Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL042W28127612531e-176
KLLA0F20636g285712042e-18
ADR308C278701927e-17
Scas_602.4d256611784e-15
ADL051W173581711e-14
Scas_707.463381741771e-14
KLLA0A04609g423561791e-14
Sklu_2398.2288501743e-14
YPR015C247491705e-14
Scas_718.36d330551735e-14
YPR013C317491727e-14
AEL077W336611701e-13
Kwal_14.2206254701653e-13
CAGL0J01595g344491673e-13
CAGL0L05786g348491673e-13
CAGL0M01870g315501664e-13
KLLA0F11682g374491674e-13
Sklu_2244.3271491611e-12
Scas_656.1*102561521e-12
ADL050W146531523e-12
ADL040W330551593e-12
AGL207W277481574e-12
Scas_710.9505661552e-11
Kwal_26.8011190491492e-11
Scas_602.4266491494e-11
KLLA0F22319g203461431e-10
AGR186C287501452e-10
Kwal_27.10467302501433e-10
Scas_717.17d350631382e-09
ACR264W769481251e-07
Scas_717.18354681222e-07
Kwal_47.19045266491203e-07
Kwal_47.17888786471223e-07
KLLA0F23782g782471205e-07
YOR113W (AZF1)914491171e-06
Scas_713.52620501171e-06
CAGL0E01331g689461171e-06
CAGL0A01628g424501143e-06
AGL197W844461143e-06
AFR471C389651124e-06
KLLA0A10373g206471095e-06
YDR146C (SWI5)709461126e-06
Sklu_2351.6548501108e-06
Kwal_56.23925745461109e-06
YJL056C (ZAP1)880851109e-06
Scas_697.35839481109e-06
Scas_575.3455771091e-05
Kwal_14.2278463501091e-05
KLLA0B00605g239501071e-05
Scas_717.17525631091e-05
Scas_711.56832491091e-05
CAGL0M06831g645481081e-05
Kwal_26.8021507491072e-05
CAGL0M04323g703461063e-05
Sklu_2389.2767491063e-05
CAGL0K12078g463501054e-05
Scas_712.42*290491034e-05
CAGL0L03916g642471045e-05
AEL174W661491045e-05
YGL035C (MIG1)504501036e-05
Kwal_27.11460531601037e-05
AGL071C396491027e-05
YNL027W (CRZ1)678701037e-05
YGL209W (MIG2)382711028e-05
Scas_709.32822861028e-05
YER028C394491011e-04
Scas_721.921152511021e-04
KLLA0E10989g474501011e-04
AGR031W14055961e-04
YLR131C (ACE2)770441011e-04
Kwal_26.8351698791001e-04
KLLA0D16456g854461002e-04
Kwal_27.1016728541982e-04
Kwal_23.540042953992e-04
ABR089C57170982e-04
KLLA0F01463g78149983e-04
Scas_712.232737973e-04
Kwal_27.1092526450963e-04
CAGL0K09372g39649973e-04
KLLA0F18524g35750973e-04
YDR043C (NRG1)23150953e-04
Scas_693.3163546974e-04
CAGL0I02816g29150946e-04
CAGL0C02519g31849947e-04
KLLA0B03454g47247948e-04
YGL254W (FZF1)29935938e-04
CAGL0F05995g59750949e-04
Sklu_2289.129144930.001
Sklu_2357.715750900.001
Sklu_2181.141050930.001
KLLA0E18645g43149930.001
Scas_718.4426650920.001
CAGL0L07480g31450920.001
KLLA0F26961g69475930.001
CAGL0J05060g71385930.001
Scas_695.257169930.001
YMR070W (MOT3)49049920.002
YMR037C (MSN2)70450920.002
ADL198W54760920.002
Kwal_14.2543711105920.002
KLLA0F13046g137989920.002
YPR186C (PZF1)42953900.002
Scas_569.229365900.002
AGR172W105751900.003
ACL057W52050890.003
YDR216W (ADR1)132351900.003
KLLA0E08679g59639880.004
Scas_378.120849860.004
Scas_649.28730120880.005
Kwal_47.16621117851880.005
CAGL0K02145g31750870.006
CAGL0H07557g47641870.006
CAGL0K03003g64749860.007
KLLA0B04477g133251870.008
Sklu_2443.2221351830.011
YKL062W (MSN4)63058850.012
Scas_687.3328849830.013
YBR066C (NRG2)22050820.015
Scas_631.743346830.015
AEL278W47647820.021
CAGL0M13189g54150820.022
CAGL0E04884g148951820.025
Kwal_47.1724140350810.027
Scas_707.3128951810.027
AER159C119151820.028
CAGL0M00594g102051820.030
YML081W125151810.041
KLLA0C17072g47450800.042
Sklu_2126.544833800.042
CAGL0H04213g132151780.087
CAGL0G10021g39438770.11
KLLA0E00726g51733760.12
Scas_602.954750750.16
CAGL0G08107g62553740.28
Kwal_55.2063441933730.30
YER130C44350730.32
AGR117C79962730.33
YER169W (RPH1)79673730.39
Scas_703.23134151730.40
KLLA0C17710g82152720.47
Scas_551.133266700.59
CAGL0L11880g98052700.89
CAGL0E03762g58447690.89
AFR190C43224690.93
YDR096W (GIS1)89452690.99
AGR365C52250691.0
Kwal_56.2345382852691.1
YJR127C (ZMS1)138051691.1
CAGL0B02651g189106651.9
YHL027W (RIM101)62521662.1
YPL038W (MET31)17760642.1
Kwal_47.1657788150643.8
Scas_683.2587950643.9
Kwal_26.8109970127644.3
AFR580C83850644.7
CAGL0L12562g22347625.3
Scas_681.1986452635.9
KLLA0B07909g92250626.9
CAGL0L06072g30047617.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL042W
         (276 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL042W [1699] [Homologous to ScYPR015C - SH] complement(615818....   487   e-176
KLLA0F20636g complement(1914452..1915309) some similarities with...    83   2e-18
ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,...    79   7e-17
Scas_602.4d                                                            73   4e-15
ADL051W [1690] [Homologous to NOHBY] complement(595496..596017) ...    70   1e-14
Scas_707.46                                                            73   1e-14
KLLA0A04609g complement(411494..412765) some similarities with s...    74   1e-14
Sklu_2398.2 , Contig c2398 2210-3076 reverse complement                72   3e-14
YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protei...    70   5e-14
Scas_718.36d                                                           71   5e-14
YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putati...    71   7e-14
AEL077W [2429] [Homologous to NOHBY] complement(483028..484038) ...    70   1e-13
Kwal_14.2206                                                           68   3e-13
CAGL0J01595g 151584..152618 some similarities with tr|Q12531 Sac...    69   3e-13
CAGL0L05786g complement(636176..637222) some similarities with t...    69   3e-13
CAGL0M01870g complement(219813..220760) some similarities with t...    69   4e-13
KLLA0F11682g complement(1068992..1070116) some similarities with...    69   4e-13
Sklu_2244.3 , Contig c2244 4100-4915 reverse complement                67   1e-12
Scas_656.1*                                                            63   1e-12
ADL050W [1691] [Homologous to NOHBY] complement(597229..597669) ...    63   3e-12
ADL040W [1701] [Homologous to ScYPR013C - SH] complement(618855....    66   3e-12
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    65   4e-12
Scas_710.9                                                             64   2e-11
Kwal_26.8011                                                           62   2e-11
Scas_602.4                                                             62   4e-11
KLLA0F22319g complement(2086613..2087224) some similarities with...    60   1e-10
AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,...    60   2e-10
Kwal_27.10467                                                          60   3e-10
Scas_717.17d                                                           58   2e-09
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    53   1e-07
Scas_717.18                                                            52   2e-07
Kwal_47.19045                                                          51   3e-07
Kwal_47.17888                                                          52   3e-07
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    51   5e-07
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    50   1e-06
Scas_713.52                                                            50   1e-06
CAGL0E01331g 124362..126431 weakly similar to sp|P08153 Saccharo...    50   1e-06
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    49   3e-06
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    49   3e-06
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    48   4e-06
KLLA0A10373g complement(907244..907864) some similarities with c...    47   5e-06
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    48   6e-06
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       47   8e-06
Kwal_56.23925                                                          47   9e-06
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    47   9e-06
Scas_697.35                                                            47   9e-06
Scas_575.3                                                             47   1e-05
Kwal_14.2278                                                           47   1e-05
KLLA0B00605g complement(46736..47455) some similarities with sp|...    46   1e-05
Scas_717.17                                                            47   1e-05
Scas_711.56                                                            47   1e-05
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    46   1e-05
Kwal_26.8021                                                           46   2e-05
CAGL0M04323g complement(474158..476269) similar to sp|P21192 Sac...    45   3e-05
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            45   3e-05
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...    45   4e-05
Scas_712.42*                                                           44   4e-05
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    45   5e-05
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    45   5e-05
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    44   6e-05
Kwal_27.11460                                                          44   7e-05
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    44   7e-05
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    44   7e-05
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    44   8e-05
Scas_709.32                                                            44   8e-05
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    44   1e-04
Scas_721.92                                                            44   1e-04
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    44   1e-04
AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...    42   1e-04
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    44   1e-04
Kwal_26.8351                                                           43   1e-04
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    43   2e-04
Kwal_27.10167                                                          42   2e-04
Kwal_23.5400                                                           43   2e-04
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    42   2e-04
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    42   3e-04
Scas_712.2                                                             42   3e-04
Kwal_27.10925                                                          42   3e-04
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    42   3e-04
KLLA0F18524g complement(1701498..1702571) some similarities with...    42   3e-04
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...    41   3e-04
Scas_693.31                                                            42   4e-04
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    41   6e-04
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    41   7e-04
KLLA0B03454g complement(314015..315433) some similarities with s...    41   8e-04
YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor i...    40   8e-04
CAGL0F05995g complement(598819..600612) some similarities with s...    41   9e-04
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          40   0.001
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement        39   0.001
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            40   0.001
KLLA0E18645g complement(1648263..1649558) some similarities with...    40   0.001
Scas_718.44                                                            40   0.001
CAGL0L07480g complement(822240..823184) some similarities with s...    40   0.001
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    40   0.001
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    40   0.001
Scas_695.2                                                             40   0.001
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    40   0.002
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    40   0.002
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    40   0.002
Kwal_14.2543                                                           40   0.002
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    40   0.002
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    39   0.002
Scas_569.2                                                             39   0.002
AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH] complement(...    39   0.003
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    39   0.003
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    39   0.003
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    39   0.004
Scas_378.1                                                             38   0.004
Scas_649.28                                                            39   0.005
Kwal_47.16621                                                          39   0.005
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    38   0.006
CAGL0H07557g 738086..739516 some similarities with sp|P32805 Sac...    38   0.006
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    38   0.007
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    38   0.008
Sklu_2443.22 , Contig c2443 45390-46027                                37   0.011
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    37   0.012
Scas_687.33                                                            37   0.013
YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor ...    36   0.015
Scas_631.7                                                             37   0.015
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    36   0.021
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    36   0.022
CAGL0E04884g complement(469295..473764) weakly similar to sp|P07...    36   0.025
Kwal_47.17241                                                          36   0.027
Scas_707.31                                                            36   0.027
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    36   0.028
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    36   0.030
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    36   0.041
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    35   0.042
Sklu_2126.5 YHL027W, Contig c2126 7763-9109                            35   0.042
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    35   0.087
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    34   0.11 
KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyce...    34   0.12 
Scas_602.9                                                             33   0.16 
CAGL0G08107g 768772..770649 weakly similar to tr|Q03833 Saccharo...    33   0.28 
Kwal_55.20634                                                          33   0.30 
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    33   0.32 
AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W (...    33   0.33 
YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsiv...    33   0.39 
Scas_703.23                                                            33   0.40 
KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces...    32   0.47 
Scas_551.1                                                             32   0.59 
CAGL0L11880g 1272624..1275566 some similarities with sp|P39956 S...    32   0.89 
CAGL0E03762g complement(351003..352757) weakly similar to sp|P33...    31   0.89 
AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH] (783110.....    31   0.93 
YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive...    31   0.99 
AGR365C [4676] [Homologous to ScYDR323C (PEP7) - SH] (1404996..1...    31   1.0  
Kwal_56.23453                                                          31   1.1  
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    31   1.1  
CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12...    30   1.9  
YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor...    30   2.1  
YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protei...    29   2.1  
Kwal_47.16577                                                          29   3.8  
Scas_683.25                                                            29   3.9  
Kwal_26.8109                                                           29   4.3  
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    29   4.7  
CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041 S...    28   5.3  
Scas_681.19                                                            29   5.9  
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    28   6.9  
CAGL0L06072g complement(679924..680826) some similarities with s...    28   7.9  

>ADL042W [1699] [Homologous to ScYPR015C - SH]
           complement(615818..616663) [846 bp, 281 aa]
          Length = 281

 Score =  487 bits (1253), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 242/276 (87%), Positives = 242/276 (87%)

Query: 1   MSQNYRMHPDSCHNYCAATAMSADVHVRNSHQLQPSDLAVAASHPISGGGSYHYYPXXXX 60
           MSQNYRMHPDSCHNYCAATAMSADVHVRNSHQLQPSDLAVAASHPISGGGSYHYYP    
Sbjct: 1   MSQNYRMHPDSCHNYCAATAMSADVHVRNSHQLQPSDLAVAASHPISGGGSYHYYPSDIS 60

Query: 61  XXXXXXXXXXXXXXXXXXXXLKEILNSTXXXXXXXXXXRHYIAPGVSTCQSKVMLPPIQV 120
                               LKEILNST          RHYIAPGVSTCQSKVMLPPIQV
Sbjct: 61  SGTKNSSSSITSRSLPSLPSLKEILNSTPAVPVAPPVPRHYIAPGVSTCQSKVMLPPIQV 120

Query: 121 AHYLPQQRQYEHMYAQDKSGHSSVLDSPRMTPLIMLNVSSPPANPISGVSATSTQQIHQA 180
           AHYLPQQRQYEHMYAQDKSGHSSVLDSPRMTPLIMLNVSSPPANPISGVSATSTQQIHQA
Sbjct: 121 AHYLPQQRQYEHMYAQDKSGHSSVLDSPRMTPLIMLNVSSPPANPISGVSATSTQQIHQA 180

Query: 181 QILPRRNSLPCFTASQTPPQQPLLNSPLHTRKNPYRGSAYKKNGSVCEICGKDFKRPSAL 240
           QILPRRNSLPCFTASQTPPQQPLLNSPLHTRKNPYRGSAYKKNGSVCEICGKDFKRPSAL
Sbjct: 181 QILPRRNSLPCFTASQTPPQQPLLNSPLHTRKNPYRGSAYKKNGSVCEICGKDFKRPSAL 240

Query: 241 RTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           RTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK
Sbjct: 241 RTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 83.2 bits (204), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 46/71 (64%), Gaps = 5/71 (7%)

Query: 205 NSPLHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRF 264
           NSP    K    G A      +C  CGK F RPSALRTHM+VH+ DKP+ C   GC K+F
Sbjct: 217 NSPTTVVKGKANGKA-----DICAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKF 271

Query: 265 NVKSNMLRHMR 275
           NVKSN++RH++
Sbjct: 272 NVKSNLIRHLK 282

>ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,
           278 aa]
          Length = 278

 Score = 78.6 bits (192), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 47/70 (67%), Gaps = 2/70 (2%)

Query: 206 SPLHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFN 265
           SP  +   P    + KKN  VC++CG++ +RPS L+THM+ H   +P++C H GC K FN
Sbjct: 187 SPGMSVAKPNYSVSTKKN--VCKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFN 244

Query: 266 VKSNMLRHMR 275
           V+SNMLRH R
Sbjct: 245 VRSNMLRHER 254

>Scas_602.4d
          Length = 256

 Score = 73.2 bits (178), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 38/61 (62%)

Query: 215 YRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHM 274
           Y      KN   C +CGK   RPS L+TH ++H  D P+ C + GC+K FNVKSNM RH+
Sbjct: 185 YVEQQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHL 244

Query: 275 R 275
           +
Sbjct: 245 K 245

>ADL051W [1690] [Homologous to NOHBY] complement(595496..596017)
           [522 bp, 173 aa]
          Length = 173

 Score = 70.5 bits (171), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 39/58 (67%)

Query: 218 SAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           S +K +G  C IC K F R ++L+THM++H   KPY C +R C K FNVKSN+ RH R
Sbjct: 109 SVHKVSGKTCAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHER 166

>Scas_707.46
          Length = 338

 Score = 72.8 bits (177), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 80/174 (45%), Gaps = 27/174 (15%)

Query: 127 QRQYEHMYAQDKSGHSSVLDSPRMTPLIMLNVSSPPANP------------ISGVSATST 174
           Q Q + MY  ++  H++ L  P   P++   VS P A P            I       T
Sbjct: 149 QFQNQQMYPPNQQYHATGL--PSYPPIVFGQVSPPQAAPMIDPRQGPNQPYIQIYPQPQT 206

Query: 175 QQIHQAQ--ILPRRNSLPCFTASQTPPQQP----LLNSPLHTRKNPYRGSAYKKNGSV-- 226
           Q   Q+Q  + P  N++        P Q P    L+N  +     P   SA +KN ++  
Sbjct: 207 QMPMQSQPIVFPNNNNVKFPQDGYDPHQFPNYNILMNDGVVDYLQPPSRSAIQKNLNLAS 266

Query: 227 -----CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
                C +CGK   RPS L+TH ++H  D P+ C  + C K FNVKSNMLRH++
Sbjct: 267 RLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLK 320

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/56 (58%), Positives = 39/56 (69%), Gaps = 2/56 (3%)

Query: 221 KKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           KKN   C ICG+   RPS L+TH+ +H  DKPY C  R C KRFNVKSNMLRH ++
Sbjct: 339 KKNQ--CHICGRICSRPSTLQTHLSIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKR 392

>Sklu_2398.2 , Contig c2398 2210-3076 reverse complement
          Length = 288

 Score = 71.6 bits (174), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           +C  CGK F+RPSAL+TH ++H    PY C   GC KRFNVK N+LRH R
Sbjct: 219 LCPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHYR 268

>YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protein
           with similarity to human GT box-binding protein
           (SP:B44489), has two tandem C2H2-type zinc fingers [744
           bp, 247 aa]
          Length = 247

 Score = 70.1 bits (170), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 33/49 (67%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C ICGK   RPS LRTH ++H  D P+ C    C K FNVKSNMLRH+R
Sbjct: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLR 235

>Scas_718.36d
          Length = 330

 Score = 71.2 bits (173), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 39/55 (70%)

Query: 221 KKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           +K G  C++CGK F+RPS+LRTH  + + ++PY C +  C K FN KSNMLRH +
Sbjct: 235 EKLGYFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYK 289

>YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putative
           transcription factor with similarity to mouse REX1
           encoded transcription factor, has two tandem C2H2-type
           zinc fingers [954 bp, 317 aa]
          Length = 317

 Score = 70.9 bits (172), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C +CGK   RPS L+TH ++H  D P+ C   GC K FNVKSNMLRH++
Sbjct: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLK 304

>AEL077W [2429] [Homologous to NOHBY] complement(483028..484038)
           [1011 bp, 336 aa]
          Length = 336

 Score = 70.1 bits (170), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 3/61 (4%)

Query: 218 SAYKKNGSV---CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHM 274
           SA K+   V   C +CGK   RPS+LR HM +H   +P+ CE  GC+KRFNVKSNM+RH 
Sbjct: 264 SADKRQKGVRNQCPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHY 323

Query: 275 R 275
           R
Sbjct: 324 R 324

>Kwal_14.2206
          Length = 254

 Score = 68.2 bits (165), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (62%), Gaps = 4/70 (5%)

Query: 206 SPLHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFN 265
           +P+HT ++    S + +    C ICGK F RPS L TH ++H   +PY C+   C KRFN
Sbjct: 179 TPVHTPRSAATSSTHHE----CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFN 234

Query: 266 VKSNMLRHMR 275
           VKSN++RH +
Sbjct: 235 VKSNLMRHRK 244

>CAGL0J01595g 151584..152618 some similarities with tr|Q12531
           Saccharomyces cerevisiae YPR015c or tr|Q12145
           Saccharomyces cerevisiae YPR013c, hypothetical start
          Length = 344

 Score = 68.9 bits (167), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C +CGK   RPS L+TH+++H  D P+ C  + C+K FNVKSN+LRH++
Sbjct: 286 CPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLK 334

>CAGL0L05786g complement(636176..637222) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 348

 Score = 68.9 bits (167), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C +CGK   RPS L+TH ++H  D P+ C  + C+K FNVKSNMLRH++
Sbjct: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLK 335

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 68.6 bits (166), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           +C++C K FKRPS+L THM +H  +KPY C    C K FN KSNMLRH +
Sbjct: 174 ICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYK 223

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C  CGK F RPS+L THM +H  DKPY C +  C K+FN KSNMLRH +
Sbjct: 306 CAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYK 354

>Sklu_2244.3 , Contig c2244 4100-4915 reverse complement
          Length = 271

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C  C K+FKRPS LRTHMV+H    P+ C+   C K+FNVKSN+LRH R
Sbjct: 218 CPKCKKEFKRPSGLRTHMVIHYGRNPFFCKWPNCSKKFNVKSNLLRHYR 266

>Scas_656.1*
          Length = 102

 Score = 63.2 bits (152), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%)

Query: 220 YKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           Y++    C ICGK   R S+L+THM+VH  D+P+ C+   C K FNVKSNM RH +
Sbjct: 35  YRRPSRQCPICGKIVTRSSSLQTHMLVHTGDRPFKCKWLNCGKTFNVKSNMNRHYK 90

>ADL050W [1691] [Homologous to NOHBY] complement(597229..597669)
           [441 bp, 146 aa]
          Length = 146

 Score = 63.2 bits (152), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 37/53 (69%)

Query: 223 NGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           N   C +C K+F R ++L TH+++H + +PY C++  C K FNVKSN+ RH+R
Sbjct: 74  NSKTCPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNLNRHLR 126

>ADL040W [1701] [Homologous to ScYPR013C - SH]
           complement(618855..619847) [993 bp, 330 aa]
          Length = 330

 Score = 65.9 bits (159), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 1/55 (1%)

Query: 220 YKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHM 274
           Y+ N   C +CG+   RPS L+THM++H  + P+ C   GC KRFNV+SNM RH+
Sbjct: 254 YETN-KTCLVCGRRCTRPSTLKTHMLIHTGELPFQCSWPGCSKRFNVRSNMNRHV 307

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 65.1 bits (157), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 32/48 (66%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRH 273
           VC  CGK F R S+LRTH  +H  D+P+ C  + C K FN +SNMLRH
Sbjct: 184 VCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRH 231

>Scas_710.9
          Length = 505

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 44/66 (66%), Gaps = 1/66 (1%)

Query: 211 RKNP-YRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSN 269
           R+NP  +    +K    C++CGK   R S+L+THM++H   +P++C   GC+K FNVKSN
Sbjct: 432 RRNPRMQELQTRKRKKQCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSN 491

Query: 270 MLRHMR 275
           M RH++
Sbjct: 492 MNRHLK 497

>Kwal_26.8011
          Length = 190

 Score = 62.0 bits (149), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 33/49 (67%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C++C K F R SAL+ H++ H   +P+ C    C K FNVKSNM+RH++
Sbjct: 130 CQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLK 178

>Scas_602.4
          Length = 266

 Score = 62.0 bits (149), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 31/49 (63%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C  CGK   RPS L+ H ++H  D P+ C    C K FNVKSNMLRH++
Sbjct: 202 CPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLK 250

>KLLA0F22319g complement(2086613..2087224) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 203

 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (73%)

Query: 231 GKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           GK+F RPS L+TH+VVH+  KP+ C +  C K +NVKSN+ RH +K
Sbjct: 152 GKEFSRPSTLKTHIVVHSQAKPFKCTYLDCNKSYNVKSNLRRHEKK 197

>AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,
           287 aa]
          Length = 287

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           +C +CGK F R S L+ H+++H N KP+ C    C K FNVKSN+ RH R
Sbjct: 168 ICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CDKEFNVKSNLNRHER 215

>Kwal_27.10467
          Length = 302

 Score = 59.7 bits (143), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 30/50 (60%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
            C  CGK F RPS+L TH   H  DKPY C    C K+FN +SNM RH +
Sbjct: 199 TCTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCDKQFNARSNMTRHYK 248

>Scas_717.17d
          Length = 350

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 38/63 (60%), Gaps = 3/63 (4%)

Query: 216 RGSAYKKNGS---VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLR 272
           +G+  K+ G    +C +CGK   R ++LRTHM++H   +P+ C    C+   +VKSN+ R
Sbjct: 273 KGNVKKRRGHKLHICVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITR 332

Query: 273 HMR 275
           H +
Sbjct: 333 HFK 335

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 2/48 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHM 274
           CE CGK F +   LRTH+ +H  ++PY C+   C KRF+ K N+  HM
Sbjct: 517 CEYCGKRFTQGGNLRTHVRLHTGERPYECDK--CGKRFSRKGNLAAHM 562

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 31/69 (44%), Gaps = 10/69 (14%)

Query: 208 LHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVK 267
           LHT + PY           C+ CGK F R   L  HM+ H N KP+ C+   C K F   
Sbjct: 536 LHTGERPYE----------CDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQL 585

Query: 268 SNMLRHMRK 276
            NM  H  +
Sbjct: 586 GNMKAHQNR 594

>Scas_717.18
          Length = 354

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 38/68 (55%), Gaps = 2/68 (2%)

Query: 210 TRKNPYRGSAYKKNGSV--CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVK 267
           T K+  R S  KK   +  C IC K   R ++LR+H+++H  +KPY C    C    +VK
Sbjct: 279 TPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVK 338

Query: 268 SNMLRHMR 275
           SN+ RH +
Sbjct: 339 SNITRHYK 346

>Kwal_47.19045
          Length = 266

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C++CGK F R    R H+  H  +KP++C   GC KRF+    + RH+R
Sbjct: 16  CDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVR 64

>Kwal_47.17888
          Length = 786

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 29/47 (61%), Gaps = 2/47 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRH 273
           CE CGK F +   LRTH+ +H  +KPY CE   C +RF+ K N+  H
Sbjct: 533 CEYCGKRFTQGGNLRTHVRLHTGEKPYECEK--CGRRFSRKGNLAAH 577

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 32/69 (46%), Gaps = 10/69 (14%)

Query: 208 LHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVK 267
           LHT + PY           CE CG+ F R   L  H + H N KP++C+  GC K F   
Sbjct: 552 LHTGEKPYE----------CEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQL 601

Query: 268 SNMLRHMRK 276
            NM  H  +
Sbjct: 602 GNMKAHQNR 610

 Score = 35.4 bits (80), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C  C K F + + L  H+  H   KP+ CE+  C KRF    N+  H+R
Sbjct: 505 CPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVR 551

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 29/47 (61%), Gaps = 2/47 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRH 273
           CE CGK F +   LRTH+ +H  +KPY CE   C ++F+ K N+  H
Sbjct: 553 CEFCGKRFTQGGNLRTHIRLHTGEKPYECER--CGRKFSRKGNLAAH 597

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 31/69 (44%), Gaps = 10/69 (14%)

Query: 208 LHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVK 267
           LHT + PY           CE CG+ F R   L  H + H+N KP+ C+   C K F   
Sbjct: 572 LHTGEKPYE----------CERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQL 621

Query: 268 SNMLRHMRK 276
            NM  H  +
Sbjct: 622 GNMKAHQNR 630

 Score = 34.7 bits (78), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C  C K F + + L  H+  H   KP++CE   C KRF    N+  H+R
Sbjct: 525 CPYCHKYFTQSTHLEVHVRSHIGYKPFSCEF--CGKRFTQGGNLRTHIR 571

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 31/49 (63%), Gaps = 2/49 (4%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHM 274
           VC+ CGK F +   LRTH  +H  +KPY+C+   C K+F+ K N+  H+
Sbjct: 622 VCDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHL 668

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 30/69 (43%), Gaps = 10/69 (14%)

Query: 208 LHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVK 267
           LHT + PY           C+IC K F R   L  H+V H   KP+ C+   C K F   
Sbjct: 642 LHTGEKPYS----------CDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQL 691

Query: 268 SNMLRHMRK 276
            NM  H  +
Sbjct: 692 GNMKAHQNR 700

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C  C + F + + L  H+  H   KP+ C++  C KRF    N+  H R
Sbjct: 595 CPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHER 641

>Scas_713.52
          Length = 620

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           + E CGK FKR   +R+H+  H  DKPY C+  GC+K F    +++RH +
Sbjct: 483 LYEDCGKIFKRRYNVRSHIQTHLEDKPYACDFPGCEKAFVRNHDLVRHKK 532

>CAGL0E01331g 124362..126431 weakly similar to sp|P08153
           Saccharomyces cerevisiae YDR146c transcription factor,
           hypothetical start
          Length = 689

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 29/46 (63%)

Query: 230 CGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           CGK FKR   +R+H+  H  D+PY C++ GC K F    +++RH +
Sbjct: 563 CGKTFKRRYNIRSHIQTHLEDRPYRCDYDGCDKAFVRNHDLVRHKK 608

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           VC ICG+ F R      HM  H  +KP+ C+  GC KRF+    + RH R
Sbjct: 44  VCPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRR 93

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%)

Query: 230 CGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           CGK F R   +R+H+  H  D+P+ C+H GC K F    +++RH +
Sbjct: 681 CGKLFNRRYNIRSHIQTHLEDRPFRCDHEGCTKAFVRNHDLIRHKK 726

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 1/65 (1%)

Query: 211 RKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNM 270
           R  PY G    +   VC IC + F R      H+  H  +KP+ C+  GC KRF+ +  +
Sbjct: 9   RSTPYSGPDAPRP-YVCPICARAFHRLEHQTRHIRTHTGEKPHACDFAGCGKRFSRQDEL 67

Query: 271 LRHMR 275
            RH R
Sbjct: 68  TRHRR 72

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 46.6 bits (109), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 28/47 (59%)

Query: 228 EICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHM 274
           E CGK + RP  LR H+  H N+KP++C   GC K F   S++  HM
Sbjct: 13  ESCGKKYSRPCLLRQHVRSHTNEKPFHCPEPGCDKAFLRPSHLRVHM 59

 Score = 43.1 bits (100), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 230 CGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C K F RPS LR HM+ H+  KPYNC    C K F  K    RH +
Sbjct: 45  CDKAFLRPSHLRVHMLSHSKVKPYNC--SVCGKGFATKQQFQRHQQ 88

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 29/46 (63%)

Query: 230 CGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C K FKR   +R+H+  H  D+PY+C+H GC K F    +++RH +
Sbjct: 557 CTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRHKK 602

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           VC IC + F R      H+  H  +KP+ CE  GC KRF+    + RH R
Sbjct: 35  VCPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTR 84

>Kwal_56.23925
          Length = 745

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%)

Query: 230 CGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           CGK F+R   +R+H+  H  D+PY C+  GC K F    +++RH +
Sbjct: 592 CGKTFRRRYNIRSHIQTHLEDRPYFCDFEGCHKAFVRNHDLIRHKK 637

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 43/85 (50%), Gaps = 16/85 (18%)

Query: 191 CFTASQTPPQQPLLNSPLHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNND 250
           CF++ +T  Q     +  H+ + PY+          C IC K F   S+L+ H+  H  +
Sbjct: 776 CFSSEETLVQH----TRTHSGEKPYK----------CHICNKKFAISSSLKIHIRTHTGE 821

Query: 251 KPYNCEHRGCQKRFNVKSNMLRHMR 275
           KP  C  + C KRFN  SN+ +H++
Sbjct: 822 KPLQC--KICGKRFNESSNLSKHIK 844

 Score = 35.0 bits (79), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 12/68 (17%)

Query: 208 LHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVK 267
           +H++  PY+          C+ C + F     L  H   H+ +KPY C    C K+F + 
Sbjct: 761 VHSKYKPYK----------CKTCKRCFSSEETLVQHTRTHSGEKPYKC--HICNKKFAIS 808

Query: 268 SNMLRHMR 275
           S++  H+R
Sbjct: 809 SSLKIHIR 816

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 230 CGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C + F +   L  H+ VH+  KPY C  + C++ F+ +  +++H R
Sbjct: 745 CHRTFPQRQKLIRHLKVHSKYKPYKC--KTCKRCFSSEETLVQHTR 788

>Scas_697.35
          Length = 839

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHM 274
           C  CGK F +   LRTH  +H  +KPY CE   C K+F+ K N+  H+
Sbjct: 545 CGYCGKRFTQGGNLRTHQRLHTGEKPYECEL--CDKKFSRKGNLAAHL 590

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 30/69 (43%), Gaps = 10/69 (14%)

Query: 208 LHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVK 267
           LHT + PY           CE+C K F R   L  H++ H   KP+ C+   C + F   
Sbjct: 564 LHTGEKPYE----------CELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQL 613

Query: 268 SNMLRHMRK 276
            NM  H  +
Sbjct: 614 GNMKAHQNR 622

>Scas_575.3
          Length = 455

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 204 LNSPLHTRKNPYRGSAYKKNGS-----VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHR 258
           +  P  T K P   S   K+G      VC IC + F R      HM  H  +KP+ C+  
Sbjct: 42  MQEPQTTVKKPRPRSRANKDGDAPRPHVCPICQRAFHRLEHQTRHMRTHTGEKPHECDFP 101

Query: 259 GCQKRFNVKSNMLRHMR 275
           GC K+F+    + RH R
Sbjct: 102 GCVKKFSRSDELTRHKR 118

>Kwal_14.2278
          Length = 463

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           +C IC + F R      H+  H  +KP+ C+  GC KRF+    + RH R
Sbjct: 24  ICPICSRAFHRLEHQTRHIRTHTGEKPHACDFAGCTKRFSRSDELTRHKR 73

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           +CEICG  F R      H+  H  +KP+ C   GC KRF+    + RH++
Sbjct: 13  LCEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIK 62

>Scas_717.17
          Length = 525

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 38/63 (60%), Gaps = 3/63 (4%)

Query: 214 PYRGSAYKKNGS-VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLR 272
           P RG+   +N   +C IC K+FKR S L+ H++ H++++ Y C    C  R   + N+L+
Sbjct: 376 PPRGTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCP--WCLSRHKRRDNLLQ 433

Query: 273 HMR 275
           HM+
Sbjct: 434 HMK 436

>Scas_711.56
          Length = 832

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 31/49 (63%), Gaps = 2/49 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C+ICGK F   S+L+ H+  H  +KP +C  + C K FN  SN+ +HM+
Sbjct: 756 CDICGKRFAISSSLKIHIRTHTGEKPLHC--KICGKAFNESSNLSKHMK 802

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C IC K F     L+ H   H+ +KP+ C+   C KRF + S++  H+R
Sbjct: 728 CSICKKHFSNEETLKQHERTHSGEKPFKCD--ICGKRFAISSSLKIHIR 774

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 4/47 (8%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRH 273
           C+ICGK F   S L  HM  H   K + CE   C+  FN  S +  H
Sbjct: 784 CKICGKAFNESSNLSKHMKTH--LKRFKCE--KCEASFNTVSKLRSH 826

 Score = 28.1 bits (61), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 230 CGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C K F +   L  HM VH+  KP+ C    C+K F+ +  + +H R
Sbjct: 703 CHKIFSQRQRLVRHMRVHSGYKPFQC--SICKKHFSNEETLKQHER 746

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 2/48 (4%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRH 273
           VCE+CGK F RP  L++H+  H ++KPY C    C K F  + +  RH
Sbjct: 522 VCEVCGKVFSRPYNLKSHLRTHTDEKPYQCSI--CGKAFARQHDKKRH 567

 Score = 35.4 bits (80), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 30/74 (40%), Gaps = 17/74 (22%)

Query: 209 HTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHR-------GCQ 261
           HT + PY+          C ICGK F R    + H  +H   K Y C  +       GC 
Sbjct: 543 HTDEKPYQ----------CSICGKAFARQHDKKRHEDLHTGKKRYVCGGKLKDGTFWGCG 592

Query: 262 KRFNVKSNMLRHMR 275
           K+F     + RH +
Sbjct: 593 KKFARSDALGRHFK 606

>Kwal_26.8021
          Length = 507

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 2/49 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C +C K FKR S  + H++ H++ KPY+C    CQ R   + N+ +HM+
Sbjct: 391 CSMCDKSFKRRSWHKRHLLSHSSFKPYSCP--WCQSRHKRRDNLFQHMK 437

>CAGL0M04323g complement(474158..476269) similar to sp|P21192
           Saccharomyces cerevisiae YLR131c ACE2 or sp|P08153
           Saccharomyces cerevisiae YDR146c SWI5, hypothetical
           start
          Length = 703

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%)

Query: 230 CGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           CGK F+R   +++H+  H  DKPY C+  GC K F    ++ RH +
Sbjct: 530 CGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLARHKK 575

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C  C K F   S+LR H+  H  +KP  C  + C KRFN  SN+ +HM+
Sbjct: 688 CTYCTKQFATSSSLRIHIRTHTGEKPLKC--KICGKRFNESSNLSKHMK 734

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 5/82 (6%)

Query: 194 ASQTPPQQPLLNSPLHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPY 253
            SQ  P    LN+ + ++  P   S+Y+ +    + C K F +   L  H+ VH+  KP+
Sbjct: 602 CSQVFPNPEALNNHIESQHIPRGQSSYQCSW---DTCSKSFTQRQKLLRHLKVHSGYKPF 658

Query: 254 NCEHRGCQKRFNVKSNMLRHMR 275
            C H  C K+F+ +  + +H+R
Sbjct: 659 KCPH--CTKKFSTEDILQQHIR 678

 Score = 34.7 bits (78), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 4/50 (8%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           C+ICGK F   S L  HM  H  ++ Y CE   C++ FN    +  H  +
Sbjct: 716 CKICGKRFNESSNLSKHMKTH--ERKYKCE--KCKRSFNQLEQLRLHQNR 761

 Score = 32.7 bits (73), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C  C K F     L+ H+  H+ ++P+ C +  C K+F   S++  H+R
Sbjct: 660 CPHCTKKFSTEDILQQHIRTHSGERPFKCTY--CTKQFATSSSLRIHIR 706

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           +C++CGK F     L  H  +H  +K + C + GC +RFN   N L+H +
Sbjct: 403 LCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYK 452

>Scas_712.42*
          Length = 290

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           CE C + F R    + HM  H  +KP++C   GC K F+    + RH+R
Sbjct: 20  CETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLR 68

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRH 273
           CE CGK F +   LRTH  +H  ++P+ C+   C K F  + N+  H
Sbjct: 510 CEFCGKRFTQAGNLRTHRRLHTGERPFKCDK--CDKTFARRGNLTAH 554

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 30/69 (43%), Gaps = 10/69 (14%)

Query: 208 LHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVK 267
           LHT + P++          C+ C K F R   L  H   H + KPY C    C KRF+  
Sbjct: 529 LHTGERPFK----------CDKCDKTFARRGNLTAHEFTHESIKPYICRLDNCFKRFSQL 578

Query: 268 SNMLRHMRK 276
            NM  H  K
Sbjct: 579 GNMKSHQNK 587

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C  C K F + + L  H+  H   KP+ CE   C KRF    N+  H R
Sbjct: 482 CAYCSKMFSQSTHLDVHIKAHMGYKPFECEF--CGKRFTQAGNLRTHRR 528

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C  C K F   S+LR H+  H  +KP +C    C KRFN  SN+ +HM+
Sbjct: 574 CHYCRKQFSTSSSLRVHIRTHTGEKPLSC--TVCGKRFNESSNLSKHMK 620

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 214 PYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRH 273
           P++G+   K  S C  C K F     L  H+  H+ ++P++C +  C+K+F+  S++  H
Sbjct: 534 PHQGTHRHKPCS-CPHCPKTFSTDDILAQHIRTHSGERPFHCHY--CRKQFSTSSSLRVH 590

Query: 274 MR 275
           +R
Sbjct: 591 IR 592

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 4/39 (10%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFN 265
           C +CGK F   S L  HM +H  ++ Y C  + C++ F+
Sbjct: 602 CTVCGKRFNESSNLSKHMKIH--ERKYMC--KLCKRSFD 636

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
            C IC + F R      HM +H  +KP+ C+  GC KRF+    + RH R
Sbjct: 39  ACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRR 88

>Kwal_27.11460
          Length = 531

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 4/60 (6%)

Query: 216 RGSAYKKNGSV--CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRH 273
           R  + +KN SV  CE+C K F RP  L++H+  H +++P++C    C K F  + +  RH
Sbjct: 402 RRKSLQKNASVYACELCDKKFTRPYNLKSHLRTHTDERPFSCAI--CGKAFARQHDRKRH 459

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 7/56 (12%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHR-------GCQKRFNVKSNMLRHMR 275
           C ICGK F R    + H  +H   K Y C  +       GC K+F     + RH +
Sbjct: 443 CAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHFK 498

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C  C K FKR S L+ H++ H+  KPY+C    C  R   K N+ +H++
Sbjct: 187 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCP--WCHSRHKRKDNLSQHLK 233

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 10/70 (14%)

Query: 204 LNSPLHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKR 263
           L+S  + RKNP            C++CGK F RP  L++H+  H N++P+ C    C K 
Sbjct: 556 LDSVTNNRKNPA--------NFACDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKA 605

Query: 264 FNVKSNMLRH 273
           F  + +  RH
Sbjct: 606 FARQHDRKRH 615

 Score = 35.0 bits (79), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 30/74 (40%), Gaps = 17/74 (22%)

Query: 209 HTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHR-------GCQ 261
           HT + P+          +C ICGK F R    + H  +H   K Y C  +       GC 
Sbjct: 591 HTNERPF----------ICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCG 640

Query: 262 KRFNVKSNMLRHMR 275
           K+F     + RH +
Sbjct: 641 KKFARSDALGRHFK 654

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 10/71 (14%)

Query: 205 NSPLHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRF 264
           N P+     P+R          C+ C + F R    + H+  H  +KP++C   GC K F
Sbjct: 7   NFPVDNENRPFR----------CDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSF 56

Query: 265 NVKSNMLRHMR 275
           +    + RHMR
Sbjct: 57  SRSDELKRHMR 67

>Scas_709.32
          Length = 822

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 10/86 (11%)

Query: 195 SQTPPQQPLLNSPLHTRKNPYRGSAYK---KNGSV-CEICGKDFKRPSALRTHM-VVHNN 249
           SQ+PP   LLN    T     R  +Y    +N +  CE CGK F+R   L+ H+  VH++
Sbjct: 734 SQSPP---LLNGQKATTTTAKRSVSYNFSDENKTFKCETCGKAFRRSEHLKRHIRSVHSS 790

Query: 250 DKPYNCEHRGCQKRFNVKSNMLRHMR 275
           ++P+ C    C K+F+   N+ +H++
Sbjct: 791 ERPFACP--TCDKKFSRSDNLAQHIK 814

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           CEIC + F R    + H   H  +KP+ C  +GC K F+    + RH+R
Sbjct: 19  CEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLR 67

>Scas_721.92
          Length = 1152

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           VC++C + F R   L  H   H N+KPY C    C K+F  +  +LRH +K
Sbjct: 79  VCDVCSRAFARQEHLDRHARSHTNEKPYQCGI--CTKKFTRRDLLLRHAQK 127

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           VC IC + F R      H+  H  ++P+ C+  GC KRF+    + RH R
Sbjct: 27  VCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRR 76

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%)

Query: 221 KKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           K+   +C+ CGK F     L  H  +H  +K + C   GC +RF+   N L+H R
Sbjct: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYR 130

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 27/44 (61%)

Query: 230 CGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRH 273
           C K FKR   +R+H+  H  D+PY+C+  GC K F    +++RH
Sbjct: 610 CNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRH 653

>Kwal_26.8351
          Length = 698

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 44/79 (55%), Gaps = 13/79 (16%)

Query: 198 PPQQPLLNSPLHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHM-VVHNNDKPYNCE 256
           PP+    +SP+   + P++          C+ C K F+R   L+ H+  VH++++P++C 
Sbjct: 624 PPRNSKSSSPVEEEEKPFK----------CQECTKAFRRSEHLKRHIRSVHSSERPFHCS 673

Query: 257 HRGCQKRFNVKSNMLRHMR 275
           +  C K+F+   N+ +H++
Sbjct: 674 Y--CDKKFSRSDNLSQHLK 690

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 26/46 (56%)

Query: 230 CGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C K F R    RTH+  H  D+PY C+  GCQK F    ++LRH +
Sbjct: 700 CQKRFNRRYNARTHIQTHLCDRPYKCDFPGCQKAFVRNHDLLRHKK 745

>Kwal_27.10167
          Length = 285

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 27/41 (65%), Gaps = 2/41 (4%)

Query: 226 VCEI--CGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRF 264
           +C I  C K +++PS+LR H+  HNN++P+ C    C KRF
Sbjct: 36  ICPITSCNKRYRKPSSLREHVNSHNNNRPFACPEPNCGKRF 76

 Score = 35.0 bits (79), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 2/45 (4%)

Query: 230 CGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHM 274
           CGK F R   +  H   H+  KP  CE   C K F  K  + RH+
Sbjct: 72  CGKRFLRVCHMNVHRWTHSKIKPLKCEE--CSKGFTTKQQLSRHL 114

>Kwal_23.5400
          Length = 429

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 227 CEICGKDFKRPSALRTHMVVHNN---DKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           CEICGK F+RP  L+ H+  H+N    + Y C    C + F   S + +HM++
Sbjct: 166 CEICGKRFQRPYRLKNHIAKHHNPDVVQKYQCSQGSCIEAFKTWSALQQHMKE 218

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRH 273
           C +C + F R + L  HM  H+ DKP+ C +  C K    K  + RH
Sbjct: 83  CTVCARQFSRKTHLERHMFSHSEDKPFKCSY--CGKGVTTKQQLRRH 127

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 228 EICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHM 274
           E C K F RPS L  H  VVH   KP+ C    C ++F+ K+++ RHM
Sbjct: 55  EGCSKAFSRPSQLTEHQEVVHQGIKPFQC--TVCARQFSRKTHLERHM 100

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 2/38 (5%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRF 264
           C  CGK       LR H + H   + + C H GC++ F
Sbjct: 111 CSYCGKGVTTKQQLRRHEITHT--RSFVCPHEGCEESF 146

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 13/70 (18%)

Query: 207 PLHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFN 265
           PL   + P++          C+ C K F+R   L+ H+  VH++D+P+ C +  C K+F+
Sbjct: 496 PLEEEEKPFK----------CQECTKAFRRSEHLKRHIRSVHSSDRPFPCTY--CDKKFS 543

Query: 266 VKSNMLRHMR 275
              N+ +H++
Sbjct: 544 RSDNLSQHLK 553

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C +C K +   S+LR H+  H  +KP +C    C KRFN  SN+ +H+R
Sbjct: 722 CHLCPKSYSTSSSLRIHIRTHTGEKPLSCP--ICNKRFNESSNLAKHIR 768

 Score = 32.3 bits (72), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 3/49 (6%)

Query: 230 CGKDFKRPSALRTHMV---VHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C K+F    +L  H+    V +    Y CE  GC K F  K  ++RH++
Sbjct: 636 CNKEFDSAKSLNEHIENFHVPSGLSSYKCEWEGCNKVFVQKQKLIRHLK 684

 Score = 31.6 bits (70), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 228 EICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           E C K F +   L  H+ VH+  KP+ C    C K FN +  + +H+R
Sbjct: 667 EGCNKVFVQKQKLIRHLKVHSKYKPFRCAE--CGKCFNTQDILTQHLR 712

>Scas_712.2
          Length = 327

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%)

Query: 228 EICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRF 264
           E C ++F RP  L+ H   H N++PY C+  GC KRF
Sbjct: 18  EGCHREFTRPCLLQQHRYSHTNERPYICDVEGCGKRF 54

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 14/68 (20%)

Query: 209 HTRKNPYRGSAYKKNGSVCEI--CGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNV 266
           HT + PY          +C++  CGK F RP  L+ H   H+  KP  C    C+K F  
Sbjct: 37  HTNERPY----------ICDVEGCGKRFMRPCHLKVHKWTHSKVKPLKCAF--CEKGFIT 84

Query: 267 KSNMLRHM 274
              + RH+
Sbjct: 85  NQQLKRHL 92

>Kwal_27.10925
          Length = 264

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           VC+IC K F     L  H  +H  +K + C H GC +RF+   N ++H +
Sbjct: 202 VCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQHYK 251

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 24/49 (48%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           CE C + F R    + HM  H  +KP+ C   GC K F+    + RH R
Sbjct: 19  CEHCSRGFHRLEHKKRHMRTHTGEKPHGCSFPGCGKSFSRSDELKRHNR 67

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           +C+IC + F     L  H  +H  +K + C+  GC +RF+   N ++H R
Sbjct: 285 ICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYR 334

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score = 41.2 bits (95), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           +C+IC + F     L  H  +H  +K + C ++GC +RF+   N L+H R
Sbjct: 175 ICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYR 224

>Scas_693.31
          Length = 635

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%)

Query: 230 CGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           CGK FKR    R+H+  H  D+PY C+   C K F    +++RH +
Sbjct: 496 CGKHFKRRYNTRSHIQTHLEDRPYACDFPNCDKAFVRNHDLVRHKK 541

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           C+IC K F R   L  H + H   +P+ C+   C K F+   NM  H  K
Sbjct: 13  CDICKKRFSRKGNLAAHKMTHGKIRPFICKLDNCNKSFSQLGNMKSHQNK 62

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           CEIC + F R    + H   H  +KP+ C+   C K F+    + RH R
Sbjct: 22  CEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADELKRHSR 70

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRH 273
           C+ CGK+F + S L  HM  H +DKP+ C    C K    +  + RH
Sbjct: 139 CDTCGKEFAKKSHLNRHMFSHTDDKPFTCS--ICGKGVTTRQQLKRH 183

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 230 CGKDFKRPSALRTH-MVVHNNDKPYNCEHRGCQKRFNVKSNMLRHM 274
           C K F RPS L  H + VH+  KP+ C+   C K F  KS++ RHM
Sbjct: 113 CNKSFTRPSLLTEHQLTVHHGIKPFKCD--TCGKEFAKKSHLNRHM 156

 Score = 32.0 bits (71), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKP---YNCEHRGCQKRFNVKSNMLRHMRK 276
            C  C K F+RP  L+ H+  H+N +    Y C+   C   F+  S++ +H+++
Sbjct: 221 TCPHCNKTFQRPYRLKNHIDKHHNPESTGMYQCDFLSCTDVFSTWSSLQQHIKQ 274

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 31/78 (39%), Gaps = 14/78 (17%)

Query: 189 LPCFTASQTPPQQPLLNSPL--HTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVV 246
             C T  +   ++  LN  +  HT   P+           C ICGK       L+ H + 
Sbjct: 137 FKCDTCGKEFAKKSHLNRHMFSHTDDKPF----------TCSICGKGVTTRQQLKRHEIT 186

Query: 247 HNNDKPYNCEHRGCQKRF 264
           H   K ++C + GC + F
Sbjct: 187 HT--KSFHCSYEGCNESF 202

>YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor
           involved in sulfite metabolism, has five C2H2-type zinc
           fingers [900 bp, 299 aa]
          Length = 299

 Score = 40.4 bits (93), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 22/35 (62%)

Query: 230 CGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRF 264
           C K + RPS L+ H   H N KPY+C+  GC K+F
Sbjct: 19  CEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKF 53

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 23/45 (51%), Gaps = 2/45 (4%)

Query: 230 CGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHM 274
           CGK F RP  LR H   H+  KP  C    CQKRF     + RH+
Sbjct: 49  CGKKFIRPCHLRVHKWTHSQIKPKAC--TLCQKRFVTNQQLRRHL 91

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 227 CEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C +C K FKR   L+ H+  VH+ D+P++C    C+K+F+   N+ +H++
Sbjct: 537 CHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHL--CEKKFSRSDNLSQHIK 584

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 230 CGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRH 273
           CGK + RP  L  H   H N++P+ CE  GC K F   S++  H
Sbjct: 15  CGKMYSRPCLLEQHRRSHTNERPFVCEEPGCGKGFLRASHLKVH 58

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 29/69 (42%), Gaps = 14/69 (20%)

Query: 209 HTRKNPYRGSAYKKNGSVCEI--CGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNV 266
           HT + P+          VCE   CGK F R S L+ H   H+  KP  C    C K F  
Sbjct: 32  HTNERPF----------VCEEPGCGKGFLRASHLKVHKWSHSQVKPLACP--VCSKGFTT 79

Query: 267 KSNMLRHMR 275
              + RH +
Sbjct: 80  NQQLSRHKK 88

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           VC+IC + F     L  H  +H  +K + C   GC +RF+   N ++H R
Sbjct: 101 VCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYR 150

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 227 CEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           CE C + FKR   L+ H+  +H  +KPY CE   C K+F+   N+ +H++
Sbjct: 356 CEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEI--CGKKFSRSDNLNQHIK 403

 Score = 31.6 bits (70), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 13/24 (54%)

Query: 227 CEICGKDFKRPSALRTHMVVHNND 250
           CEICGK F R   L  H+  H  D
Sbjct: 385 CEICGKKFSRSDNLNQHIKTHGGD 408

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C +C K F+R S L+ H++ H+N K ++C    C      K N+L+H++
Sbjct: 308 CHLCEKQFRRKSWLKRHLLSHSNVKKFHCP--WCSSTHKRKDNLLQHLK 354

>Scas_718.44
          Length = 266

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           VC+IC   F     L  H  +H  +K ++C   GC ++F+   N L+H R
Sbjct: 211 VCKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQKFSRHDNCLQHYR 260

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           +C+IC   F     L  H  +H  +K + C H GC + F+   N L+H R
Sbjct: 253 ICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYR 302

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 40/75 (53%), Gaps = 13/75 (17%)

Query: 202 PLLNSPLHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGC 260
           P   SP+   + P++          C+ C K F+R   L+ H+  VH+ ++P++C+   C
Sbjct: 608 PKSTSPMDEEEKPFK----------CDQCNKTFRRSEHLKRHVRSVHSTERPFHCQF--C 655

Query: 261 QKRFNVKSNMLRHMR 275
            K+F+   N+ +H++
Sbjct: 656 DKKFSRSDNLSQHLK 670

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 16/85 (18%)

Query: 191 CFTASQTPPQQPLLNSPLHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNND 250
           CF+   T  Q       +H+ + PY           C IC K F   ++L+ H+  H  +
Sbjct: 605 CFSTEDTLNQH----KRVHSGEKPYE----------CHICHKRFAISNSLKIHIRTHTGE 650

Query: 251 KPYNCEHRGCQKRFNVKSNMLRHMR 275
           KP  C  + C + FN  SN+ +HM+
Sbjct: 651 KPLKC--KVCGRCFNESSNLSKHMK 673

 Score = 34.7 bits (78), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 12/68 (17%)

Query: 208 LHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVK 267
           +H++  PY+          C  C K F     L  H  VH+ +KPY C    C KRF + 
Sbjct: 590 VHSKYKPYQ----------CPQCQKCFSTEDTLNQHKRVHSGEKPYEC--HICHKRFAIS 637

Query: 268 SNMLRHMR 275
           +++  H+R
Sbjct: 638 NSLKIHIR 645

 Score = 32.3 bits (72), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 228 EICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           E C K F +   L  H+ VH+  KPY C    CQK F+ +  + +H R
Sbjct: 572 EGCNKTFSQRQKLVRHLKVHSKYKPYQCPQ--CQKCFSTEDTLNQHKR 617

 Score = 31.6 bits (70), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 3/49 (6%)

Query: 230 CGKDFKRPSALRTH---MVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C + FK    L  H   M +      Y CE  GC K F+ +  ++RH++
Sbjct: 541 CNERFKSAGDLNDHLEEMHLTKGKSQYTCEWEGCNKTFSQRQKLVRHLK 589

>Scas_695.2
          Length = 571

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

Query: 206 SPLHTRKNPYRGSAYKKNGS-VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRF 264
           SP   R+   + +    +G+  CE+C K F RP  L++H+  H N+ P+ C    C K F
Sbjct: 432 SPRKARRKSSQTTGRSGSGAYACELCDKTFTRPYNLKSHLRTHTNEXPFVCNI--CGKAF 489

Query: 265 NVKSNMLRH 273
             + +  RH
Sbjct: 490 ARQHDRKRH 498

 Score = 34.7 bits (78), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 29/74 (39%), Gaps = 17/74 (22%)

Query: 209 HTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEH-------RGCQ 261
           HT + P+          VC ICGK F R    + H  +H   K Y C          GC 
Sbjct: 474 HTNEXPF----------VCNICGKAFARQHDRKRHEDLHTGKKRYVCGGVLKNGTPWGCH 523

Query: 262 KRFNVKSNMLRHMR 275
           K+F     + RH +
Sbjct: 524 KKFARSDALGRHFK 537

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C+ C K FKR S L+ H++ H+  + + C    C  R   K N+L+HM+
Sbjct: 348 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCP--WCLSRQKRKDNLLQHMK 394

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 227 CEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C IC K FKR   L+ H+  VH+N++P+ C    C K+F+   N+ +H++
Sbjct: 649 CHICPKSFKRSEHLKRHVRSVHSNERPFAC--HICDKKFSRSDNLSQHIK 696

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 216 RGSAYKKNGSV--CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRH 273
           R  + +KN ++  C +C K F RP  L++H+  H +++P++C    C K F  + +  RH
Sbjct: 415 RRKSLQKNPAIYSCNLCDKKFTRPYNLKSHLRTHTDERPFSCS--VCGKAFARQHDRKRH 472

 Score = 34.7 bits (78), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 7/56 (12%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHR-------GCQKRFNVKSNMLRHMR 275
           C +CGK F R    + H  +H+  K Y C  +       GC K+F     + RH +
Sbjct: 456 CSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATWGCGKKFARSDALGRHFK 511

>Kwal_14.2543
          Length = 711

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 40/105 (38%), Gaps = 36/105 (34%)

Query: 197 TPPQQPLLNSPLHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCE 256
           T  Q+ L +  +HTR  P +          C  C K F     L+ HM  H+ +KPY C 
Sbjct: 588 TQRQKLLRHLRVHTRYKPCK----------CVHCLKTFSTQDILQQHMRTHSGEKPYKCS 637

Query: 257 HRG--------------------------CQKRFNVKSNMLRHMR 275
           H G                          C KRFN  SN+ +HMR
Sbjct: 638 HCGKGFATSSSLRIHIRTHTGEKPLECKVCGKRFNESSNLSKHMR 682

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 4/50 (8%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           C++CGK F   S L  HM  H  ++ Y C+   C++ F+ K  +  H  +
Sbjct: 664 CKVCGKRFNESSNLSKHMRTH--ERKYKCQ--KCKRSFDFKEQLEVHQSR 709

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 9/74 (12%)

Query: 204 LNSPLHTRKNPYRGSAYKKNGSVC--EICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQ 261
           LN+ +     P   S+Y     VC  E CG+   +   L  H+ VH   KP  C H  C 
Sbjct: 560 LNTHIEKEHIPRGKSSY-----VCGWENCGRVITQRQKLLRHLRVHTRYKPCKCVH--CL 612

Query: 262 KRFNVKSNMLRHMR 275
           K F+ +  + +HMR
Sbjct: 613 KTFSTQDILQQHMR 626

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 42/89 (47%), Gaps = 5/89 (5%)

Query: 188 SLPCFTASQTPPQQPLLNSPLHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVH 247
           SLP    + T  +  +L  P H R N    S  K    VC++C + F R   L  H   H
Sbjct: 91  SLPAKITNNTNKKFDML--PDHLRLNGVTPSG-KPRLFVCKVCTRAFARQEHLTRHERSH 147

Query: 248 NNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
             +KPY C    C++RF  +  ++RH +K
Sbjct: 148 TKEKPYVC--GICERRFTRRDLLIRHCQK 174

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNN---DKPYNCEHRGCQKRFNVKSNMLRHMR 275
            C  C K F+RP  LR H+  H++   + PY C   GC K F + S +  H++
Sbjct: 164 TCPHCNKSFQRPYRLRNHISKHHDPEVENPYQCTFAGCCKEFRIWSQLQSHIK 216

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRH 273
           C+ C K F + S L  H+  H++ KP+ C +  C K    +  + RH
Sbjct: 82  CDKCAKSFVKKSHLERHLYTHSDTKPFQCSY--CGKGVTTRQQLKRH 126

 Score = 32.0 bits (71), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 230 CGKDFKRPSALRTHMV-VHNNDKPYNCEHRGCQKRFNVKSNMLRHM 274
           C K F RPS L  H + VH   + + C+   C K F  KS++ RH+
Sbjct: 56  CDKAFTRPSILTEHQLSVHQGLRAFQCD--KCAKSFVKKSHLERHL 99

>Scas_569.2
          Length = 293

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 32/65 (49%)

Query: 211 RKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNM 270
           +K  +     K+   +C++C K F     L  H  +H  +K ++C + GC  +F+   N 
Sbjct: 214 KKRKHEEELEKRRKYICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNC 273

Query: 271 LRHMR 275
           ++H R
Sbjct: 274 VQHYR 278

>AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH]
           complement(1071491..1074664) [3174 bp, 1057 aa]
          Length = 1057

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           VC  C + F R   L  H   H N+KPY C    C +RF+ +  +LRH  K
Sbjct: 50  VCHTCTRAFARQEHLIRHKRSHTNEKPYICGI--CDRRFSRRDLLLRHAHK 98

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 227 CEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           CE C + FKR   L+ H+  +H  +KPY C+   C K+F+   N+ +H++
Sbjct: 462 CEYCERRFKRQEHLKRHIRSLHMGEKPYGCDI--CGKKFSRSDNLNQHIK 509

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 14/23 (60%)

Query: 227 CEICGKDFKRPSALRTHMVVHNN 249
           C+ICGK F R   L  H+  H+N
Sbjct: 491 CDICGKKFSRSDNLNQHIKTHSN 513

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           VCE+C + F R   L+ H   H N+KPY C    C + F  +  ++RH +K
Sbjct: 105 VCEVCTRAFARQEHLKRHYRSHTNEKPYPCGL--CNRCFTRRDLLIRHAQK 153

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRF 264
            C+IC K F RP  L++H+  H +++PY C    C K F
Sbjct: 470 ACDICDKKFTRPYNLKSHLRSHTDERPYVCSV--CGKAF 506

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 28/74 (37%), Gaps = 17/74 (22%)

Query: 209 HTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNC-------EHRGCQ 261
           HT + PY          VC +CGK F R      H  +H   + Y C          GC 
Sbjct: 491 HTDERPY----------VCSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGNSWGCG 540

Query: 262 KRFNVKSNMLRHMR 275
           K+F     + RH +
Sbjct: 541 KKFARSDALGRHFK 554

>Scas_378.1
          Length = 208

 Score = 37.7 bits (86), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 30/49 (61%), Gaps = 2/49 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C +C K F+R S L+ H++ H++ + Y+C    C  +   K N+L+H++
Sbjct: 86  CHMCVKSFRRHSWLKRHLLAHSSQRHYSCP--KCVSKHKRKDNLLQHLK 132

>Scas_649.28
          Length = 730

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 57/120 (47%), Gaps = 21/120 (17%)

Query: 165 PISGVSATSTQQIHQAQILPRRNSLPCFTASQTPPQQPLLNSPLHTRKNPYRGSAYKKNG 224
           P +  SAT + +    QI PRR      + S T P     NS  HT +   R S     G
Sbjct: 615 PTTASSATGSSK----QINPRRRKS---SISPTSPHNNSNNSTAHTSR---RASVSVTPG 664

Query: 225 SV--------CEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           S+        C  C K F+R   L+ H+  VH++++P+ C    C+K+F+   N+ +H++
Sbjct: 665 SLDDKNKPFKCSECIKAFRRSEHLKRHIRSVHSSERPFACMF--CEKKFSRSDNLSQHLK 722

>Kwal_47.16621
          Length = 1178

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           +C IC + F R   L+ H   H N+KP+ C    C + F  +  +LRH +K
Sbjct: 79  LCSICTRGFARQEHLKRHQRAHTNEKPFLCAF--CGRCFARRDLVLRHQQK 127

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 227 CEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           CE C + FKR   L+ H+  +H  +KPY C    C K+F+   N+ +H++
Sbjct: 266 CEFCDRRFKRQEHLKRHIRSLHMGEKPYEC--HICNKKFSRSDNLNQHIK 313

>CAGL0H07557g 738086..739516 some similarities with sp|P32805
           Saccharomyces cerevisiae YGL254w FZF1, hypothetical
           start
          Length = 476

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 226 VCEI--CGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRF 264
           VC+I  C ++F  PS L  H   H +++PY C+   C KRF
Sbjct: 58  VCQIDGCKREFSVPSLLAQHRNAHTDERPYVCDEPNCGKRF 98

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 30/67 (44%), Gaps = 14/67 (20%)

Query: 209 HTRKNPYRGSAYKKNGSVCEI--CGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNV 266
           HT + PY          VC+   CGK F RP  LR H   H   KP  C +  C++RF  
Sbjct: 81  HTDERPY----------VCDEPNCGKRFLRPCHLRVHKWTHAQVKPLKCSY--CERRFIT 128

Query: 267 KSNMLRH 273
              + RH
Sbjct: 129 NQQLKRH 135

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C +C K FKR S L+ H++ H+  + + C    C  R   + N+L+HM+
Sbjct: 536 CHLCPKLFKRKSWLKRHLLSHSQQRHFLCP--WCNSRHKRRDNLLQHMK 582

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           +C IC + F R   LR H   H N+KP+ C    C + F  +  +LRH +K
Sbjct: 84  LCPICTRGFARQEHLRRHERSHTNEKPFLCAF--CGRCFARRDLVLRHQQK 132

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 36.6 bits (83), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           +C IC + F R   L+ H   H N+KP+ C    C + F  +  +LRH +K
Sbjct: 49  LCPICTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRHQQK 97

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 220 YKKNGSV-CEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           Y KN    C+ C K F+R   L+ H+  VH+ ++P+ C    C+K+F+   N+ +H++
Sbjct: 567 YDKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLK 622

>Scas_687.33
          Length = 288

 Score = 36.6 bits (83), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C IC + F R    + H+  H  +KP+ C    C K F+    + RH+R
Sbjct: 19  CPICSRGFHRLEHKKRHVRTHTGEKPHPCTFAHCGKSFSRGDELKRHIR 67

>YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor of
           snf mutations, predicted transcription factor with two
           tandem C2H2-type zinc fingers, involved in glucose
           repression of MUC1 transcription [663 bp, 220 aa]
          Length = 220

 Score = 36.2 bits (82), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
            C+IC   F     L  H  +H  +K + C H GC +RF+   N  +H R
Sbjct: 154 FCKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDNCNQHYR 203

>Scas_631.7
          Length = 433

 Score = 36.6 bits (83), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 230 CGKDFKRPSALRTH-MVVHNNDKPYNCEHRGCQKRFNVKSNMLRHM 274
           C K F RPS L  H +  H   KP+ CE   C K+F+ K+++ RH+
Sbjct: 64  CTKAFTRPSLLSEHQLTFHQGIKPFKCEQ--CDKQFSRKTHLERHL 107

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRH 273
           CE C K F R + L  H++ H++ KP+ C H  C K    +  + RH
Sbjct: 90  CEQCDKQFSRKTHLERHLISHSDSKPFCCLH--CGKGVTTRQQLKRH 134

 Score = 34.3 bits (77), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNN---DKPYNCEHRGCQKRF 264
            C+ CGK F+RP  L+ H+  H+N     PY C    C + F
Sbjct: 172 TCKHCGKKFQRPYRLQNHIAKHHNPDVKTPYQCTFANCHRSF 213

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRH 273
           CE CG+ F + S L  H+  H+  KP++C    C K    +  + RH
Sbjct: 152 CEQCGRGFTKKSHLERHLFSHSETKPFSCT--VCGKGVTTRQQLRRH 196

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKP---YNCEHRGCQKRFNVKSNMLRHM 274
            C  C K F+RP  L+TH+  H+       Y C + GC + F   S + +H+
Sbjct: 234 TCTHCDKRFQRPYRLKTHIAKHHGPASQFRYQCTNAGCVQCFETWSALQQHL 285

 Score = 32.7 bits (73), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 2/38 (5%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRF 264
           C +CGK       LR H + H   K + C H GC + F
Sbjct: 180 CTVCGKGVTTRQQLRRHEITHT--KSFKCPHEGCGEAF 215

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 227 CEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C  C K F+R   L+ H+  VH+ ++P+ C    C+K+F+   N+ +H++
Sbjct: 486 CADCDKAFRRSEHLKRHVRSVHSTERPFPCMF--CEKKFSRSDNLSQHLK 533

>CAGL0E04884g complement(469295..473764) weakly similar to sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1489

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           VC+ C + F R   L  H   H  +KPY C    C +RF  +  +LRH  K
Sbjct: 31  VCQTCTRAFARQEHLTRHERSHTKEKPYCC--GICDRRFTRRDLLLRHAHK 79

>Kwal_47.17241
          Length = 403

 Score = 35.8 bits (81), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 227 CEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C+ C + FKR   L+ H+  +H  +KP++C    C K+F+   N+ +H++
Sbjct: 348 CDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHI--CGKKFSRSDNLNQHIK 395

>Scas_707.31
          Length = 289

 Score = 35.8 bits (81), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 226 VCEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
            C +C K FKR   L+ H   +H   +P+ C    C KRF+   N+ +H+R
Sbjct: 224 FCHLCKKRFKRHEHLKRHFRTIHLRVRPFECS--VCHKRFSRNDNLNQHVR 272

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 36.2 bits (82), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           +C +C + F R   L+ H   H N+KP+ C    C + F  +  +LRH +K
Sbjct: 81  LCPVCTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRHQQK 129

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 36.2 bits (82), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           +C IC + F R   L+ H   H ++KP+ C    C K F  K  +LRH++K
Sbjct: 28  LCPICSRGFVRQEHLKRHQNSHTHEKPFLC--LICGKCFARKDLVLRHLQK 76

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 35.8 bits (81), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           +C IC + F R   L+ H   H N+KP+ C    C + F  +  +LRH  K
Sbjct: 62  LCHICTRGFVRQEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRHQHK 110

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 35.4 bits (80), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 227 CEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           CE C + FKR   L+ H+  +H  +KPY C    C K+F+   N+ +H++
Sbjct: 420 CEYCDRRFKRQEHLKRHIRSLHICEKPYGCHL--CGKKFSRSDNLSQHLK 467

>Sklu_2126.5 YHL027W, Contig c2126 7763-9109
          Length = 448

 Score = 35.4 bits (80), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (54%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRG 259
           C  CGK FKRP  L+ H+ VH +D       RG
Sbjct: 120 CSTCGKKFKRPQDLKKHLRVHLDDGTTIKRKRG 152

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 34.7 bits (78), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           +C IC + F R   L+ H   H N+KP+ C    C + F  +  +LRH  K
Sbjct: 34  LCPICTRGFVRLEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRHQYK 82

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 2/38 (5%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRF 264
           C  CGK       L+ H V H   K +NCE+ GC + F
Sbjct: 97  CSFCGKGLITRQQLKRHEVTHT--KSFNCEYEGCNESF 132

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 5/52 (9%)

Query: 226 VCEI--CGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHM 274
           +CE   C K F RPS L  H   VH   KP+ C    C+  F  K ++ RH+
Sbjct: 37  LCEYDNCDKAFTRPSLLTEHQNTVHLGRKPWKCNQ--CESSFTKKIHLERHL 86

 Score = 32.0 bits (71), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 3/52 (5%)

Query: 227 CEICGKDFKRPSALRTHMVVHNN---DKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C  C K F+RP  L+ H+  H+N      Y C    C K F   S +  H++
Sbjct: 152 CHECNKSFQRPYRLKNHIAKHHNPDVVNAYQCTFSVCSKSFKTWSALRLHVK 203

>KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyces
           lactis RIM101 homologue, start by similarity
          Length = 517

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 18/33 (54%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRG 259
           C  C K FKRP  L+ H+ VHN +     + RG
Sbjct: 179 CSTCNKKFKRPQDLKKHLKVHNEELSLLKKKRG 211

>Scas_602.9
          Length = 547

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 227 CEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           C+ C + FKR   L+ H+  +H  +KPY C    C K F+   N+ +H++
Sbjct: 497 CDYCERRFKRQEHLKRHVRSLHIGEKPYAC--HICNKNFSRSDNLTQHIK 544

>CAGL0G08107g 768772..770649 weakly similar to tr|Q03833
           Saccharomyces cerevisiae YDR096w GIS1 DNA
           damage-responsive repressor of PHR1, hypothetical start
          Length = 625

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 7/53 (13%)

Query: 227 CEICGKDFKRPSA---LRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           CEIC  +F  PS+   +R    VH+ +KPYNC    C K F  K ++ +H++K
Sbjct: 564 CEICDHNF--PSSYHLIRHRNSVHSAEKPYNCP--ICSKGFKRKDHVSQHLKK 612

>Kwal_55.20634
          Length = 419

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 17/33 (51%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRG 259
           C  C K FKRP  L+ H+ VH  D+      RG
Sbjct: 124 CSTCTKTFKRPQDLKKHLKVHLEDETIVRRRRG 156

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 227 CEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           CE C + FKR   L+ H+  +H  +KP+ C    C K F+   N+ +H++
Sbjct: 391 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTC--HICNKNFSRSDNLNQHVK 438

>AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W
           (GIS1) - SH] (964417..966816) [2400 bp, 799 aa]
          Length = 799

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 8/62 (12%)

Query: 216 RGSAYKKNGSVCEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHM 274
           +G AY     VC+ C + F     L  H   VH+ +KP++C    C K+F  + ++L+H+
Sbjct: 728 KGKAY-----VCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQHL 780

Query: 275 RK 276
            K
Sbjct: 781 NK 782

>YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsive
           repressor of PHR1, contains two C2H2-type zinc finger
           domains [2391 bp, 796 aa]
          Length = 796

 Score = 32.7 bits (73), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 4/73 (5%)

Query: 206 SPLHTRKNPYRGSAYKKNGS-VCEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKR 263
           SPL+++  P       KN   +C+ C + F     L  H   VH+ +KP++C    C KR
Sbjct: 689 SPLNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPK--CGKR 746

Query: 264 FNVKSNMLRHMRK 276
           F  + ++L+H+ K
Sbjct: 747 FKRRDHVLQHLNK 759

>Scas_703.23
          Length = 1341

 Score = 32.7 bits (73), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           +C  C + F R   L+ H   H N+KP+ C    C + F  +  +LRH  K
Sbjct: 73  LCPTCTRGFVRQEHLKRHQRSHTNEKPFLCVF--CGRCFARRDLVLRHQHK 121

>KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces
           cerevisiae YER169w RPH1, start by similarity
          Length = 821

 Score = 32.3 bits (72), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 226 VCEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           VC+ C + F     L  H   VH+ +KP++C    C K+F  + ++L+H+ K
Sbjct: 756 VCQECARQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQHLNK 805

>Scas_551.1
          Length = 332

 Score = 31.6 bits (70), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 11/66 (16%)

Query: 178 HQAQILPRRNSLPCFTASQTPPQQPLLNSPLHTRKNPYRGSAYKKNGSVCEICGKDFKRP 237
           HQ Q L + N    FT       +P  ++  + +  PYR          CE+CGK +K  
Sbjct: 42  HQNQKL-QENPDGTFTILDPDSNEPFFDNAGNAKDKPYR----------CEVCGKRYKNL 90

Query: 238 SALRTH 243
           + L+ H
Sbjct: 91  NGLKYH 96

>CAGL0L11880g 1272624..1275566 some similarities with sp|P39956
           Saccharomyces cerevisiae YER169w, hypothetical start
          Length = 980

 Score = 31.6 bits (70), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 226 VCEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           VC+ C + F     L  H   VH+ +KP++C    C KRF  + ++L+H+ K
Sbjct: 903 VCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKRFKRRDHVLQHLNK 952

>CAGL0E03762g complement(351003..352757) weakly similar to sp|P33400
           Saccharomyces cerevisiae YHL027w RIM101 meiotic
           regulatory protein, hypothetical start
          Length = 584

 Score = 31.2 bits (69), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 5/47 (10%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNC--EHRGCQ---KRFNVKS 268
           C  C K FKRP  L+ H+ +H +D   +   + RG +   KR N KS
Sbjct: 221 CSTCSKRFKRPQDLKKHLKIHLSDLGIDAPKKKRGPKVGSKRVNSKS 267

>AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH]
           (783110..784408) [1299 bp, 432 aa]
          Length = 432

 Score = 31.2 bits (69), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 14/24 (58%)

Query: 227 CEICGKDFKRPSALRTHMVVHNND 250
           C  C + FKRP  L+ H+ VH  D
Sbjct: 138 CSTCSRKFKRPQDLKKHLKVHMED 161

>YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive
           repressor of PHR1, has two tandem C2H2-type zinc finger
           domains [2685 bp, 894 aa]
          Length = 894

 Score = 31.2 bits (69), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 226 VCEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           +C  C + F     L  H   VH+ +KP++C    C KRF  + ++L+H+ K
Sbjct: 829 ICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPR--CGKRFKRRDHVLQHLNK 878

>AGR365C [4676] [Homologous to ScYDR323C (PEP7) - SH]
          (1404996..1406564) [1569 bp, 522 aa]
          Length = 522

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 23/50 (46%)

Query: 7  MHPDSCHNYCAATAMSADVHVRNSHQLQPSDLAVAASHPISGGGSYHYYP 56
          MH D  HN+    ++S D    N     P+ + +A+S   SG    HY P
Sbjct: 43 MHLDVEHNFKDERSLSTDSGSVNIASTTPTSVGLASSRETSGRNRSHYKP 92

>Kwal_56.23453
          Length = 828

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 226 VCEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           VC+ C + F     L  H   VH+ +KP++C    C K+F  + ++L+H+ K
Sbjct: 736 VCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQHLNK 785

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           +C  C + F R   L+ H   H  +KPY C    C + F  +  +LRH +K
Sbjct: 152 LCPTCTRGFVRQEHLKRHQHSHTREKPYLCIF--CGRCFARRDLVLRHQQK 200

>CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 189

 Score = 29.6 bits (65), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 44/106 (41%), Gaps = 20/106 (18%)

Query: 178 HQAQILP------RRNSLPCFTASQTPPQQPLLNSPLHTRKNPYRGSAYKKNGSV--CEI 229
           H  QI+P      RR      TAS  PP   L ++  HTR+        + N  +  C I
Sbjct: 74  HVEQIIPSITAQVRREKSGIKTASIEPPNY-LYDNGKHTRR--------RSNQKIYPCNI 124

Query: 230 CGKDFKRPSALRTHMVVHNNDKPYN-CEHRGCQKRFNVKSNMLRHM 274
           CG  + + + LR H    +  K  N C    C K+F  K  + RH 
Sbjct: 125 CGISYDKLTDLRKHERASHEPKQENVC--MNCGKKFARKDALKRHF 168

>YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor
           involved in induction of IME1, IME2, DIT1, and DIT2
           transcription, has three C2H2-type zinc fingers [1878
           bp, 625 aa]
          Length = 625

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 10/21 (47%), Positives = 13/21 (61%)

Query: 227 CEICGKDFKRPSALRTHMVVH 247
           C  C K FKRP  L+ H+ +H
Sbjct: 214 CSTCSKKFKRPQDLKKHLKIH 234

>YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protein
           involved in transcriptional regulation of methionine
           metabolism, has two tandem C2H2-type zinc fingers [534
           bp, 177 aa]
          Length = 177

 Score = 29.3 bits (64), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 5/60 (8%)

Query: 217 GSAYKKNGS---VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRH 273
           G+ + K G+    C  C   F R S LR H  VH+   P+ C +  C K F  K  + RH
Sbjct: 84  GNNHSKEGAQLYSCAKCQLKFSRSSDLRRHEKVHSLVLPHICSN--CGKGFARKDALKRH 141

>Kwal_47.16577
          Length = 881

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 5/50 (10%)

Query: 230 CGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFN----VKSNMLRHMR 275
           C K F R   L  H   H+++K Y CE   C + F+     K +  RH+R
Sbjct: 20  CSKSFSRSDHLGRHKANHSSEK-YKCEWPACGREFSRLDVKKKHFGRHLR 68

>Scas_683.25
          Length = 879

 Score = 29.3 bits (64), Expect = 3.9,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 2/50 (4%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           +C  C K F R      H   H   KPY C  + C   F      LRH++
Sbjct: 16  ICSFCAKGFSRAEHKIRHERSHTGLKPYKC--KVCTHCFVRSDLALRHIK 63

>Kwal_26.8109
          Length = 970

 Score = 29.3 bits (64), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 49/127 (38%), Gaps = 34/127 (26%)

Query: 113 VMLPPIQVAHYLPQ-----------------QRQYE----HMYAQDKSGHSSVLDSPRMT 151
           V LPP+  AHYLPQ                 Q+Q+     H Y Q +      + S    
Sbjct: 121 VSLPPL--AHYLPQPGAPTRLQSFLGSRAQPQQQFWKVPYHEYQQQRRSSVDSMASDASN 178

Query: 152 PLIMLNVSSPPANPISGVSATSTQQIHQAQILP---------RRNS--LPCFTASQTPPQ 200
            +    ++ PP+   SG    S  Q+H  Q LP         RRNS  LP F    TPP 
Sbjct: 179 RVGSEQLAYPPSQASSGSQLYSMPQLHGPQRLPEAENGVSDDRRNSLNLPSFHRVSTPPA 238

Query: 201 QPLLNSP 207
              L+ P
Sbjct: 239 GGYLHYP 245

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 29.3 bits (64), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 22/50 (44%), Gaps = 2/50 (4%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           +C  C + F R      H   H   KP++C  + C   F  +  + RH+R
Sbjct: 9   ICSFCAQAFSRSEHKTRHERSHTGVKPFSC--KVCNHSFVRRDLLQRHIR 56

>CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 or tr|Q03081
           Saccharomyces cerevisiae YPL038w MET31, hypothetical
           start
          Length = 223

 Score = 28.5 bits (62), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 2/47 (4%)

Query: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRH 273
           C  C   F R S LR H   H    PY C    C K F  K  + RH
Sbjct: 144 CSQCSLKFNRSSDLRRHERAHLLVLPYICTQ--CGKGFARKDALKRH 188

>Scas_681.19
          Length = 864

 Score = 28.9 bits (63), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 226 VCEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276
           VC  C + F     L  H   VH+ +KP++C    C K+F  + ++L+H+ K
Sbjct: 766 VCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQHLNK 815

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 28.5 bits (62), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 21/50 (42%), Gaps = 2/50 (4%)

Query: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275
           +C  C K F R      H   H   KP++C    C   F  +  + RH+R
Sbjct: 9   ICSFCAKPFSRSEHKARHERSHTGSKPFSCS--ICSHSFVRRDLLQRHIR 56

>CAGL0L06072g complement(679924..680826) some similarities with
           sp|P39959 Saccharomyces cerevisiae YER130c or sp|P33749
           Saccharomyces cerevisiae YKL062w MSN4 transcriptional
           activator, hypothetical start
          Length = 300

 Score = 28.1 bits (61), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 10/47 (21%)

Query: 206 SPLHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKP 252
           S LH  + PY           C+IC K F R   L  H   HNN  P
Sbjct: 238 SSLHMGERPYS----------CDICLKSFSRSDNLNQHKRTHNNPHP 274

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.129    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,246,553
Number of extensions: 320537
Number of successful extensions: 1339
Number of sequences better than 10.0: 195
Number of HSP's gapped: 1284
Number of HSP's successfully gapped: 257
Length of query: 276
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 176
Effective length of database: 13,134,309
Effective search space: 2311638384
Effective search space used: 2311638384
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)