Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL041C99794212e-55
Sklu_2189.295793353e-42
KLLA0D03971g99793312e-41
YLL018C-A (COX19)98793172e-39
Scas_347.289793127e-39
CAGL0D06578g86782981e-36
Sklu_2371.447836601.4
KLLA0B08679g36337601.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL041C
         (98 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL041C [1700] [Homologous to ScYLL018C-A (COX19) - SH] (617549....   166   2e-55
Sklu_2189.2 YLL018C-A, Contig c2189 4754-5041 reverse complement      133   3e-42
KLLA0D03971g 334691..334990 similar to sgd|S0007245 Saccharomyce...   132   2e-41
YLL018C-A (COX19) [3400] chr12 complement(108675..108971) Protei...   126   2e-39
Scas_347.2                                                            124   7e-39
CAGL0D06578g 625655..625915 no similarity, hypothetical start         119   1e-36
Sklu_2371.4 YDR030C, Contig c2371 8070-9506 reverse complement         28   1.4  
KLLA0B08679g 767808..768899 weakly similar to sgd|S0005415 Sacch...    28   1.6  

>ADL041C [1700] [Homologous to ScYLL018C-A (COX19) - SH]
          (617549..617848) [300 bp, 99 aa]
          Length = 99

 Score =  166 bits (421), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%)

Query: 1  MSGNPVSALHALSPTPSERGLFPLDHEGECTAHMMEYLNCMKLVRGENAPNCRLLVRNYL 60
          MSGNPVSALHALSPTPSERGLFPLDHEGECTAHMMEYLNCMKLVRGENAPNCRLLVRNYL
Sbjct: 1  MSGNPVSALHALSPTPSERGLFPLDHEGECTAHMMEYLNCMKLVRGENAPNCRLLVRNYL 60

Query: 61 KCRMDHRLMDRDEWAHLGL 79
          KCRMDHRLMDRDEWAHLGL
Sbjct: 61 KCRMDHRLMDRDEWAHLGL 79

>Sklu_2189.2 YLL018C-A, Contig c2189 4754-5041 reverse complement
          Length = 95

 Score =  133 bits (335), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 59/79 (74%), Positives = 69/79 (87%)

Query: 1  MSGNPVSALHALSPTPSERGLFPLDHEGECTAHMMEYLNCMKLVRGENAPNCRLLVRNYL 60
          MSGNP ++L ALSPTP ERG FPLDH+GEC+  M +YL C+KLVRGENAPNCRLL +NYL
Sbjct: 1  MSGNPGNSLRALSPTPPERGSFPLDHDGECSKQMQDYLQCIKLVRGENAPNCRLLAKNYL 60

Query: 61 KCRMDHRLMDRDEWAHLGL 79
          KCRMD++LMDRDEW +LGL
Sbjct: 61 KCRMDNQLMDRDEWKNLGL 79

>KLLA0D03971g 334691..334990 similar to sgd|S0007245 Saccharomyces
          cerevisiae YLL018ca COX19, start by similarity
          Length = 99

 Score =  132 bits (331), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 68/79 (86%)

Query: 1  MSGNPVSALHALSPTPSERGLFPLDHEGECTAHMMEYLNCMKLVRGENAPNCRLLVRNYL 60
          MS NP ++L ALSPTP ERG FPLDH+G+CT  M EYL+C+KLV+GENAPNCRLL + YL
Sbjct: 1  MSANPGNSLKALSPTPPERGSFPLDHDGDCTKQMQEYLSCIKLVKGENAPNCRLLAKEYL 60

Query: 61 KCRMDHRLMDRDEWAHLGL 79
          KCRMD++LMDRD+W HLGL
Sbjct: 61 KCRMDNKLMDRDDWKHLGL 79

>YLL018C-A (COX19) [3400] chr12 complement(108675..108971) Protein
          that may function in metal transport required for
          cytochrome oxidase assembly, localizes to the
          mitochondrial intermembrane space and to the cytoplasm
          [297 bp, 98 aa]
          Length = 98

 Score =  126 bits (317), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 67/79 (84%)

Query: 1  MSGNPVSALHALSPTPSERGLFPLDHEGECTAHMMEYLNCMKLVRGENAPNCRLLVRNYL 60
          MSGNP S+L AL PTP ERG FPLDH+GECT +M EYL CM+LV+ ENA NCRLL ++YL
Sbjct: 1  MSGNPGSSLSALRPTPPERGSFPLDHDGECTKYMQEYLKCMQLVQNENAMNCRLLAKDYL 60

Query: 61 KCRMDHRLMDRDEWAHLGL 79
          +CRMDH+LMD DEW+HLGL
Sbjct: 61 RCRMDHQLMDYDEWSHLGL 79

>Scas_347.2
          Length = 89

 Score =  124 bits (312), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 56/79 (70%), Positives = 65/79 (82%)

Query: 1  MSGNPVSALHALSPTPSERGLFPLDHEGECTAHMMEYLNCMKLVRGENAPNCRLLVRNYL 60
          MSGNP S+L ALSPTP ERG FPLDH+ EC   M  YL CMKLV+G+NAPNCRLL + YL
Sbjct: 1  MSGNPGSSLRALSPTPPERGSFPLDHDNECFQQMSAYLECMKLVKGQNAPNCRLLAKEYL 60

Query: 61 KCRMDHRLMDRDEWAHLGL 79
          +CRMDH+LMD D+W+HLGL
Sbjct: 61 QCRMDHQLMDVDDWSHLGL 79

>CAGL0D06578g 625655..625915 no similarity, hypothetical start
          Length = 86

 Score =  119 bits (298), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (80%)

Query: 2  SGNPVSALHALSPTPSERGLFPLDHEGECTAHMMEYLNCMKLVRGENAPNCRLLVRNYLK 61
          SGNP  AL ALSPTP ERG FPLDH+GEC  +M +YL CM+L   ENA NCRLL ++YLK
Sbjct: 3  SGNPGGALRALSPTPPERGSFPLDHDGECAEYMQKYLQCMRLAANENAHNCRLLAKDYLK 62

Query: 62 CRMDHRLMDRDEWAHLGL 79
          CRMDH+LMD+DEW +LGL
Sbjct: 63 CRMDHQLMDKDEWKNLGL 80

>Sklu_2371.4 YDR030C, Contig c2371 8070-9506 reverse complement
          Length = 478

 Score = 27.7 bits (60), Expect = 1.4,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 6/36 (16%)

Query: 45  RGENAPNCRL------LVRNYLKCRMDHRLMDRDEW 74
           R  + P CRL      L+RN  + R  HRLM  D +
Sbjct: 370 RNTSEPRCRLQLGDTNLMRNKYRMRTSHRLMWHDRY 405

>KLLA0B08679g 767808..768899 weakly similar to sgd|S0005415
           Saccharomyces cerevisiae YOL054w, start by similarity
          Length = 363

 Score = 27.7 bits (60), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 18/37 (48%)

Query: 39  NCMKLVRGENAPNCRLLVRNYLKCRMDHRLMDRDEWA 75
           NC   V G   PNC   +RNY     +   +D DE++
Sbjct: 158 NCQWEVEGPVCPNCNATIRNYNAGAQNFDEVDVDEYS 194

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.137    0.451 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,811,162
Number of extensions: 93964
Number of successful extensions: 154
Number of sequences better than 10.0: 8
Number of HSP's gapped: 154
Number of HSP's successfully gapped: 8
Length of query: 98
Length of database: 16,596,109
Length adjustment: 69
Effective length of query: 29
Effective length of database: 14,207,467
Effective search space: 412016543
Effective search space used: 412016543
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 54 (25.4 bits)