLEPVDMLLKRFISKD-----MENVNLRRLVINSLTSSLKF 1632

Query: 137  FSD-FFYSNSRYARVGGISLEELNRLE 162
              D ++ S SR+  +    + +L+ +E
Sbjct: 1633 DRDEYWKSTSRFELISVSLVNQLSNIE 1659

>Kwal_23.5231
          Length = 256

 Score = 28.5 bits (62), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 62/148 (41%), Gaps = 26/148 (17%)

Query: 23  TDKLLEMLTGLLYKIIKSNDRLKPFDQEKHDINNK-YVAHVLSFRGKHIPTI-TLGDYFA 80
           TD ++  LT     +I             H+ N + Y +   S +  H  T+ +L  +  
Sbjct: 16  TDDMIRYLTNTTLTVIPC----------AHNNNRQTYPSPPASPQEPHKRTLPSLMTFVT 65

Query: 81  RIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNI----HRLIIAAVTVSTKF 136
           R+ +Y  +     L+   Y +++ +        L   D++ +    HR+ +A + +S KF
Sbjct: 66  RLVRYTNVYTSTLLTATCYLEKLRR--------LLPRDAHGLPSTSHRIFLACLILSAKF 117

Query: 137 FSDFFYSNSRYARV--GGISLEELNRLE 162
            +D    N  +A    G   LE++N +E
Sbjct: 118 HNDSSPQNKHWAAYTDGLFCLEDVNLME 145

>YHR071W (PCL5) [2359] chr8 (237005..237694) Cyclin that associates
           with the Pho85p cyclin-dependent kinase and regulates
           Gcn4p stability [690 bp, 229 aa]
          Length = 229

 Score = 27.3 bits (59), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 40/94 (42%), Gaps = 2/94 (2%)

Query: 86  CPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNS 145
           C   N V  +   YF +I +     D       S+   R+ +  + +S KF +D  YS  
Sbjct: 93  CSKENAVLATF--YFQKIHQSRGVRDESSLPEFSHCSRRIFLCCLILSHKFLNDNTYSMK 150

Query: 146 RYARVGGISLEELNRLELQFSILCDFELIVSIQE 179
            +  + G+  ++L+ +E       ++EL +   E
Sbjct: 151 NWQIISGLHAKDLSLMERWCLGKLNYELAIPYDE 184

>AEL195W [2311] [Homologous to ScYNL289W (PCL1) - SH]
           complement(266347..267060) [714 bp, 237 aa]
          Length = 237

 Score = 27.3 bits (59), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 123 HRLIIAAVTVSTKFFSDFFYSNSRYARV--GGISLEELNRLELQFSILCDFELIVSIQEL 180
           HR+ +A + +S KF +D    N  + +   G  + +++N +E Q   L D+ + V  ++L
Sbjct: 98  HRIFLACLILSAKFHNDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNVRVGHRDL 157

Query: 181 QR 182
            R
Sbjct: 158 CR 159

>Scas_647.14
          Length = 371

 Score = 27.3 bits (59), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 49/126 (38%), Gaps = 12/126 (9%)

Query: 85  YCPITNDVFLSLLVYFDRIAKRCNALDPQLFVM-DSYN-IHRLIIAAVTVSTKFFSDFFY 142
           Y   TN V  SL  YF       N +  Q+  + D  N IHR I A       F S   +
Sbjct: 84  YTVPTNFVPTSLHCYFINGGDPTNMITYQVEKLRDGRNFIHRQIRAYQHNKLIFQSMILF 143

Query: 143 SNSRYARVGGISLEELNRLE----------LQFSILCDFELIVSIQELQRYADLLYKFWH 192
           SN R +     SL  L  L+           Q +     E I+    LQRYA L  +F  
Sbjct: 144 SNQRNSNDAHDSLHHLAHLDNLTPLPPTETHQDAASLYTEKIIKNGNLQRYAHLSERFLD 203

Query: 193 REHLAK 198
            EHL +
Sbjct: 204 TEHLQR 209

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.141    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,562,449
Number of extensions: 277394
Number of successful extensions: 873
Number of sequences better than 10.0: 48
Number of HSP's gapped: 846
Number of HSP's successfully gapped: 49
Length of query: 203
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 106
Effective length of database: 13,238,163
Effective search space: 1403245278
Effective search space used: 1403245278
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)