Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL074W52451425890.0
Sklu_1893.251350116460.0
KLLA0C08283g51950915440.0
Kwal_23.581951650314980.0
YER056C (FCY2)53349914530.0
Scas_704.3654550714430.0
YER060W (FCY21)52849913990.0
Scas_715.4953251413940.0
CAGL0L00671g54349113920.0
Kwal_34.1573051850513750.0
YER060W-A (FCY22)53051013520.0
CAGL0J02948g51550413500.0
Scas_715.47d53348113460.0
Scas_715.47d152350111851e-158
CAGL0C00231g54049911461e-152
Scas_715.54d2322205419e-66
CAGL0L06138g6314474736e-52
Kwal_47.172165425354687e-52
Scas_710.305844244462e-48
KLLA0D05060g5235104362e-47
YGL186C (TPN1)5794124242e-45
CAGL0M13101g341145673.3
CAGL0G04411g177093657.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL074W
         (514 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH] complement(...  1001   0.0  
Sklu_1893.2 YER056C, Contig c1893 1725-3266                           638   0.0  
KLLA0C08283g complement(725563..727122) similar to sp|P17064 Sac...   599   0.0  
Kwal_23.5819                                                          581   0.0  
YER056C (FCY2) [1485] chr5 complement(266511..268112) Cytosine/p...   564   0.0  
Scas_704.36                                                           560   0.0  
YER060W (FCY21) [1490] chr5 (274565..276151) Protein with simila...   543   0.0  
Scas_715.49                                                           541   0.0  
CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomy...   540   0.0  
Kwal_34.15730                                                         534   0.0  
YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine p...   525   0.0  
CAGL0J02948g 282559..284106 highly similar to sp|P40039 Saccharo...   524   0.0  
Scas_715.47d                                                          523   0.0  
Scas_715.47d1                                                         461   e-158
CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces cer...   446   e-152
Scas_715.54d                                                          213   9e-66
CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces c...   186   6e-52
Kwal_47.17216                                                         184   7e-52
Scas_710.30                                                           176   2e-48
KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces c...   172   2e-47
YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of ...   167   2e-45
CAGL0M13101g 1286561..1287586 similar to sp|P35735 Saccharomyces...    30   3.3  
CAGL0G04411g complement(415927..421239) similar to sp|P42945 Sac...    30   7.1  

>ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH]
           complement(551981..553555) [1575 bp, 524 aa]
          Length = 524

 Score = 1001 bits (2589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/514 (96%), Positives = 494/514 (96%)

Query: 1   MGSSAEQYGTRSSMSLTKDDGSYGDLEKKKGFLSDAEEPVTPQVDETEYTTLSWVNRWAA 60
           MGSSAEQYGTRSSMSLTKDDGSYGDLEKKKGFLSDAEEPVTPQVDETEYTTLSWVNRWAA
Sbjct: 1   MGSSAEQYGTRSSMSLTKDDGSYGDLEKKKGFLSDAEEPVTPQVDETEYTTLSWVNRWAA 60

Query: 61  RLNAETKGVSPVTEDECHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLAT 120
           RLNAETKGVSPVTEDECHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLAT
Sbjct: 61  RLNAETKGVSPVTEDECHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLAT 120

Query: 121 VVFSFMGVLAVAFFSVFGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIAS 180
           VVFSFMGVLAVAFFSVFGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIAS
Sbjct: 121 VVFSFMGVLAVAFFSVFGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIAS 180

Query: 181 TTLLHMINPTGARCPPWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARL 240
           TTLLHMINPTGARCPPWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARL
Sbjct: 181 TTLLHMINPTGARCPPWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARL 240

Query: 241 AIAGNFTAGSSLGGKATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMI 300
           AIAGNFTAGSSLGGKATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMI
Sbjct: 241 AIAGNFTAGSSLGGKATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMI 300

Query: 301 AGLATPLLFTLILGAAAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVL 360
           AGLATPLLFTLILGAAAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVL
Sbjct: 301 AGLATPLLFTLILGAAAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVL 360

Query: 361 AMSTVANNIPNMYSIALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSF 420
           AMSTVANNIPNMYSIALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSF
Sbjct: 361 AMSTVANNIPNMYSIALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSF 420

Query: 421 MDSIGYYLSIYIVICVTEHFVFRKGFRGYDVSHWDRPDLLPXXXXXXXXXXXXXXXXXXX 480
           MDSIGYYLSIYIVICVTEHFVFRKGFRGYDVSHWDRPDLLP                   
Sbjct: 421 MDSIGYYLSIYIVICVTEHFVFRKGFRGYDVSHWDRPDLLPAGYAGCAALCVGAVGVAMG 480

Query: 481 XSHEYYTGPIAKLAGGDIGFLLAAGFSFIVYICC 514
            SHEYYTGPIAKLAGGDIGFLLAAGFSFIVYICC
Sbjct: 481 MSHEYYTGPIAKLAGGDIGFLLAAGFSFIVYICC 514

>Sklu_1893.2 YER056C, Contig c1893 1725-3266
          Length = 513

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/501 (61%), Positives = 383/501 (76%), Gaps = 4/501 (0%)

Query: 14  MSLTKDDGSYGDLEKKKGFLSDAEEPVTPQVDETEYTTLSWVNRWAARLNAETKGVSPVT 73
           MS +K++ +  D+EK+   L   E   TP V+ TEYTT+S+++RWAA+L AETKG+ P+T
Sbjct: 1   MSSSKEEYAIQDMEKQNP-LELTETDSTPVVESTEYTTVSFIDRWAAKLKAETKGIEPIT 59

Query: 74  EDECHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMGVLAVAF 133
           ++E  D S+LNAASMWFSAN+VIAA+A+GVL T VF LN  E+VL  + FSF+G++ VAF
Sbjct: 60  DEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSFLGLIPVAF 119

Query: 134 FSVFGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLHMINPTGAR 193
           FSVFGAE G+RQM+LSR+LMGN TARIF LINVIACVGW +VNTIAS +LLHMINP GA+
Sbjct: 120 FSVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLHMINPGGAQ 179

Query: 194 CPPWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARLAIAGNFTAGSSLG 253
           CPPWAA LIIV ST+ +TFFGYRVIHAYEKWSWVPN  VFL+IIARL I+GNF+ G    
Sbjct: 180 CPPWAACLIIVFSTIIVTFFGYRVIHAYEKWSWVPNFAVFLVIIARLKISGNFSTGEWTS 239

Query: 254 GKATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMIAGLATPLLFTLIL 313
           G  TAG  LS+G  +FGFASGWTTYAADYTVYMP+++NK++IFF ++ GLA PL F+LIL
Sbjct: 240 GATTAGGVLSFGGSIFGFASGWTTYAADYTVYMPRSTNKWKIFFALVFGLAFPLCFSLIL 299

Query: 314 GAAAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVLAMSTVANNIPNMY 373
           GAA+   +  N  W +YY+ HSVGGL +AIL +++L GFG+FCCV+LAMSTVANNIPNMY
Sbjct: 300 GAASIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTVANNIPNMY 359

Query: 374 SIALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSFMDSIGYYLSIYIV 433
           SIAL TQ++W   A+VPRVFWT+ GN  +L IAI AYYKFE+FM+SFM++I YYL+IYI 
Sbjct: 360 SIALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFMEAIAYYLAIYIA 419

Query: 434 ICVTEHFVFRKGFRGYDVSHWDRPDLLPXXXXXXXXXXXXXXXXXXXXSHEYYTGPIAKL 493
           I ++EHF +RKGF+GY+V  W+R D LP                    S  Y+ G IA+ 
Sbjct: 420 ISLSEHFFYRKGFKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVAFGMSQTYWEGQIARH 479

Query: 494 A---GGDIGFLLAAGFSFIVY 511
               GGDIGF L  GFSFI Y
Sbjct: 480 IGEYGGDIGFELGMGFSFITY 500

>KLLA0C08283g complement(725563..727122) similar to sp|P17064
           Saccharomyces cerevisiae YER056c FCY2 purine-cytosine
           permease, start by similarity
          Length = 519

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/509 (60%), Positives = 376/509 (73%), Gaps = 14/509 (2%)

Query: 13  SMSLTKDDGSYGDLEKKKGFLSDA-------EEPVTPQVDETEYTTLSWVNRWAARLNAE 65
           S S +K++    D+EK++  LS         EEPV   V+ TE T LSWV+  A++L+AE
Sbjct: 2   SSSSSKEEYVLHDVEKQE--LSKTQFDEVLEEEPVI--VETTEVTKLSWVDHLASKLHAE 57

Query: 66  TKGVSPVTEDECHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSF 125
           TKG+ P+T+DE  D  +LNAASMW SANLVIAAF++G + T+VF LN  EAVL  V FSF
Sbjct: 58  TKGIEPITDDEKDDDDILNAASMWLSANLVIAAFSLGCIGTSVFGLNFGEAVLVIVFFSF 117

Query: 126 MGVLAVAFFSVFGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLH 185
           +G+L VAFFSVFGAE GLRQ++LSR+L+GN TARIFC IN+IACVGW +VNTIAS +LLH
Sbjct: 118 LGLLPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACVGWGAVNTIASASLLH 177

Query: 186 MINPTGARCPPWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARLAIAGN 245
           ++NP+G  CPPWA  LII+  T+ +TFFGYRVIHAYEKWSWVPN  VFL+IIARLA AG 
Sbjct: 178 IVNPSGPDCPPWAGCLIIIFGTIIVTFFGYRVIHAYEKWSWVPNFAVFLVIIARLAKAGT 237

Query: 246 FTAGSSLGGKATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMIAGLAT 305
           FTAGS   G  TAG  LS+GS VFGFA+GWTTYA+DYTVYMP+ +NK ++F  ++ GLA 
Sbjct: 238 FTAGSWGSGSTTAGGVLSFGSSVFGFATGWTTYASDYTVYMPRTTNKKKVFAAIVLGLAF 297

Query: 306 PLLFTLILGAAAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVLAMSTV 365
           PL F++ILGAAA     TN  W E Y K+SVGGLC+AIL E++L GFG FCCVVLA+ST+
Sbjct: 298 PLCFSMILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLWGFGSFCCVVLALSTI 357

Query: 366 ANNIPNMYSIALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSFMDSIG 425
           +NNIPNMYSIAL TQAL+   A+VPRV WT++GN  +L IAI AYYKFETFMT+FMDSIG
Sbjct: 358 SNNIPNMYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAYYKFETFMTTFMDSIG 417

Query: 426 YYLSIYIVICVTEHFVFRKGFRGYDVSHWDRPDLLPXXXXXXXXXXXXXXXXXXXXSHEY 485
           YYL+IY  I ++EHF++R GF+GY+V  WDR D LP                    +  Y
Sbjct: 418 YYLAIYSAIALSEHFIYRGGFKGYNVDDWDRWDKLPIGYAGTFALFIGAFGVAFGMNQIY 477

Query: 486 YTGPIAKLA---GGDIGFLLAAGFSFIVY 511
           + G I +L    GGDIGF L AGF+FI Y
Sbjct: 478 WQGQIGRLIGENGGDIGFELGAGFAFITY 506

>Kwal_23.5819
          Length = 516

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/503 (58%), Positives = 359/503 (71%), Gaps = 5/503 (0%)

Query: 14  MSLTKDDGSYGDLEKK-KGFLSDAEEPVTPQVDETEYTTLSWVNRWAARLNAETKGVSPV 72
           MSL K++    D+EK+       +++   P V+ TEYT LS V+R AA L AETKG+ PV
Sbjct: 1   MSLQKEEYEIQDVEKRLNSRFEISDDDSQPVVESTEYTKLSIVDRIAASLRAETKGIEPV 60

Query: 73  TEDECHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMGVLAVA 132
           TE+E  D S+ NAASMWFSAN+VIAAF++GVL   V+ LN    VLA V+FS +GV+ VA
Sbjct: 61  TEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIPVA 120

Query: 133 FFSVFGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLHMINPTGA 192
           ++SVFGAE GLRQM+LSR+L+GN TARIF LIN+IACVGW +VNTIAS  LLHMINP GA
Sbjct: 121 YYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPGGA 180

Query: 193 RCPPWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARLAIAGNFTAGSSL 252
           RCPPWA  LIIVLST+ +TFFGYRVIHAYEKWSW+PN  VFL+IIARL I G+F++G  +
Sbjct: 181 RCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIARLKIDGSFSSGEWI 240

Query: 253 GGKATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMIAGLATPLLFTLI 312
            G   A + LS+G V+FGFASGWTTYAADYTVYMP+ +NK ++FF +I GL  PL F++I
Sbjct: 241 SGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFSII 300

Query: 313 LGAAAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVLAMSTVANNIPNM 372
           LGAAA      N  +   +    VGGL +AIL  N+L GFGQFCCV+LAMSTVANNIPNM
Sbjct: 301 LGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIPNM 360

Query: 373 YSIALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSFMDSIGYYLSIYI 432
           YSIAL TQALW   A++PRVFWT+ GN  +L IAI AYYKF +FMT+FMD+I YYLSIYI
Sbjct: 361 YSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSIYI 420

Query: 433 VICVTEHFVFRK-GFRGYDVSHWDRPDLLPXXXXXXXXXXXXXXXXXXXXSHEYYTGPIA 491
            I ++EH  FRK  FR Y+V  W++ D LP                       Y+TG IA
Sbjct: 421 GISLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYAGCCALFVGAVGVAVGMEQTYWTGQIA 480

Query: 492 KLA---GGDIGFLLAAGFSFIVY 511
           +     G DIGF +   FS IVY
Sbjct: 481 RKIGDYGADIGFEIGFCFSVIVY 503

>YER056C (FCY2) [1485] chr5 complement(266511..268112)
           Cytosine/purine permease, member of the purine/cytosine
           permease family of membrane transporters [1602 bp, 533
           aa]
          Length = 533

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/499 (56%), Positives = 357/499 (71%), Gaps = 8/499 (1%)

Query: 21  GSYGDLEKK----KGFLSDAEEPVTPQVDETEYTTLSWVNRWAARLNAETKGVSPVTEDE 76
           GS  + EKK    + F + +E+     V+ +E T LSW +++ A LNAETKGV PVTEDE
Sbjct: 22  GSSLENEKKVAASETFTATSEDDQQYIVESSEATKLSWFHKFFASLNAETKGVEPVTEDE 81

Query: 77  CHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMGVLAVAFFSV 136
             D S+LNAASMWFSAN+VIA++A+G L   VF LN  ++VL  + F+ MG++ VAFFSV
Sbjct: 82  KTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVIIFFNIMGLIFVAFFSV 141

Query: 137 FGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLHMINP-TGARCP 195
           FGAE GLRQMILSRYL+GN TARIF LINVIACVGW  VNT  S  LL+M+N  +G  CP
Sbjct: 142 FGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSAQLLNMVNEGSGHVCP 201

Query: 196 PWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARLAIAGNFTAGSSLGGK 255
            WA  LII+  TV +TFFGY VIHAYEKWSWVPN  VFL+IIA+L+ +G F  G  +GG 
Sbjct: 202 IWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIAQLSRSGKFKGGEWVGGA 261

Query: 256 ATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMIAGLATPLLFTLILGA 315
            TAGS LS+GS +FGFA+GWTTYAADYTVYMPK++NKY+IFF ++AGLA PL FT+ILGA
Sbjct: 262 TTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFSLVAGLAFPLFFTMILGA 321

Query: 316 AAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVLAMSTVANNIPNMYSI 375
           A+      +PTW  YY K+++GG+ +AIL  N+L GFGQFCCV+LA+ST+ANNIPNMY++
Sbjct: 322 ASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLALSTIANNIPNMYTV 381

Query: 376 ALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSFMDSIGYYLSIYIVIC 435
           ALS QALW+  A++PRV WT+ GNA +L I+I A Y F+ FM +FMDSIGYYL+IYI I 
Sbjct: 382 ALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMDSIGYYLAIYIAIS 441

Query: 436 VTEHFVFRKGFRGYDVSHWDRPDLLPXXXXXXXXXXXXXXXXXXXXSHEYYTGPIAKLA- 494
            +EHF +R+ F  Y++  WD  + LP                       Y+ G I +L  
Sbjct: 442 CSEHFFYRRSFSAYNIDDWDNWEHLPIGIAGTAALIVGAFGVALGMCQTYWVGEIGRLIG 501

Query: 495 --GGDIGFLLAAGFSFIVY 511
             GGDIGF L A ++FI+Y
Sbjct: 502 KYGGDIGFELGASWAFIIY 520

>Scas_704.36
          Length = 545

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/507 (57%), Positives = 361/507 (71%), Gaps = 7/507 (1%)

Query: 10  TRSSMSLTKDDGSYGDLEKKKGFLSDAEEPVTPQVDET--EYTTLSWVNRWAARLNAETK 67
           T   M+   +  S  D++   G + D +E  + Q  ET  E T LS+ NR+ A LNAETK
Sbjct: 28  TGYEMNSFGEKASSADIKVIPG-VPDYDEYESIQEPETYMEETKLSFFNRFVASLNAETK 86

Query: 68  GVSPVTEDECHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMG 127
           GV PVT++E  D S++NAASMWFSANLVIA++A+G L   VF LN   +VL  + F+ +G
Sbjct: 87  GVEPVTDEEKTDDSIINAASMWFSANLVIASYALGGLGPIVFNLNFGTSVLVIIFFNILG 146

Query: 128 VLAVAFFSVFGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLHMI 187
           +L++AFFSVFGAEFGLRQMILSRYL+GN TARIF +IN+IACVGW  VNT+AS+ LL+M+
Sbjct: 147 LLSIAFFSVFGAEFGLRQMILSRYLLGNITARIFAIINIIACVGWGVVNTVASSQLLNMV 206

Query: 188 NPTGARCPPWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARLAIAGNFT 247
           N T   CP WA  LIIV  TV +TFFGY VIHAYEKWSWVPN  VFL+IIARL ++G FT
Sbjct: 207 N-TPNNCPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWVPNFAVFLVIIARLKMSGAFT 265

Query: 248 AGSSLGGKATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMIAGLATPL 307
            G    G  TAG+ LS+G  VFGFA+GWTTYAADYTVYMP+++NKY IFF + AGL+ PL
Sbjct: 266 GGEWTSGPTTAGNVLSFGGAVFGFAAGWTTYAADYTVYMPRSTNKYTIFFSLTAGLSLPL 325

Query: 308 LFTLILGAAAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVLAMSTVAN 367
            FT+ILGAA+      NP W  YYK + +GG+ +AIL  ++L GFGQFCCV+LAMSTVAN
Sbjct: 326 FFTMILGAASAMGAVNNPDWMNYYKSNGMGGVTYAILVPDSLHGFGQFCCVLLAMSTVAN 385

Query: 368 NIPNMYSIALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSFMDSIGYY 427
           NIPNMY+IALS QAL+  F++VPRV WT+ GNA +L I+I A Y F+ FM +FM+SIGYY
Sbjct: 386 NIPNMYTIALSVQALYQPFSKVPRVAWTMAGNAFTLGISIAACYYFQGFMENFMNSIGYY 445

Query: 428 LSIYIVICVTEHFVFRKGFRGYDVSHWDRPDLLPXXXXXXXXXXXXXXXXXXXXSHEYYT 487
           L+IYI I ++EHF++RKGF+GY+V  W+    LP                    S  Y+ 
Sbjct: 446 LAIYIAISLSEHFIYRKGFQGYNVEDWNTWSKLPIGIAGTSALIVGAFGVALGMSQSYWV 505

Query: 488 GPIAKL---AGGDIGFLLAAGFSFIVY 511
           G I KL    GGDIGF L A ++FIVY
Sbjct: 506 GEIGKLIGDHGGDIGFELGASWAFIVY 532

>YER060W (FCY21) [1490] chr5 (274565..276151) Protein with
           similarity to Fcy2p, member of the purine/cytosine
           family of secondary active transporters [1587 bp, 528
           aa]
          Length = 528

 Score =  543 bits (1399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/499 (54%), Positives = 347/499 (69%), Gaps = 16/499 (3%)

Query: 25  DLEKKKGFLSDAEEPVTPQ---------VDETEYTTLSWVNRWAARLNAETKGVSPVTED 75
           DLE +     DA+ P T +          +E     LS++NR AA L+AETKG+ P+TED
Sbjct: 21  DLESRA---HDAKTPSTNEFYDDVESHGTEELVEAKLSFLNRIAAGLSAETKGIEPITED 77

Query: 76  ECHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMGVLAVAFFS 135
           E  D S+LNAASMWFSAN+V+ A+A+G L   VF LN  ++V   + F+ +G+++VAFFS
Sbjct: 78  EKTDDSILNAASMWFSANMVLPAYAIGALGPMVFDLNFGQSVFVIIFFNLLGLVSVAFFS 137

Query: 136 VFGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLHMINPTGARCP 195
           VFGAE GLRQMILSRYL+GN  ARIF  IN IAC+GW  VNT+AS+ +L+M+NP G +CP
Sbjct: 138 VFGAELGLRQMILSRYLVGNIAARIFSFINFIACIGWGIVNTVASSQVLNMVNP-GHQCP 196

Query: 196 PWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARLAIAGNFTAGSSLGGK 255
            WA  ++I+ +TV +TFFGY VIHAYEKW+WVPN  VFL+IIARLA +  F  G    G 
Sbjct: 197 LWAGCIVIIGATVIVTFFGYGVIHAYEKWAWVPNFAVFLVIIARLARSKKFVLGEWTSGP 256

Query: 256 ATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMIAGLATPLLFTLILGA 315
            TAG+ LS+GS V+GFA+GWTTYAADYTVYMP+ +NKY+IFF ++ GLATPL FT+ILGA
Sbjct: 257 TTAGNVLSFGSTVYGFAAGWTTYAADYTVYMPRKTNKYKIFFSLVVGLATPLYFTMILGA 316

Query: 316 AAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVLAMSTVANNIPNMYSI 375
           A       +P W  YY ++S+GGL FA+L  N++ GFGQFCCV+L++ST+ANN+PNMY+I
Sbjct: 317 AVAMAAIGDPAWKTYYDENSIGGLTFAVLVPNSVHGFGQFCCVLLSLSTIANNVPNMYTI 376

Query: 376 ALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSFMDSIGYYLSIYIVIC 435
           ALS QA W   A+VPRV WTL+GNA +L IAI A Y F TFM  FMDSIGYYL+IYI I 
Sbjct: 377 ALSVQATWEPLAKVPRVIWTLLGNAAALGIAIPACYYFSTFMNYFMDSIGYYLAIYIAIA 436

Query: 436 VTEHFVFRKGFRGYDVSHWDRPDLLPXXXXXXXXXXXXXXXXXXXXSHEYYTGPIAKLA- 494
            +EHF++R+ F  Y+V  WD  + LP                       Y+ G I++L  
Sbjct: 437 CSEHFIYRRSFSAYNVDDWDSWERLPIGIAGTAALIVGAFGVALGMCQTYWVGEISRLIG 496

Query: 495 --GGDIGFLLAAGFSFIVY 511
             GGDIGF L   ++FIVY
Sbjct: 497 DYGGDIGFELGLSWAFIVY 515

>Scas_715.49
          Length = 532

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/514 (52%), Positives = 359/514 (69%), Gaps = 11/514 (2%)

Query: 6   EQYGTRSSMSLTKDDGSYGDLEKKKGFLS-----DAEEPVTPQVDETEYTTLSWVNRWAA 60
           ++    SS  +   + +  DL+     LS     D +   + +V ET+   L+  NR AA
Sbjct: 9   KEIDVGSSYEMNDLERNSKDLKSPSKNLSSDYYVDIDSHASEEVLETK---LNLFNRIAA 65

Query: 61  RLNAETKGVSPVTEDECHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLAT 120
            L+AETKG+ P+T++E +D+SLLNAASMWFSAN+VIAA+A+G L   VF LN   + L  
Sbjct: 66  GLSAETKGIEPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVI 125

Query: 121 VVFSFMGVLAVAFFSVFGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIAS 180
           + F+ +G+L VAFFS+FGA+ GLRQM+LSR+L+GN+TARIF +IN +ACVGW  VNT+AS
Sbjct: 126 IFFNILGLLPVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVAS 185

Query: 181 TTLLHMINPTGARCPPWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARL 240
           + LL+M+N    +CP WA  ++I+ +T+ ITFFGYRVIH++EKW WVPN   FL+IIARL
Sbjct: 186 SQLLNMVNQGPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIARL 245

Query: 241 AIAGNFTAGSSLGGKATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMI 300
           A +GNF+ G    G  TAG+ LS+GS VFGFA+GWTTYAADYTVYMP+N+NK++IFF ++
Sbjct: 246 AKSGNFSNGEWTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFSLV 305

Query: 301 AGLATPLLFTLILGAAAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVL 360
           AGL+ PL F +ILGAA+      NP W  YY ++ +GGL +AIL  N+L GFG+FCCVVL
Sbjct: 306 AGLSFPLFFVMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCVVL 365

Query: 361 AMSTVANNIPNMYSIALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSF 420
           ++S VANN+PNMY+IALS QA+W+  A++PRVFWT+ GN  +L IAI A Y F+TFM  F
Sbjct: 366 SISIVANNVPNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFMEYF 425

Query: 421 MDSIGYYLSIYIVICVTEHFVFRKGFRGYDVSHWDRPDLLPXXXXXXXXXXXXXXXXXXX 480
           MDSI YYL+IYI I ++EHF++R+ F  Y+V  WD    LP                   
Sbjct: 426 MDSIAYYLAIYISIALSEHFIYRRSFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALG 485

Query: 481 XSHEYYTGPIAKLA---GGDIGFLLAAGFSFIVY 511
               Y+TG I +L    GGD+GF L AG+SFIVY
Sbjct: 486 MCQTYWTGQIGRLIGEYGGDLGFELGAGWSFIVY 519

>CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomyces
           cerevisiae YER056c FCY2 purine-cytosine permease or
           sp|P40039 Saccharomyces cerevisiae YER060w FCY21,
           hypothetical start
          Length = 543

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/491 (55%), Positives = 350/491 (71%), Gaps = 7/491 (1%)

Query: 25  DLEKKKGF-LSDAEEPVTPQVDETEYTTLSWVNRWAARLNAETKGVSPVTEDECHDSSLL 83
           D E   G   +++ E  T  V+ET+   L +++R A ++NAETKGV PVT++E  D S+L
Sbjct: 43  DFEYDYGDDFTNSSEAAT--VEETK-LKLGFISRLALKMNAETKGVEPVTDEEKTDDSVL 99

Query: 84  NAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMGVLAVAFFSVFGAEFGL 143
           NAASMWFSANLV+A++A+G L   VFRLN   +VL  V F+ +G+++VAFFSVFGAEFGL
Sbjct: 100 NAASMWFSANLVLASYALGALGPIVFRLNFGTSVLTIVFFNMIGLVSVAFFSVFGAEFGL 159

Query: 144 RQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLHMINPTGARCPPWAASLII 203
           RQMILSR+L+GN TAR+F  INV+ACVGW  VNT+ +  LLH++N    + P W   L+I
Sbjct: 160 RQMILSRFLVGNVTARVFAAINVVACVGWGVVNTVVAAQLLHIVNQGSHQLPLWGGCLVI 219

Query: 204 VLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARLAIAGNFTAGSSLGGKATAGSFLS 263
           V  TV +TFFGY +IHAYE+WSWVPN  VFL+IIARL  +G F+ G    G  TAG  LS
Sbjct: 220 VGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVIIARLHKSGQFSNGPWTSGATTAGGVLS 279

Query: 264 YGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMIAGLATPLLFTLILGAAAGRCVHT 323
           +GS ++GFA+GWTTYAADYTVYMP+  NK++IFFF+ AGLA PLLFT+ILGAA+      
Sbjct: 280 FGSAIYGFAAGWTTYAADYTVYMPRTMNKFKIFFFLCAGLAFPLLFTMILGAASAMGAVN 339

Query: 324 NPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVLAMSTVANNIPNMYSIALSTQALW 383
           NP W   Y K ++GGL +AIL  N+L GFG+FCCV+LAMST+ANNIPNMY+IALS QAL+
Sbjct: 340 NPEWMALYDKDNMGGLTYAILVPNSLHGFGEFCCVLLAMSTIANNIPNMYTIALSVQALY 399

Query: 384 SRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSFMDSIGYYLSIYIVICVTEHFVFR 443
             F+RVPRV WTL GNA  + I+I A Y FE F+ +FMDSIGYYL+IYI I ++EHF++R
Sbjct: 400 EPFSRVPRVVWTLAGNAAVVGISIPASYYFEGFLENFMDSIGYYLAIYIAISLSEHFIYR 459

Query: 444 KGFRGYDVSHWDRPDLLPXXXXXXXXXXXXXXXXXXXXSHEYYTGPIAK---LAGGDIGF 500
           +GF+GY++  W+  D LP                    S  Y+TG I++     GGDIGF
Sbjct: 460 RGFKGYNIEDWNNWDRLPIGIAGCSALFVGAFGVALGMSQTYWTGEISRHIGKHGGDIGF 519

Query: 501 LLAAGFSFIVY 511
            L   ++FIV+
Sbjct: 520 ELGMSWAFIVF 530

>Kwal_34.15730
          Length = 518

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/505 (55%), Positives = 344/505 (68%), Gaps = 9/505 (1%)

Query: 16  LTKDDGSYGDLE-----KKKGFLSDAEEPVTPQVDETEYTTLSWVNRWAARLNAETKGVS 70
           + KD     DLE     ++     DA    +   ++     ++ +NR A +L AETKG+ 
Sbjct: 1   MAKDKYEVQDLELNVYSQENTSADDATRGSSQAPEKLNGGGMAVLNRLAKKLRAETKGIE 60

Query: 71  PVTEDECHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMGVLA 130
           PVTEDE  DSS+ NAA +WFSAN+VIAAF+VG+L   VF LN    V++ V+F+F+GVL 
Sbjct: 61  PVTEDEKDDSSIWNAAFVWFSANMVIAAFSVGMLGPLVFSLNFWGCVVSIVIFTFIGVLP 120

Query: 131 VAFFSVFGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLHMINPT 190
           V  +SVFG +  LRQM+LSR+L+GN TARIF LINVIAC+GW  VNT+ S  LLHMINPT
Sbjct: 121 VCLYSVFGVQLSLRQMVLSRFLLGNVTARIFALINVIACIGWGVVNTVTSAQLLHMINPT 180

Query: 191 GARCPPWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARLAIAGNFTAGS 250
           G RCPPWA  LIIV ST+F+TFFGYRVIH + K+SW+PN +VF++IIARL I G+F+ G 
Sbjct: 181 GGRCPPWAGCLIIVFSTIFVTFFGYRVIHTFGKYSWIPNFIVFIVIIARLKIDGSFSVGK 240

Query: 251 SLGGKATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMIAGLATPLLFT 310
              G  TAGS LS G +VFGFA+GWTTYAAD+TVYMP+  N+  +FF ++ GL  PL FT
Sbjct: 241 WESGSTTAGSILSLGGIVFGFATGWTTYAADFTVYMPRTVNRAEVFFAVMLGLVFPLCFT 300

Query: 311 LILGAAAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVLAMSTVANNIP 370
           +ILGAAAG     NP + E+Y+    GGL +AIL   +L GFGQFCCV+LAMSTVAN +P
Sbjct: 301 IILGAAAGCAALNNPVYHEFYESDHAGGLVYAILVPRSLHGFGQFCCVLLAMSTVANMVP 360

Query: 371 NMYSIALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSFMDSIGYYLSI 430
           NMYSIAL TQALW   A+VPRVFWTL GN  +L IAI AYY+FE FMT+FMDSI YYLSI
Sbjct: 361 NMYSIALGTQALWEPLAKVPRVFWTLAGNLITLAIAIPAYYRFEAFMTNFMDSIAYYLSI 420

Query: 431 YIVICVTEHFVFRKG-FRGYDVSHWDRPDLLPXXXXXXXXXXXXXXXXXXXXSHEYYTGP 489
           YI + ++EHF+FR+  F  YD S W+    LP                       Y+TG 
Sbjct: 421 YIGVSLSEHFIFRQNKFSNYDTSEWNDWHRLPLGYAGCAALFVGAIGVALGMHQTYWTGE 480

Query: 490 IAKLA---GGDIGFLLAAGFSFIVY 511
           I +L    GGDIGF L   FS IVY
Sbjct: 481 IGRLIGEFGGDIGFELGLAFSMIVY 505

>YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine
           permease with similarity to Fcy2p, member of the
           purine/cytosine subfamily of the nucleobase:cation
           symporter-1 (NCS1) family [1593 bp, 530 aa]
          Length = 530

 Score =  525 bits (1352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/510 (52%), Positives = 343/510 (67%), Gaps = 11/510 (2%)

Query: 13  SMSLTKDDGSY------GDLEKKKGFLSDAEEPVT-PQVDETEYTTLSWVNRWAARLNAE 65
           SM   KD GS       G L+ K        E V   + +E      S+ NR AA LNAE
Sbjct: 8   SMVDIKDAGSELRDLESGALDTKSSAADVYYEGVELHRTNEFIDNKPSFFNRIAAALNAE 67

Query: 66  TKGVSPVTEDECHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSF 125
           TKG+ PVTEDE +D S+LNAA++WFSAN+VI A++VG L   VF LN  ++VL  + F+ 
Sbjct: 68  TKGIEPVTEDEKNDDSILNAATIWFSANMVIVAYSVGALGPLVFGLNFGQSVLVIIFFNI 127

Query: 126 MGVLAVAFFSVFGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLH 185
           +G++ VA FS+FG E GLRQMILSRYL GN TAR F L+NVIACVGW  +N   S  LL+
Sbjct: 128 LGLIPVALFSLFGVELGLRQMILSRYLAGNITARFFSLVNVIACVGWCVLNISVSAQLLN 187

Query: 186 MINP-TGARCPPWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARLAIAG 244
           M+N  +G  CP WA  LII   TV +TFFGY V+HAYEKWSWVPN   FL+IIA+L+ +G
Sbjct: 188 MVNEGSGHNCPIWAGCLIIAGGTVLVTFFGYSVVHAYEKWSWVPNFAAFLVIIAQLSRSG 247

Query: 245 NFTAGSSLGGKATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMIAGLA 304
            F  G  +GG  TAG  LS+GS VFG A+GW TYAADYTVYMPK ++KY+IFF ++AGLA
Sbjct: 248 KFKGGEWVGGATTAGGVLSFGSSVFGSAAGWATYAADYTVYMPKTTSKYKIFFSVVAGLA 307

Query: 305 TPLLFTLILGAAAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVLAMST 364
            PL FT+ILGAA G     +PTW  YY K+++GG+ +AIL  N+L GFGQFCCV+LA+ST
Sbjct: 308 FPLFFTMILGAACGMAALNDPTWKSYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLALST 367

Query: 365 VANNIPNMYSIALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSFMDSI 424
           VANN+P MY++ALS QALW+  A++PRV WT+ GNA +L I+I A Y F+ FM +FMDSI
Sbjct: 368 VANNVPGMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMDSI 427

Query: 425 GYYLSIYIVICVTEHFVFRKGFRGYDVSHWDRPDLLPXXXXXXXXXXXXXXXXXXXXSHE 484
           GYYL+IYI I  +EHF++R+ F  Y++  WD  + LP                       
Sbjct: 428 GYYLAIYIAIACSEHFIYRRSFSAYNIDDWDNWEHLPIGIAGTAALIAGAFGVALGMCQT 487

Query: 485 YYTGPIAKLA---GGDIGFLLAAGFSFIVY 511
           Y+ G I++L    GGDIGF L   ++FI+Y
Sbjct: 488 YWVGEISRLIGEYGGDIGFELGGSWAFIIY 517

>CAGL0J02948g 282559..284106 highly similar to sp|P40039
           Saccharomyces cerevisiae YER060w or sp|P17064
           Saccharomyces cerevisiae YER056c FCY2, hypothetical
           start
          Length = 515

 Score =  524 bits (1350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/504 (52%), Positives = 339/504 (67%), Gaps = 11/504 (2%)

Query: 22  SYGDLEKKKGFLSDAEEPVTPQVDETEY-------TTLSWVNRWAARLNAETKGVSPVTE 74
           SY D +         E      V+   Y       T LS +NR AA ++AETKG+ P+T+
Sbjct: 2   SYEDKKDLYDMEMQVESSANSHVETDGYNDATVLETKLSLLNRLAAMISAETKGIEPITD 61

Query: 75  DECHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMGVLAVAFF 134
           DE +D SL+NAASMWFSAN+V+ A A+G L   VF LN   +VL  V F+ +G+ AVAFF
Sbjct: 62  DEKNDDSLINAASMWFSANMVLPALAIGGLGPLVFGLNFGVSVLTIVFFNILGLFAVAFF 121

Query: 135 SVFGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLHMINPTGARC 194
           SVFGA+FGLRQM+LSRYL+GN TARIF LIN +ACVGW  VNT+A++ LL+ INP   + 
Sbjct: 122 SVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPGSHQL 181

Query: 195 PPWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARLAIAGNFTAGSSLGG 254
           P W   L+I+ +T+ ++FFGY+VIH YEK+SWVPN  VFL++IARL I+G F  G+   G
Sbjct: 182 PLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNGAWGSG 241

Query: 255 KATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMIAGLATPLLFTLILG 314
             TAGS LS+GS VFGFASGWTTYAADYTVYMP+N+N Y+IFF ++AGLA PL FT+ILG
Sbjct: 242 PTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFPLFFTMILG 301

Query: 315 AAAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVLAMSTVANNIPNMYS 374
           +A  +       W E+Y K+ +GGL FAIL  ++L GFGQFCCVVLAMST+ANN+PNMY+
Sbjct: 302 SACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIANNVPNMYT 361

Query: 375 IALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSFMDSIGYYLSIYIVI 434
           IALS Q++W  FA++PRV WT++GN  +L I+I A Y F TFM  FMDSI YYLSIYI I
Sbjct: 362 IALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDSIAYYLSIYISI 421

Query: 435 CVTEHFVFR-KGFRGYDVSHWDRPDLLPXXXXXXXXXXXXXXXXXXXXSHEYYTGPIAKL 493
            + EH ++R   F  Y+V  W+    LP                    S  Y+ G IA+ 
Sbjct: 422 ALCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIARH 481

Query: 494 A---GGDIGFLLAAGFSFIVYICC 514
               GGDI   L AG++FI Y  C
Sbjct: 482 IGEYGGDIAIELGAGWAFIAYNIC 505

>Scas_715.47d
          Length = 533

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/481 (51%), Positives = 340/481 (70%), Gaps = 4/481 (0%)

Query: 36  AEEPVT-PQVDETEYTTLSWVNRWAARLNAETKGVSPVTEDECHDSSLLNAASMWFSANL 94
           + EP +  ++ E   +  S+ NR A++LNAETKG+  +T++E  D S+L+A SMWFSAN+
Sbjct: 41  SNEPASFIEITEETGSKFSFFNRLASQLNAETKGIERITDEEKTDGSILDATSMWFSANM 100

Query: 95  VIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMGVLAVAFFSVFGAEFGLRQMILSRYLMG 154
           VI+A+ +G +   V+ LN    VL  + FS +G+L VAFFS+FGA+FGLRQM+LSR+L+G
Sbjct: 101 VISAYTLGGIGPLVYGLNFGTCVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIG 160

Query: 155 NTTARIFCLINVIACVGWSSVNTIASTTLLHMINPTGARCPPWAASLIIVLSTVFITFFG 214
           N+TARI  +INVI+ VGW  VN++AS+ LL+M+N     CP WA  +II+ +T+ +TFFG
Sbjct: 161 NSTARIIAVINVISSVGWGVVNSVASSQLLNMVNQGHHSCPLWAGCVIIIGATILVTFFG 220

Query: 215 YRVIHAYEKWSWVPNLVVFLIIIARLAIAGNFTAGSSLGGKATAGSFLSYGSVVFGFASG 274
           Y  IHAYE+WSWVPN  VFL+IIARL ++GNF+ G    G  TAG+ LS+G  +FGFA+G
Sbjct: 221 YSYIHAYERWSWVPNFAVFLVIIARLHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATG 280

Query: 275 WTTYAADYTVYMPKNSNKYRIFFFMIAGLATPLLFTLILGAAAGRCVHTNPTWGEYYKKH 334
           WT YAADYTVYMP+++NK++IFF ++ GL+ PL F LILGAA+      NPTW +YY+ +
Sbjct: 281 WTVYAADYTVYMPRDTNKFKIFFSLVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNN 340

Query: 335 SVGGLCFAILAENALGGFGQFCCVVLAMSTVANNIPNMYSIALSTQALWSRFARVPRVFW 394
            +GG+ +AIL  ++L GFG+FCCV+LA+ST+ANNIPNMYSI L+ QA+W   A+VPR  W
Sbjct: 341 GMGGVTYAILVPDSLHGFGEFCCVLLALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIW 400

Query: 395 TLVGNACSLVIAIVAYYKFETFMTSFMDSIGYYLSIYIVICVTEHFVFRKGFRGYDVSHW 454
           TL GNA +L I+I A Y F+ FM  FM+SIGYYL+IY    + EHF+FR+GF+GY+V  W
Sbjct: 401 TLAGNAATLAISIPACYYFDGFMEDFMNSIGYYLAIYSATALAEHFIFRRGFKGYNVEDW 460

Query: 455 DRPDLLPXXXXXXXXXXXXXXXXXXXXSHEYYTGPIAKLA---GGDIGFLLAAGFSFIVY 511
           D    LP                    S  Y+ G IA+     GGDIGF L AG++F+VY
Sbjct: 461 DDNSKLPMGIAGCAALFVGAFGVALGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVY 520

Query: 512 I 512
           +
Sbjct: 521 V 521

>Scas_715.47d1
          Length = 523

 Score =  461 bits (1185), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 232/501 (46%), Positives = 316/501 (63%), Gaps = 14/501 (2%)

Query: 25  DLEKKK-GFLSD--------AEEPVTPQVDETEYTTLSWVNRWAARLNAETKGVSPVTED 75
           DLEK+   F+++         E+  +  V  +E + ++++ + A RLNAET+G+ PV +D
Sbjct: 12  DLEKQDPAFVANEAISNDTTGEDDFSKTV-SSEASNIAFLQKIATRLNAETRGIEPVRDD 70

Query: 76  ECHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMGVLAVAFFS 135
           E  D+++ N   +WFSAN VI+A+AVG L   VF LN     L  V F+ +GV+ VA+FS
Sbjct: 71  EKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGVVPVAYFS 130

Query: 136 VFGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLHMINPTGARCP 195
           +FG E GLRQM+LSRYL+GN   R F  IN IACVGW  +N+I S  LL+M+N  G RCP
Sbjct: 131 LFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVNLHGHRCP 190

Query: 196 PWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARLAIAGNFTAGSSLGGK 255
            WA  +++VL T+ +TFFG +VI A+E+WSWVPNL VFL+IIARL  +G F+ G    G 
Sbjct: 191 FWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVIIARLHKSGQFSGGKWTSGP 250

Query: 256 ATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMIAGLATPLLFTLILGA 315
            TAG+ LS G V +G+A  W TY+ADYTVYMP+N+NK ++FF +   L  PL FT+ILGA
Sbjct: 251 TTAGNVLSLGCVAYGYAGAWATYSADYTVYMPRNTNKVKLFFGLCVALTVPLCFTMILGA 310

Query: 316 AAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVLAMSTVANNIPNMYSI 375
           A G     N TW +YY  + +GGL + +L  N++ GFG+FCCV+LA+ST+ANN PNMY++
Sbjct: 311 AVGMGGVNNATWAKYYSSNGIGGLTYEVLVPNSVHGFGEFCCVLLALSTIANNTPNMYTL 370

Query: 376 ALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSFMDSIGYYLSIYIVIC 435
             S QA+W   ARVPR F TL GNA   V+   A Y F++FM  FMD++ YY +IYI + 
Sbjct: 371 GFSFQAIWEPLARVPRAFCTLFGNAAVFVVGCCACYYFDSFMEKFMDTLAYYGAIYISLG 430

Query: 436 VTEHFVFRK-GFRGYDVSHWDRPDLLPXXXXXXXXXXXXXXXXXXXXSHEYYTGPIAKL- 493
           + EH +FRK  F+ YDV  W     LP                       Y+ G I +  
Sbjct: 431 MAEHLIFRKCSFKAYDVKDWKTFSKLPIGIAGGVGFFVAAFGVALGMCQSYWVGEIGRRI 490

Query: 494 --AGGDIGFLLAAGFSFIVYI 512
              GGD+GF + A + FI Y+
Sbjct: 491 GKDGGDVGFEMGAAWGFIAYV 511

>CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces
           cerevisiae YER060w or sp|P17064 Saccharomyces cerevisiae
           YER056c, hypothetical start
          Length = 540

 Score =  446 bits (1146), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 236/499 (47%), Positives = 318/499 (63%), Gaps = 8/499 (1%)

Query: 19  DDGSYGDLEKKKGFLSDAEEPVTPQVDETEYTT--LSWVNRWAARLNAETKGVSPVTEDE 76
           +D    D+  K+ F     +      DET + +  + W+ R    LNAETKGV P+ E+E
Sbjct: 33  EDLELKDITFKEKFNELDNKSTETDKDETCFKSPFIIWLKR---TLNAETKGVEPINENE 89

Query: 77  CHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMGVLAVAFFSV 136
            +D+++  ++ +WFSANLV+AA+ VG L   V+ LN   +VL  V F+ +G+++V+FFSV
Sbjct: 90  KNDTNIFGSSFVWFSANLVLAAYGVGSLGPTVYHLNFAISVLTIVFFNILGLVSVSFFSV 149

Query: 137 FGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLHMINPTGARCPP 196
           FGAE GLRQMI+SRYL+GN TARIF  +N I CVGW  +N   +  L  +I   G   P 
Sbjct: 150 FGAELGLRQMIISRYLVGNVTARIFAALNCIGCVGWDVLNIYLAAKLFAIIKTGGNHLPL 209

Query: 197 WAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARLAIAGNFTAGSSLGGKA 256
           W   ++IV STVFI   GY+ IH YEKWSW+PNL VFLIII+R+ I+  F+ G    G  
Sbjct: 210 WGGCIVIVGSTVFIAALGYKFIHIYEKWSWIPNLAVFLIIISRIKISREFSNGPWTSGST 269

Query: 257 TAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMIAGLATPLLFTLILGAA 316
           TAG+ LS+GS +FG A+GW TY+ADYTVYMP+ +NK+RIFFF   GLA  L+FT+I+GAA
Sbjct: 270 TAGNVLSFGSAIFGSAAGWVTYSADYTVYMPRRTNKFRIFFFNSIGLAFSLIFTMIVGAA 329

Query: 317 AGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVLAMSTVANNIPNMYSIA 376
           AG C   N  W E Y +  +GG+ +A+L  N+L GFG+FCCV+LAMSTVANN+P+MY+IA
Sbjct: 330 AGICAVNNSKWMELYNEFQIGGVTYALLVPNSLHGFGKFCCVILAMSTVANNVPSMYTIA 389

Query: 377 LSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSFMDSIGYYLSIYIVICV 436
           LS QALW     VPR  WT+  N   L I+I A Y F++FM +FM SIGY+ ++YI I +
Sbjct: 390 LSVQALWEPLTSVPRAIWTIFANIVVLGISIPACYFFQSFMQNFMGSIGYFYALYIGISL 449

Query: 437 TEHFVFRKGFRGYDVSHWDRPDLLPXXXXXXXXXXXXXXXXXXXXSHEYYTGPIAKLA-- 494
            EH VFR+ F  Y+V+     + LP                    +  Y+ G IA+    
Sbjct: 450 AEHCVFRRKFGNYNVNDHSNWEKLPIGFAGCIALIVGSFGVALGMAQTYWVGEIARKIGT 509

Query: 495 -GGDIGFLLAAGFSFIVYI 512
            GGDIGF L   ++F+ YI
Sbjct: 510 YGGDIGFELGMSWAFLTYI 528

>Scas_715.54d
          Length = 232

 Score =  213 bits (541), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 107/220 (48%), Positives = 148/220 (67%), Gaps = 8/220 (3%)

Query: 25  DLEKKK-GFLSDA--EEPVTPQVD-----ETEYTTLSWVNRWAARLNAETKGVSPVTEDE 76
           DLEK+   F+++       T + D      +E + ++++ + A RLNAET+G+ PV +DE
Sbjct: 13  DLEKQDPAFVANEAISNDTTSEDDFSKTVSSEASNIAFLQKIATRLNAETRGIEPVRDDE 72

Query: 77  CHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMGVLAVAFFSV 136
             D+++ N   +WFSAN VI+A+AVG L   VF LN     L  V F+ +GV+ VA+FS+
Sbjct: 73  KTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGVVPVAYFSL 132

Query: 137 FGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLHMINPTGARCPP 196
           FG E GLRQM+LSRYL+GN   R F  IN IACVGW  +N+I S  LL+M+N  G RCP 
Sbjct: 133 FGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVNLHGHRCPF 192

Query: 197 WAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLII 236
           WA  +++VL T+ +TFFG +VI A+E+WSWVPNL VFL+I
Sbjct: 193 WAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232

>CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, start by similarity
          Length = 631

 Score =  186 bits (473), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 126/447 (28%), Positives = 213/447 (47%), Gaps = 15/447 (3%)

Query: 7   QYGTRSSMSLTKDDGSYGDLEKKKGFLSDAEEPVTPQVDETEYTTLSWVNRWAARLNAET 66
            Y      +   D  S  +   KK F  D  +P    +       L W++        ET
Sbjct: 33  DYDLEKRSTHKTDPDSRTNRRNKKLFDLDRHDP-NLNIFMKGLAYLLWLSDKLDSFGVET 91

Query: 67  KGVSPVTE-DECHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSF 125
            G+  V   +       L+ A +W SA   +++ +  +L   +F L+  +A+ ++++   
Sbjct: 92  SGIERVPPYERGTKKQFLHVAGLWLSATGGLSSMSSFLLGPLLFELSFQQALTSSMISVT 151

Query: 126 MGVLAVAFFSVFGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLH 185
           +G L  A+ S+ G + G RQM+ +RYL G    +   L  +I  +GWS  N++    +L 
Sbjct: 152 VGCLVAAYCSIMGPQSGCRQMVTARYLFGWWFVKFVALAAIIGVMGWSVTNSVVGGEMLA 211

Query: 186 MINPTGARCPPWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIII----ARLA 241
            I  +  R P W   +I+ + +  +  FG + +   E +  VP L  FL++      R  
Sbjct: 212 AI--SNDRVPLWVGIVIVTVCSFVVAIFGIKQVLRIETYISVPVLTSFLLLYISSGNRDY 269

Query: 242 IAGNFTAGSSLGGKATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMIA 301
           +   +     +  K   G+++S+ S+ +   S W +  ADY +  P+++  Y++F   +A
Sbjct: 270 LVREYKP-IDVPSKTIKGNWISFFSLCYSITSTWGSITADYYILFPEDTPHYQVFLLTLA 328

Query: 302 GLATPLLFTLILGAAAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVLA 361
           G   P  F  ILG        +   +GE Y  H +GGL +A  +     GFG+F  VVL 
Sbjct: 329 GTLIPTTFVGILGLTLASIAKSYQPYGEEYDTHGMGGLLWAGFSR--WNGFGKFLVVVLI 386

Query: 362 MSTVANNIPNMYSIALSTQ--ALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTS 419
           +S ++NNI N YS A   Q  A+W+  ARVPR FW +V     LV A+V    F T + +
Sbjct: 387 LSLISNNIINTYSAAFGIQLSAVWA--ARVPRWFWCIVCTIVYLVCALVGRNHFATILGN 444

Query: 420 FMDSIGYYLSIYIVICVTEHFVFRKGF 446
           F+  IGY++S+Y ++   E+ +FR+ F
Sbjct: 445 FLPMIGYWISMYFILLFEENVIFRRYF 471

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 28/67 (41%), Gaps = 4/67 (5%)

Query: 449 YDVSHWDRPDLLPXXXXXXXXXXXXXXXXXXXXSHEYYTGPIAKLAGG----DIGFLLAA 504
           Y+   WD PD+L                     +  Y+ GPIA+  GG    DI   L+ 
Sbjct: 552 YNWDEWDNPDVLTHGYAATFAFLCGVAGVVVGMAQTYWVGPIARKLGGPYGGDIAMWLSM 611

Query: 505 GFSFIVY 511
           GFS IVY
Sbjct: 612 GFSGIVY 618

>Kwal_47.17216
          Length = 542

 Score =  184 bits (468), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 138/535 (25%), Positives = 231/535 (43%), Gaps = 54/535 (10%)

Query: 19  DDGSYGDLEKKKGFLSDAEEPVTPQVDETEYTTLSWVNRWAARLNAETKGVSPVTEDECH 78
           DD  + + EK +G   +  + V  +V       LS  ++    L  E +G+  +   E  
Sbjct: 7   DDVVFSETEKSRG---EGNQTVFGKV----LNKLSVASKRLDALGVEIRGIQRIPAYERG 59

Query: 79  DS-SLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMGVLAVAFFSVF 137
            S   L+ A +W SA   +++ +   L   +F L   +++++ +V   +G    A+ S  
Sbjct: 60  TSKQFLSVAGLWLSAAGGLSSMSSYFLGPLLFELTFRQSLVSGLVSMAIGCAVAAYLSTM 119

Query: 138 GAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLHMINPTGARCPPW 197
           G + G RQM+ +RYL G    +   L ++I  +GWS VN +    +L  I  + ++ P W
Sbjct: 120 GPQSGCRQMVTARYLFGWYFVKFVSLASIIGVMGWSIVNCVVGGQMLAAI--SNSKIPLW 177

Query: 198 AASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIII----ARLAIAGNFTAGSSLG 253
              +I+   +  +  FG + +   E +  VP L  FL++      +  +   F     + 
Sbjct: 178 VGIIIVTAVSFIVAIFGIKQVLRVETFLSVPVLTCFLLLYIAASDKYYLLDTFK-NDDID 236

Query: 254 GKATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMIAGLATPLLFTLIL 313
                G++LS+ S+ +   S W +  ADY +  P+++  Y++F     G   P  F  +L
Sbjct: 237 PLTIKGNWLSFFSLCYSITSTWGSITADYYILFPEDTAHYKVFLLTFFGTLIPTTFVGVL 296

Query: 314 GAAAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVLAMSTVANNIPNMY 373
           G     C  +   W   Y K+ +GGL F+        GFG+FC VVL  S ++NNI N Y
Sbjct: 297 GLILASCAASYEPWKAAYHKYGMGGLLFS--GFERWNGFGKFCVVVLIFSLISNNIINTY 354

Query: 374 SIALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSFMDSIGYYLSIYIV 433
           S A + Q      ARVPR  W +      LV A+V    F   + +F+  IGY++S+Y +
Sbjct: 355 SAAFNIQLSSVHMARVPRWLWAIACTIFYLVCALVGRNHFSEILGNFLPMIGYWISMYFI 414

Query: 434 ICVTEHFVFRKGFR----------------------------------GYDVSHWDRPDL 459
           I + E+ +FR  FR                                   Y+   W+  ++
Sbjct: 415 ILLEENLIFRSHFRHLYTEEFPPHPVEEGESPRALRDIKNKKVSSRKHAYNWEMWNNAEV 474

Query: 460 LPXXXXXXXXXXXXXXXXXXXXSHEYYTGPIAKL---AGGDIGFLLAAGFSFIVY 511
           L                     +  Y+ GPIA+     GGD+G  ++ GFS  VY
Sbjct: 475 LTHGYAATFAFLVGVGGVALSMAQAYWIGPIARHFGDFGGDLGMWVSMGFSGTVY 529

>Scas_710.30
          Length = 584

 Score =  176 bits (446), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 119/424 (28%), Positives = 211/424 (49%), Gaps = 23/424 (5%)

Query: 43  QVDETEYTTLSWVNRWAARL--------------NAETKGVSPVT--EDECHDSSLLNAA 86
           +V ETE+TT+     +  RL                E  G+  ++  E        ++ A
Sbjct: 10  EVAETEFTTVKKSPSYLRRLLHTANLLSKKLDSLGVEATGIERISPYERGSKRKQFIHVA 69

Query: 87  SMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMGVLAVAFFSVFGAEFGLRQM 146
             W +A   +++ +  +L   +F L   E++++ +V   +G L  A+ S+ G + G RQM
Sbjct: 70  GYWLAATGSLSSMSSFLLGPLLFGLTFNESMVSGIVSMAIGCLVAAYCSIMGPQSGCRQM 129

Query: 147 ILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLHMINPTGARCPPWAASLIIVLS 206
           + +RYL G    +   L  +I  +GWS VN++    +L  I  +  + P W   LI+ L 
Sbjct: 130 VTARYLFGWWFVKFVALAAIIGVMGWSVVNSVVGGEMLASI--SNDKVPLWVGVLIVTLF 187

Query: 207 TVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARLAIAGNFTAG--SSLGGKAT-AGSFLS 263
           +  +  FG + +   E +  +P  ++F+++    +   ++     S +  + T  G++LS
Sbjct: 188 SFLVAVFGIKQVLKVETYLSIPVWLMFILLYISSSDKYHYIDDFKSPIPDRLTLKGNWLS 247

Query: 264 YGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMIAGLATPLLFTLILGAAAGRCVHT 323
           + S+ +   + W +  ADY +  P++++K+++F     G   P LF  +LG        T
Sbjct: 248 FFSLCYSITATWGSITADYYILFPEDTSKFQVFMLTFLGTVVPTLFVGVLGLCLSTVAAT 307

Query: 324 NPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVLAMSTVANNIPNMYSIALSTQALW 383
              W + Y K+ +GGL  A        GFG+FC VVL +S ++NNI N YS A S Q   
Sbjct: 308 YEPWNDDYNKYGMGGLLHAGFKR--WNGFGKFCVVVLLLSLISNNIINTYSAAFSVQLAS 365

Query: 384 SRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSFMDSIGYYLSIYIVICVTEHFVFR 443
            + A+VPR FW++V     LV A+V    F T + +F+  IGY++S+Y ++ + E+ +FR
Sbjct: 366 VKAAKVPRWFWSIVCMIICLVCALVGRNHFSTILGNFLPMIGYWISMYFILLLEENVIFR 425

Query: 444 KGFR 447
           + F 
Sbjct: 426 EYFH 429

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 32/79 (40%), Gaps = 6/79 (7%)

Query: 439 HFVFRKGF---RGYDVSHWDRPDLLPXXXXXXXXXXXXXXXXXXXXSHEYYTGPIAKL-- 493
           H + R+       Y+ + WD P++L                     +  Y+ GP+A+   
Sbjct: 493 HLLKRRHLATSHKYNWNKWDDPEVLTHGYAATFAFLCGVAGVVVGMAQAYWIGPLARKFG 552

Query: 494 -AGGDIGFLLAAGFSFIVY 511
             GGDI   L+  FS +VY
Sbjct: 553 ETGGDIAMWLSMAFSGLVY 571

>KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, hypothetical start
          Length = 523

 Score =  172 bits (436), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 128/510 (25%), Positives = 229/510 (44%), Gaps = 45/510 (8%)

Query: 43  QVDETEYTTL----SWVNRWAARLNA---ETKGVSPVTEDECHDS-SLLNAASMWFSANL 94
           +V+ TE +      S + +++ +L+A   E +G+  +   E   +    + A +W SA  
Sbjct: 5   EVEVTERSIFVRSASSIRQFSDKLDALGVEARGIQRIQPYERGTAKQFWHVAGLWLSAAG 64

Query: 95  VIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMGVLAVAFFSVFGAEFGLRQMILSRYLMG 154
            +++ +   L   VF+L   + +++ ++  ++G    A+ SV G + G RQ++ +RYL G
Sbjct: 65  GLSSMSSYFLGPMVFQLTFNQCLVSGLISMWIGCGVAAYCSVMGPQSGCRQIVTARYLFG 124

Query: 155 NTTARIFCLINVIACVGWSSVNTIASTTLLHMINPTGARCPPWAASLIIVLSTVFITFFG 214
               +   L  ++  +GWS VN +    +L  +  +  + P W   +I+ + ++ ++ FG
Sbjct: 125 WWFVKFIALAAIVGVMGWSIVNCVVGGQMLASV--SDGKVPLWVGIIIVTVVSLLVSIFG 182

Query: 215 YRVIHAYEKWSWVPNLVVFLIIIARLAIAGNFT---AGSSLGGKATAGSFLSYGSVVFGF 271
            + +   E    VP L  FL++    +    +    + S +      G +LS+ S+ +  
Sbjct: 183 IKQVLKVETLFAVPVLTSFLLLYISASDKFKYLYEFSNSDIDSLTVKGCWLSFFSLCYSI 242

Query: 272 ASGWTTYAADYTVYMPKNSNKYRIFFFMIAGLATPLLFTLILGAAAGRCVHTNPTWGEYY 331
            S W +  ADY +  P+++ + ++F     G A P  F  +LG     C  +   W   Y
Sbjct: 243 TSTWGSITADYYILFPEDTPQIQVFLLTFFGTAVPTTFVGVLGLLLASCSLSYEPWQAAY 302

Query: 332 KKHSVGGLCFAILAENALGGFGQFCCVVLAMSTVANNIPNMYSIALSTQALWSRFARVPR 391
            ++ +GGL  A  +     GFG+F  VVL +S ++NNI N YS A S Q      A+VPR
Sbjct: 303 DEYGMGGLMNAGFSR--WNGFGKFLVVVLILSLISNNIVNTYSAAFSIQLSSVMLAKVPR 360

Query: 392 VFWTLVGNACSLVIAIVAYYKFETFMTSFMDSIGYYLSIYIVICVTEHFVFRKGFRG--- 448
             W +      LV A+V    F T + +F+  IGY++S+Y ++ V E+ +FR  F     
Sbjct: 361 WIWAIGCTIFYLVCALVGRNSFSTILGNFLPMIGYWISMYFILLVEENVIFRNWFHHLYK 420

Query: 449 ------------------------YDVSHWDRPDLLPXXXXXXXXXXXXXXXXXXXXSHE 484
                                   Y+   WD  +++                        
Sbjct: 421 LEFPNDIEVKPHHKLRKLPRHIHRYNWDEWDNSEVITRGLAASAAFCIGVAGVVLGMCQT 480

Query: 485 YYTGPIA-KLA--GGDIGFLLAAGFSFIVY 511
           YY GP+A K+   GGD+G  L  GF+ + Y
Sbjct: 481 YYVGPLAAKIGEYGGDLGMWLGMGFAGVSY 510

>YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of the
           purine/cytosine permease family of membrane transporters
           [1740 bp, 579 aa]
          Length = 579

 Score =  167 bits (424), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 113/412 (27%), Positives = 203/412 (49%), Gaps = 10/412 (2%)

Query: 41  TPQVDETEYTTLSWVNRWAARLNAETKGVSPVT--EDECHDSSLLNAASMWFSANLVIAA 98
           +P +        +W+++    +  E+ G+  ++  E        L+ A +W SA   +++
Sbjct: 45  SPSILRRIINRAAWLSKKVDAMGVESTGIQRISPYERGTSKKQFLHVAGLWLSATGGLSS 104

Query: 99  FAVGVLSTAVFRLNMLEAVLATVVFSFMGVLAVAFFSVFGAEFGLRQMILSRYLMGNTTA 158
            +  +L   +F L+  E+V ++++   +G L  A+ S+ G + G RQM+ +RYL G    
Sbjct: 105 MSSFLLGPLLFGLSFRESVASSLISVTIGCLIAAYCSIMGPQSGCRQMVTARYLFGWWFV 164

Query: 159 RIFCLINVIACVGWSSVNTIASTTLLHMINPTGARCPPWAASLIIVLSTVFITFFGYRVI 218
           ++  L ++I  +GWS VN++    +L  I  +  + P W   +I+ + +  +  FG + +
Sbjct: 165 KLVALASIIGVMGWSVVNSVVGGEMLAAI--SNDKVPLWVGIVIVTVCSFLVAIFGIKQV 222

Query: 219 HAYEKWSWVPNLVVFLIII----ARLAIAGNFTAGSSLGGKATAGSFLSYGSVVFGFASG 274
              E +  VP L  FL++      + +    + +  +L      G+++S+ S+ +   + 
Sbjct: 223 IKVETYLSVPVLTAFLLLYISSSDKYSFVNAYVSKGNLDSSTRKGNWMSFFSLCYSITAT 282

Query: 275 WTTYAADYTVYMPKNSNKYRIFFFMIAGLATPLLFTLILGAAAGRCVHTNPTWGEYYKKH 334
           W +  ADY +  P+++   +IF     G   P  F  ILG        +   W   Y  H
Sbjct: 283 WGSITADYYILFPEDTPYIQIFCLTFFGTFLPTCFVGILGLLLASVAMSYKPWSVEYDSH 342

Query: 335 SVGGLCFAILAENALGGFGQFCCVVLAMSTVANNIPNMYSIALSTQALWSRFARVPRVFW 394
            +GGL +A        GFG+FC VVL  S V+NNI N YS A S Q      A++PR FW
Sbjct: 343 GMGGLLWA--GFQRWNGFGKFCVVVLVFSLVSNNIINTYSAAFSIQLSSVFCAKIPRWFW 400

Query: 395 TLVGNACSLVIAIVAYYKFETFMTSFMDSIGYYLSIYIVICVTEHFVFRKGF 446
           ++V     LV A++    F T + +F+  IGY++S+Y ++   E+ VFR+ F
Sbjct: 401 SIVCTIICLVCALIGRNHFSTILGNFLPMIGYWISMYFILLFEENLVFRRFF 452

>CAGL0M13101g 1286561..1287586 similar to sp|P35735 Saccharomyces
           cerevisiae YKL051w, hypothetical start
          Length = 341

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 58/145 (40%), Gaps = 24/145 (16%)

Query: 56  NRWAARLNAETKGVSPVTEDECHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLE 115
           N  +  + AE   VS  TE   H   L+         NL+ A+F +G +        ++ 
Sbjct: 95  NSKSPHVEAEYDNVSSYTERLLHSRLLMPPYYTKHERNLIFASFVLGCIGEIAL---LMC 151

Query: 116 AVLATVVFSFMGVLAVAFFSVFGAEFGLRQMILSRYLMGNTTARIFCLINVIACVG--WS 173
           ++ +T  +  + +  VA F +F        M+LS          I CL      +G  ++
Sbjct: 152 SIFSTAKYHHVHISMVAIFCIF--------MLLS----------IVCLTAEYFSMGRHYA 193

Query: 174 SVNTIASTTL-LHMINPTGARCPPW 197
           S++ +A+T       NPT     PW
Sbjct: 194 SIHPLAATKADFDPSNPTNIDSLPW 218

>CAGL0G04411g complement(415927..421239) similar to sp|P42945
            Saccharomyces cerevisiae YJL109c, start by similarity
          Length = 1770

 Score = 29.6 bits (65), Expect = 7.1,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 5/93 (5%)

Query: 44   VDETEYTTLSWVNRWAARLNAETKGVSPVTEDECHDSSLLNAASMWFSANLVIAAF--AV 101
            VD+ E T  S V+    ++  E   V+ V  +    SSL+N    +F  NL++     A 
Sbjct: 1283 VDDHELTQ-SVVHTLNEKIPQEENNVAQVLLN--LQSSLINKYGSFFDNNLLVEVLNLAS 1339

Query: 102  GVLSTAVFRLNMLEAVLATVVFSFMGVLAVAFF 134
            G++ST    L +    + T   S MGV  ++F+
Sbjct: 1340 GLISTGPRELQISSIAVITNCVSVMGVKFISFY 1372

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.138    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,824,604
Number of extensions: 574523
Number of successful extensions: 1938
Number of sequences better than 10.0: 28
Number of HSP's gapped: 1942
Number of HSP's successfully gapped: 30
Length of query: 514
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 408
Effective length of database: 12,926,601
Effective search space: 5274053208
Effective search space used: 5274053208
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 64 (29.3 bits)