Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL069W2052017521e-102
KLLA0C08195g243682504e-26
Kwal_23.58351571672122e-21
YER063W (THO1)218581882e-17
Scas_704.31*222671631e-13
CAGL0J02992g230581271e-08
CAGL0J03586g41131614.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL069W
         (201 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL069W [1672] [Homologous to ScYER063W (THO1) - SH] complement(...   294   e-102
KLLA0C08195g complement(719857..720588) some similarities with s...   100   4e-26
Kwal_23.5835                                                           86   2e-21
YER063W (THO1) [1494] chr5 (281708..282364) Protein that suppres...    77   2e-17
Scas_704.31*                                                           67   1e-13
CAGL0J02992g 286008..286700 similar to sp|P40040 Saccharomyces c...    54   1e-08
CAGL0J03586g complement(341290..342525) similar to sp|P10862 Sac...    28   4.7  

>ADL069W [1672] [Homologous to ScYER063W (THO1) - SH]
           complement(558299..558916) [618 bp, 205 aa]
          Length = 205

 Score =  294 bits (752), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 153/201 (76%)

Query: 1   MDIDHVASAARKAGATDATGWPWLANRQSHDEMTDYASMTVAQLKDVLKERELPTQGLKA 60
           MDIDHVASAARKAGATDATGWPWLANRQSHDEMTDYASMTVAQLKDVLKERELPTQGLKA
Sbjct: 1   MDIDHVASAARKAGATDATGWPWLANRQSHDEMTDYASMTVAQLKDVLKERELPTQGLKA 60

Query: 61  ALVERLQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLSP 120
           ALVERLQQ                                                TLSP
Sbjct: 61  ALVERLQQADATAAEPTDATTRPAAEEHTPEAAEPAATPAEAEAPVAEQRAAAEPRTLSP 120

Query: 121 EEMKQAAVAHLSKKLHRARKFGEDDAAVGALQKQLARLEKFGLDLTTQLAQELGFGRGPA 180
           EEMKQAAVAHLSKKLHRARKFGEDDAAVGALQKQLARLEKFGLDLTTQLAQELGFGRGPA
Sbjct: 121 EEMKQAAVAHLSKKLHRARKFGEDDAAVGALQKQLARLEKFGLDLTTQLAQELGFGRGPA 180

Query: 181 AAVGKHAFHRRRGYHQGKKFK 201
           AAVGKHAFHRRRGYHQGKKFK
Sbjct: 181 AAVGKHAFHRRRGYHQGKKFK 201

>KLLA0C08195g complement(719857..720588) some similarities with
           sp|P40040 Saccharomyces cerevisiae YER063w THO1
           singleton, hypothetical start
          Length = 243

 Score =  100 bits (250), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 44/68 (64%), Positives = 59/68 (86%)

Query: 118 LSPEEMKQAAVAHLSKKLHRARKFGEDDAAVGALQKQLARLEKFGLDLTTQLAQELGFGR 177
           LS +++KQAA+ HL KK++RA KFG+DD+ +  LQ+Q+ R+EKFGLDL+TQLA+ELGFG+
Sbjct: 157 LSQDQLKQAAIDHLQKKIYRAEKFGQDDSTIDDLQRQINRIEKFGLDLSTQLAKELGFGK 216

Query: 178 GPAAAVGK 185
           GP AAVGK
Sbjct: 217 GPDAAVGK 224

 Score = 42.7 bits (99), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/32 (62%), Positives = 25/32 (78%)

Query: 36 YASMTVAQLKDVLKERELPTQGLKAALVERLQ 67
          Y+  TVAQLK++LK+R L T GLKA L+ RLQ
Sbjct: 48 YSGNTVAQLKELLKQRNLSTDGLKADLINRLQ 79

>Kwal_23.5835
          Length = 157

 Score = 86.3 bits (212), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/167 (32%), Positives = 79/167 (47%), Gaps = 19/167 (11%)

Query: 33  MTDYASMTVAQLKDVLKERELPTQGLKAALVERLQQXXXXXXXXXXXXXXXXXXXXXXXX 92
            T YA  TV QL++ L+ R+L + G K+ LVERL+                         
Sbjct: 4   TTKYAEQTVEQLQNELQSRQLDSDGEKSQLVERLE------------------ADDAKKG 45

Query: 93  XXXXXXXXXXXXXXXXXXXXXXXXTLSPEEMKQA-AVAHLSKKLHRARKFGEDDAAVGAL 151
                                   + +P++  QA A+AHL +KL RA+KF +D A +  L
Sbjct: 46  QQNSDASGAAEPSKSETPEKAAEISPAPQKDPQALAIAHLERKLRRAKKFADDQATLDYL 105

Query: 152 QKQLARLEKFGLDLTTQLAQELGFGRGPAAAVGKHAFHRRRGYHQGK 198
           ++Q+AR+ KFGLD TT+LA+ELG G+GP  AV   +   R      K
Sbjct: 106 ERQIARVRKFGLDTTTELARELGLGKGPETAVPTRSVRSRTARKSNK 152

>YER063W (THO1) [1494] chr5 (281708..282364) Protein that suppresses
           the transcriptional defects of hpr1 null mutant upon
           overproduction [657 bp, 218 aa]
          Length = 218

 Score = 77.0 bits (188), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 34/58 (58%), Positives = 47/58 (81%)

Query: 118 LSPEEMKQAAVAHLSKKLHRARKFGEDDAAVGALQKQLARLEKFGLDLTTQLAQELGF 175
           LSPEE+K  A+  L+KKLHRA KFG+D A + +LQ+Q+ R+EKFG+DL ++LA+ELG 
Sbjct: 120 LSPEEIKAKALDLLNKKLHRANKFGQDQADIDSLQRQINRVEKFGVDLNSKLAEELGL 177

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/34 (58%), Positives = 25/34 (73%)

Query: 33 MTDYASMTVAQLKDVLKERELPTQGLKAALVERL 66
          M DY+S+TV QLKD+L +R L   GLK  LV+RL
Sbjct: 1  MADYSSLTVVQLKDLLTKRNLSVGGLKNELVQRL 34

>Scas_704.31*
          Length = 222

 Score = 67.4 bits (163), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%)

Query: 118 LSPEEMKQAAVAHLSKKLHRARKFGEDDAAVGALQKQLARLEKFGLDLTTQLAQELGFGR 177
           L+ EEMK  A+  L+KK+HRA+KF  + +++  L++ + R+EKFGLDL + LA ELG   
Sbjct: 117 LTQEEMKTMALELLNKKIHRAKKFAAEQSSIDELERMITRIEKFGLDLNSTLAVELGLAP 176

Query: 178 GPAAAVG 184
            P A  G
Sbjct: 177 KPKAKTG 183

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/34 (61%), Positives = 28/34 (82%)

Query: 33 MTDYASMTVAQLKDVLKERELPTQGLKAALVERL 66
          MT+Y+ +TVAQLK++L +R LP +GLK  LVERL
Sbjct: 1  MTEYSKLTVAQLKELLTQRSLPLEGLKKDLVERL 34

>CAGL0J02992g 286008..286700 similar to sp|P40040 Saccharomyces
           cerevisiae YER063w THO1, start by similarity
          Length = 230

 Score = 53.5 bits (127), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (65%)

Query: 118 LSPEEMKQAAVAHLSKKLHRARKFGEDDAAVGALQKQLARLEKFGLDLTTQLAQELGF 175
           L+ EE+KQ A   + KKLHRA+KFG +   + +L+K   R+++FG+D    +A ELG 
Sbjct: 130 LTAEEIKQRATELIDKKLHRAKKFGAEQDQIDSLEKLKVRIDRFGVDRNMSIALELGL 187

 Score = 43.1 bits (100), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 26/34 (76%)

Query: 33 MTDYASMTVAQLKDVLKERELPTQGLKAALVERL 66
          M++Y+++TV QLK++L ER L   GLK  LVERL
Sbjct: 1  MSNYSALTVVQLKELLTERNLSVAGLKNQLVERL 34

>CAGL0J03586g complement(341290..342525) similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein, hypothetical start
          Length = 411

 Score = 28.1 bits (61), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 35  DYASMTVAQLKDVLKERELPTQGLKAALVER 65
           ++A MT +QLK  L    LP  G +A +V R
Sbjct: 255 NFAKMTTSQLKQKLASLSLPVSGTRANMVAR 285

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.129    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,316,675
Number of extensions: 123599
Number of successful extensions: 393
Number of sequences better than 10.0: 12
Number of HSP's gapped: 390
Number of HSP's successfully gapped: 18
Length of query: 201
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 104
Effective length of database: 13,238,163
Effective search space: 1376768952
Effective search space used: 1376768952
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)