Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL073W27727214480.0
Sklu_1893.32812634832e-59
YIL049W (DFG10)2532424742e-58
Scas_704.372512424654e-57
CAGL0L00693g2492364645e-57
Kwal_23.58252432434523e-55
KLLA0C08261g2332324289e-52
Sklu_2435.1970686700.67
CAGL0G08448g58086627.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL073W
         (272 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL073W [1668] [Homologous to ScYIL049W (DFG10) - SH] complement...   562   0.0  
Sklu_1893.3 YIL049W, Contig c1893 3492-4337                           190   2e-59
YIL049W (DFG10) [2618] chr9 (260157..260918) Protein involved in...   187   2e-58
Scas_704.37                                                           183   4e-57
CAGL0L00693g 85333..86082 similar to sp|P40526 Saccharomyces cer...   183   5e-57
Kwal_23.5825                                                          178   3e-55
KLLA0C08261g complement(724399..725100) similar to sp|P40526 Sac...   169   9e-52
Sklu_2435.19 YPR141C, Contig c2435 30850-32970 reverse complement      32   0.67 
CAGL0G08448g complement(797481..799223) highly similar to sp|Q05...    28   7.3  

>ADL073W [1668] [Homologous to ScYIL049W (DFG10) - SH]
           complement(553708..554541) [834 bp, 277 aa]
          Length = 277

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/272 (100%), Positives = 272/272 (100%)

Query: 1   MQRNPRYNSQHMNQMLPPIAAGGAEVYVWHLIHFSYGIGLFSLWLAKYRLPKLLQYGKTR 60
           MQRNPRYNSQHMNQMLPPIAAGGAEVYVWHLIHFSYGIGLFSLWLAKYRLPKLLQYGKTR
Sbjct: 1   MQRNPRYNSQHMNQMLPPIAAGGAEVYVWHLIHFSYGIGLFSLWLAKYRLPKLLQYGKTR 60

Query: 61  QKKLVGVIEPWYTSIAVPRRYFSHFYVLSFVLATANLYWFPEDVITSCIFFHSLRRLVES 120
           QKKLVGVIEPWYTSIAVPRRYFSHFYVLSFVLATANLYWFPEDVITSCIFFHSLRRLVES
Sbjct: 61  QKKLVGVIEPWYTSIAVPRRYFSHFYVLSFVLATANLYWFPEDVITSCIFFHSLRRLVES 120

Query: 121 ARVTKWGSESRMHAAHYLVGLWFYSVLNLSVYLQLNSRQRTRSPSTVNKVFGAVGAVGFL 180
           ARVTKWGSESRMHAAHYLVGLWFYSVLNLSVYLQLNSRQRTRSPSTVNKVFGAVGAVGFL
Sbjct: 121 ARVTKWGSESRMHAAHYLVGLWFYSVLNLSVYLQLNSRQRTRSPSTVNKVFGAVGAVGFL 180

Query: 181 LASWDQARNHIHLAHMIKYTLPRRGLFKIVACAHYFDEIVIYASLAAMEATTRWSLTVAV 240
           LASWDQARNHIHLAHMIKYTLPRRGLFKIVACAHYFDEIVIYASLAAMEATTRWSLTVAV
Sbjct: 181 LASWDQARNHIHLAHMIKYTLPRRGLFKIVACAHYFDEIVIYASLAAMEATTRWSLTVAV 240

Query: 241 IWVCANLGVSAVETKRYYDAKFKGQAVAPYAL 272
           IWVCANLGVSAVETKRYYDAKFKGQAVAPYAL
Sbjct: 241 IWVCANLGVSAVETKRYYDAKFKGQAVAPYAL 272

>Sklu_1893.3 YIL049W, Contig c1893 3492-4337
          Length = 281

 Score =  190 bits (483), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 104/263 (39%), Positives = 163/263 (61%), Gaps = 24/263 (9%)

Query: 31  LIHFSYGIGLFSLWLAKYRLPKLLQYGKT--------------RQKKLVGVIE--PWYTS 74
           LI  S+ + +  + LAK++L   L+YGKT               ++++  V++   ++ S
Sbjct: 17  LIDASFVVAISCVLLAKWKLTGFLKYGKTLLSVDDKKHDGNEKEKREMTNVLQILDFFES 76

Query: 75  IAVPRRYFSHFYVLSFVLATANLYWFPEDVITSCIFFHSLRRLVESARVTKWGSESRMHA 134
           I VPR +FSHFY++S   +  N  W+P  +I     FHSLRRL ES  ++K+G+ES+M+ 
Sbjct: 77  IVVPRAWFSHFYIISTFFSLVNGIWYPGHLIAWLPLFHSLRRLYESYCISKFGAESKMNI 136

Query: 135 AHYLVGLWFYSVLNLSVYLQLNSRQRTRSPSTVNKVFGAVGAVGFLLASWDQARNHIHLA 194
           +HYLVG+WFY+ LNL   + L+   +  S S+ N  F  +    FL +S++Q +NH++L+
Sbjct: 137 SHYLVGIWFYTSLNLIFSIGLSKDNKITSLSS-NSAFQLIALFVFLASSYNQYQNHVYLS 195

Query: 195 HMIKYTLPRRGLFKIVACAHYFDEIVIYASLAAMEATTRW-----SLTVAVIWVCANLGV 249
            ++KYT P++GLFK V+CAHYFDEI+IY+SL      +R+      L   ++WV  NL V
Sbjct: 196 QLVKYTNPKKGLFKWVSCAHYFDEILIYSSLFGYARVSRYGYLADGLKYCLLWVGINLSV 255

Query: 250 SAVETKRYYDAKFKGQAVAPYAL 272
           SA+ET+ YY  ++  Q VAP+A+
Sbjct: 256 SAIETRNYYSHRY--QDVAPHAI 276

>YIL049W (DFG10) [2618] chr9 (260157..260918) Protein involved in
           filamentous growth, cell polarity, and cellular
           elongation [762 bp, 253 aa]
          Length = 253

 Score =  187 bits (474), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 149/242 (61%), Gaps = 16/242 (6%)

Query: 35  SYGIGLFSLWLAKYRLPKLLQYGKT----RQKKLVGVIEPWYTSIAVPRRYFSHFYVLSF 90
           S+ +G+ SL++AK  LP+ LQYGKT       K   ++E       VP+ YFSHFY L+ 
Sbjct: 19  SFFVGICSLFIAKSCLPEFLQYGKTYRPKENSKYSSILER-IKKFTVPKAYFSHFYYLAT 77

Query: 91  VLATANLYWFPEDVITSCIFFHSLRRLVESARVTKWGSESRMHAAHYLVGLWFYSVLNLS 150
            L+   LY++P+  I   IF HSLRRL E+  V  + S SRM+ +HYLVG+WFYSVL L 
Sbjct: 78  FLSLVTLYFYPKFPIVWIIFGHSLRRLYETLYVLHYTSNSRMNWSHYLVGIWFYSVLLLI 137

Query: 151 VYLQLNSRQRTRSPSTVNKVFGAVGAVGFLLASWDQARNHIHLAHMIKYTLPRRGLFKIV 210
           + + L    +   P+T+N        + F +ASWDQ +NH+ LA+++KY+LP   LF++V
Sbjct: 138 LNISL---YKNSIPNTLN----MNAFIIFCIASWDQYKNHVILANLVKYSLPTGRLFRLV 190

Query: 211 ACAHYFDEIVIYASLAAMEATTRWSLTVAVIWVCANLGVSAVETKRYYDAKFKGQAVAPY 270
            C HY DEI+IY++L   E        + ++WV  +L +SA+ETK YY  KFK   VAPY
Sbjct: 191 CCPHYLDEIIIYSTLLPYEQ----EFYLTLVWVITSLTISALETKNYYRHKFKDNHVAPY 246

Query: 271 AL 272
           A+
Sbjct: 247 AI 248

>Scas_704.37
          Length = 251

 Score =  183 bits (465), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 150/242 (61%), Gaps = 16/242 (6%)

Query: 35  SYGIGLFSLWLAKYRLPKLLQYGKTRQKKLVGVIEPWYTSI---AVPRRYFSHFYVLSFV 91
           S+ +GL SL +AK+ LP  LQYGKT      G +   +  I    VP+ YFSHFY LS +
Sbjct: 17  SFFLGLLSLAIAKFYLPDFLQYGKTLNTAQSGDVMTLWDKIIHFTVPKSYFSHFYYLSAI 76

Query: 92  LATANLYWFPEDVITSCIFFHSLRRLVESARVTKWGSESRMHAAHYLVGLWFYSVLNLSV 151
           L+ + LY +P+  +   + FHSLRRL E+  V K+ S+SRM+ +HY+VG+WFY+VL+L +
Sbjct: 77  LSVSTLYVYPKYPVVWLLAFHSLRRLYETLFVCKYTSKSRMNWSHYVVGIWFYTVLHLIL 136

Query: 152 YLQLNSRQRTRSPSTVNKVFGAVGAVGFL-LASWDQARNHIHLAHMIKYTLPRRGLFKIV 210
            + L      R   T+N     + A+  L LASWDQ +NH  LAH+ KY+LP + LFKIV
Sbjct: 137 NICLYFE---RISPTIN-----ISALFILILASWDQYKNHRVLAHLRKYSLPTQRLFKIV 188

Query: 211 ACAHYFDEIVIYASLAAMEATTRWSLTVAVIWVCANLGVSAVETKRYYDAKFKGQAVAPY 270
            C HY DE++IY++  +  A   W L    IWV  +L +SA+ETK +Y +KF  + V  Y
Sbjct: 189 CCPHYLDEMIIYSTFLSYNAEFIWPL----IWVVVSLSISAIETKNFYKSKFVEENVPDY 244

Query: 271 AL 272
           ++
Sbjct: 245 SI 246

>CAGL0L00693g 85333..86082 similar to sp|P40526 Saccharomyces
           cerevisiae YIL049w DFG10, hypothetical start
          Length = 249

 Score =  183 bits (464), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 102/236 (43%), Positives = 146/236 (61%), Gaps = 15/236 (6%)

Query: 38  IGLFSLWLAKYRLPKLLQYGKTRQKKLVGVIEPW--YTSIAVPRRYFSHFYVLSFVLATA 95
           +GL SL +AKY LP  L+YGKT      G    W    + +VP+ YF+HFY+LS VLA  
Sbjct: 21  VGLMSLIIAKYYLPDFLRYGKTFTFAKNGNENIWDKIKNFSVPKSYFAHFYILSSVLALV 80

Query: 96  NLYWFPEDVITSCIFFHSLRRLVESARVTKWGSESRMHAAHYLVGLWFYSVLNLSVYLQL 155
            L  +P D++   +F HS RRL E+  ++K+  +S+M+ +HY VGLWFYS LN+ VYL++
Sbjct: 81  TLASYPTDILVWQLFLHSSRRLYETLYISKYTEKSKMNWSHYAVGLWFYSQLNILVYLRV 140

Query: 156 NSRQRTRSPSTVNKVFGAVGAVGFLLASWDQARNHIHLAHMIKYTLPRRGLFKIVACAHY 215
              QR  + + V  +   V      LASWDQ +NH+ L+ + KY+LPR  LF++V C HY
Sbjct: 141 ---QRENTTARVLPILVMV------LASWDQYKNHVVLSKLKKYSLPRSRLFELVCCPHY 191

Query: 216 FDEIVIYASLAAMEATTRWSLTVAVIWVCANLGVSAVETKRYYDAKFKGQAVAPYA 271
            DE++IY SL +      W L    IWV A+L +SA+E++++Y +KFK   V  YA
Sbjct: 192 LDEMIIYGSLVSYGHEFVWPL----IWVIASLSISALESRKFYLSKFKDTEVPRYA 243

>Kwal_23.5825
          Length = 243

 Score =  178 bits (452), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 103/243 (42%), Positives = 149/243 (61%), Gaps = 21/243 (8%)

Query: 35  SYGIGLFSLWLAKYRLPKLLQYGKT-----RQKKLVGVIEPWYTSIAVPRRYFSHFYVLS 89
           S+ +G+ S+ LAK++LP LL+YGKT      QK L+G  E     + VP+++F+HFYV S
Sbjct: 12  SFLVGIASVHLAKWQLPALLKYGKTLEGSRTQKGLLGFFE----QLTVPKQWFTHFYVYS 67

Query: 90  FVLATANLYWFPEDVITSCIFFHSLRRLVESARVTKWGSESRMHAAHYLVGLWFYSVLNL 149
             LA  N+Y    ++++     HS RRL E+  VTK+G  SRMH +HYLVGLWFYSV N 
Sbjct: 68  TTLAILNVYC-QRNLVSLLFLIHSGRRLYETQCVTKYGENSRMHLSHYLVGLWFYSVANW 126

Query: 150 SVYLQLNSRQRTRSPSTVNKVFGAVGAVGFLLASWDQARNHIHLAHMIKYTLPRRGLFKI 209
           +V+    S+ R++ P     +   +  + F L+S DQ  NH+HL+ ++KYT+P  GLF I
Sbjct: 127 AVF---ESKSRSQLP-----LVRFLAVLVFALSSVDQYMNHLHLSKLVKYTMPTYGLFSI 178

Query: 210 VACAHYFDEIVIYASLAAMEATTRWSLTVAVIWVCANLGVSAVETKRYYDAKFKGQAVAP 269
               HYFDE+++Y SL A   + +  L   ++WV  NL  SA+ET+ +Y  KF  Q   P
Sbjct: 179 TTSPHYFDEVLLYLSLTAYTGSLK--LFACLVWVIVNLSTSALETRAWYLKKFP-QTTPP 235

Query: 270 YAL 272
           YA+
Sbjct: 236 YAI 238

>KLLA0C08261g complement(724399..725100) similar to sp|P40526
           Saccharomyces cerevisiae YIL049w DFG10 singleton, start
           by similarity
          Length = 233

 Score =  169 bits (428), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 140/232 (60%), Gaps = 18/232 (7%)

Query: 31  LIHFSYGIGLFSLWLAKYRLPKLLQYGKTRQKKLVGVIEPWYTSIAVPRRYFSHFYVLSF 90
           L++ ++ +G+ S+++A++ +P+LL+YGKT +         WY S+  P+  F HFY+LS 
Sbjct: 7   LLYSTFYVGIISVFVAEFYIPQLLKYGKTWEAS----NNFWY-SLTCPKSNFGHFYLLSS 61

Query: 91  VLATANLYWFPEDVITSCIFFHSLRRLVESARVTKWGSESRMHAAHYLVGLWFYSVLNLS 150
           + +  NL W    ++T  +F HS+RRL E   VTKWG +S++H +HYLVG+WFY+ LNL 
Sbjct: 62  IFSIYNLLWI-RSLLTLSVFIHSVRRLYECYCVTKWG-QSKIHLSHYLVGIWFYTTLNLG 119

Query: 151 VYLQLNSRQRTRSPSTVNKVFGAVGAVGFLLASWDQARNHIHLAHMIKYTLPRRGLFKIV 210
           + L     Q           +  +  + F+++S DQA NH +L+ + KY+ P  GLFK +
Sbjct: 120 IMLYHGETQ-----------YSLISVILFIMSSLDQATNHDYLSKLKKYSQPSYGLFKYI 168

Query: 211 ACAHYFDEIVIYASLAAMEATTRWSLTVAVIWVCANLGVSAVETKRYYDAKF 262
             AHYFDE++IY S   M+  +R  L   ++W+  NLG S+ ET  +Y  KF
Sbjct: 169 CSAHYFDELLIYTSFMLMDKGSRMLLIHCILWILVNLGTSSFETGNWYQEKF 220

>Sklu_2435.19 YPR141C, Contig c2435 30850-32970 reverse complement
          Length = 706

 Score = 31.6 bits (70), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 9/86 (10%)

Query: 159 QRTRSPSTVNKVFGAVGAVGFLLASWDQARNHI-----HLAHMIKYTL---PRRGLF-KI 209
            R R    +NK    +G V   LAS D ++ HI      L ++++Y+L    +  +F  I
Sbjct: 618 DRLRETQNINKSLSCLGDVIHALASPDASKRHIPFRNSKLTYLLQYSLLGDSKTLMFVNI 677

Query: 210 VACAHYFDEIVIYASLAAMEATTRWS 235
             C  +F+E +     A+   +TR +
Sbjct: 678 SPCLDHFNETLNSLRFASKVNSTRMT 703

>CAGL0G08448g complement(797481..799223) highly similar to sp|Q05998
           Saccharomyces cerevisiae YLR237w THI7 thiamin transport
           protein, hypothetical start
          Length = 580

 Score = 28.5 bits (62), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 14/86 (16%)

Query: 104 VITSCIFFHSLRRLVESARVTKWGSESRMHAAHYLVGLWFYSV----LNLSVY------- 152
           VI  C   H + +L  S++ T  GS +R  A  Y++  WF SV    +N S Y       
Sbjct: 210 VIYLCKENHGVGQLFTSSKTTATGS-ARAWAWVYMISYWFGSVSPGSVNQSDYSRFGSSL 268

Query: 153 --LQLNSRQRTRSPSTVNKVFGAVGA 176
             + L +      P+T+  V+GA+GA
Sbjct: 269 TGIYLGTIAGLLIPTTLVPVYGAIGA 294

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.137    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,374,435
Number of extensions: 318658
Number of successful extensions: 827
Number of sequences better than 10.0: 9
Number of HSP's gapped: 820
Number of HSP's successfully gapped: 9
Length of query: 272
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 172
Effective length of database: 13,134,309
Effective search space: 2259101148
Effective search space used: 2259101148
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 61 (28.1 bits)