Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL030C24524112571e-178
CAGL0K02497g24524112221e-172
Sklu_1537.124524112161e-172
Kwal_14.219124524112131e-171
YPR016C (TIF6)24524112131e-171
Scas_602.524524112071e-170
KLLA0D02046g24524112051e-170
AER159C119167760.13
Kwal_26.668041691690.64
YKR031C (SPO14)168343662.4
Kwal_56.2228556758633.8
Kwal_55.1958256758633.9
Kwal_33.1303333245633.9
YPL006W (NCR1)117030634.4
Sklu_2255.262556634.9
YGL236C (MTO1)67961626.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL030C
         (241 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL030C [1712] [Homologous to ScYPR016C (TIF6) - SH] (647423..64...   488   e-178
CAGL0K02497g 225229..225966 highly similar to sp|Q12522 Saccharo...   475   e-172
Sklu_1537.1 YPR016C, Contig c1537 383-1120 reverse complement         473   e-172
Kwal_14.2191                                                          471   e-171
YPR016C (TIF6) [5450] chr16 complement(592327..593064) Translati...   471   e-171
Scas_602.5                                                            469   e-170
KLLA0D02046g complement(175907..176644) highly similar to sp|Q12...   468   e-170
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    34   0.13 
Kwal_26.6680                                                           31   0.64 
YKR031C (SPO14) [3286] chr11 complement(500986..506037) Phosphol...    30   2.4  
Kwal_56.22285                                                          29   3.8  
Kwal_55.19582                                                          29   3.9  
Kwal_33.13033                                                          29   3.9  
YPL006W (NCR1) [5431] chr16 (544626..548138) Protein involved in...    29   4.4  
Sklu_2255.2 YLR353W, Contig c2255 1532-3409 reverse complement         29   4.9  
YGL236C (MTO1) [1763] chr7 complement(53756..55795) Protein with...    28   6.6  

>ADL030C [1712] [Homologous to ScYPR016C (TIF6) - SH]
           (647423..648160) [738 bp, 245 aa]
          Length = 245

 Score =  488 bits (1257), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 241/241 (100%), Positives = 241/241 (100%)

Query: 1   MATRTQFENSNEVGVFSKLTNTYCLVTIGGSENFYSAFEAELGDAIPIVHTTIAGTRIVG 60
           MATRTQFENSNEVGVFSKLTNTYCLVTIGGSENFYSAFEAELGDAIPIVHTTIAGTRIVG
Sbjct: 1   MATRTQFENSNEVGVFSKLTNTYCLVTIGGSENFYSAFEAELGDAIPIVHTTIAGTRIVG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRIEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRIEERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRIEERLSALGNVICCNDYVALVHPD 120

Query: 121 IDNETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP 180
           IDNETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP
Sbjct: 121 IDNETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP 180

Query: 181 LVAGTINRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDANPDAISGNLRDTL 240
           LVAGTINRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDANPDAISGNLRDTL
Sbjct: 181 LVAGTINRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDANPDAISGNLRDTL 240

Query: 241 I 241
           I
Sbjct: 241 I 241

>CAGL0K02497g 225229..225966 highly similar to sp|Q12522
           Saccharomyces cerevisiae YPR016c Eukaryotic translation
           initiation factor 6, start by similarity
          Length = 245

 Score =  475 bits (1222), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 230/241 (95%), Positives = 237/241 (98%)

Query: 1   MATRTQFENSNEVGVFSKLTNTYCLVTIGGSENFYSAFEAELGDAIPIVHTTIAGTRIVG 60
           MATRTQFENSNEVGVFSKLTNTYCLV +GGSENFYSAFEAELGD+IPI HTTIAGTRIVG
Sbjct: 1   MATRTQFENSNEVGVFSKLTNTYCLVAVGGSENFYSAFEAELGDSIPIAHTTIAGTRIVG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRIEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQR+EERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 IDNETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP 180
           ID ETEELI+DVLGVEVFRQTISGN+LVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP
Sbjct: 121 IDRETEELISDVLGVEVFRQTISGNILVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP 180

Query: 181 LVAGTINRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDANPDAISGNLRDTL 240
           LVAGT+NRGS+VVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDA PDAISGNLRDTL
Sbjct: 181 LVAGTVNRGSAVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPDAISGNLRDTL 240

Query: 241 I 241
           I
Sbjct: 241 I 241

>Sklu_1537.1 YPR016C, Contig c1537 383-1120 reverse complement
          Length = 245

 Score =  473 bits (1216), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 229/241 (95%), Positives = 237/241 (98%)

Query: 1   MATRTQFENSNEVGVFSKLTNTYCLVTIGGSENFYSAFEAELGDAIPIVHTTIAGTRIVG 60
           MATRTQFENSNEVGVFSKLTN+YCLV +GGSENFYSAFEAELGDAIPI HTTIAGTRI+G
Sbjct: 1   MATRTQFENSNEVGVFSKLTNSYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRIIG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRIEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQR+EERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 IDNETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP 180
           ID ETEELIADVLGVEVFRQTISGNVLVGSYC+LSNQGGLVHPQTTIQDQEELSSLLQVP
Sbjct: 121 IDRETEELIADVLGVEVFRQTISGNVLVGSYCSLSNQGGLVHPQTTIQDQEELSSLLQVP 180

Query: 181 LVAGTINRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDANPDAISGNLRDTL 240
           LVAGT+NRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDA P++ISGNLRDTL
Sbjct: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240

Query: 241 I 241
           I
Sbjct: 241 I 241

>Kwal_14.2191
          Length = 245

 Score =  471 bits (1213), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 227/241 (94%), Positives = 238/241 (98%)

Query: 1   MATRTQFENSNEVGVFSKLTNTYCLVTIGGSENFYSAFEAELGDAIPIVHTTIAGTRIVG 60
           MA+RTQFENSNEVGVFSKLTN+YCLVT+GGSENFYSAFEAELGDAIP+VHTTIAGTRI+G
Sbjct: 1   MASRTQFENSNEVGVFSKLTNSYCLVTVGGSENFYSAFEAELGDAIPMVHTTIAGTRIIG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRIEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQEL HLRNSLPDSVKIQR+EERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELHHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 IDNETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP 180
           +D ETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQT+IQDQEELSSLLQVP
Sbjct: 121 VDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTSIQDQEELSSLLQVP 180

Query: 181 LVAGTINRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDANPDAISGNLRDTL 240
           LVAGT+NRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDA P++ISGNLRDTL
Sbjct: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240

Query: 241 I 241
           I
Sbjct: 241 I 241

>YPR016C (TIF6) [5450] chr16 complement(592327..593064) Translation
           initiation factor 6 (eIF6), nuclear protein required for
           transit of pre-60S ribosomal subunits from the nucleus
           to the cytoplasm [738 bp, 245 aa]
          Length = 245

 Score =  471 bits (1213), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 226/241 (93%), Positives = 238/241 (98%)

Query: 1   MATRTQFENSNEVGVFSKLTNTYCLVTIGGSENFYSAFEAELGDAIPIVHTTIAGTRIVG 60
           MATRTQFENSNE+GVFSKLTNTYCLV +GGSENFYSAFEAELGDAIPIVHTTIAGTRI+G
Sbjct: 1   MATRTQFENSNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGDAIPIVHTTIAGTRIIG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRIEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQR+EERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 IDNETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP 180
           ID ETEELI+DVLGVEVFRQTISGN+LVGSYC+LSNQGGLVHPQT++QDQEELSSLLQVP
Sbjct: 121 IDRETEELISDVLGVEVFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSLLQVP 180

Query: 181 LVAGTINRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDANPDAISGNLRDTL 240
           LVAGT+NRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDA P++ISGNLRDTL
Sbjct: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240

Query: 241 I 241
           I
Sbjct: 241 I 241

>Scas_602.5
          Length = 245

 Score =  469 bits (1207), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 226/241 (93%), Positives = 236/241 (97%)

Query: 1   MATRTQFENSNEVGVFSKLTNTYCLVTIGGSENFYSAFEAELGDAIPIVHTTIAGTRIVG 60
           MATRTQFENSNE+GVFSKLTNTYCLV +GGSENFYSAFEAELGDAIPI HTTIAGTRI+G
Sbjct: 1   MATRTQFENSNEIGVFSKLTNTYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRIIG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRIEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQELQHLRN LPDSVKIQR+EERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNCLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 IDNETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP 180
           ID ETEELI+DVLGVEVFRQTISGN+LVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP
Sbjct: 121 IDRETEELISDVLGVEVFRQTISGNILVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP 180

Query: 181 LVAGTINRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDANPDAISGNLRDTL 240
           LVAGT+NRGS+VVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDA P++ISGNLRDTL
Sbjct: 181 LVAGTVNRGSAVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240

Query: 241 I 241
           I
Sbjct: 241 I 241

>KLLA0D02046g complement(175907..176644) highly similar to sp|Q12522
           Saccharomyces cerevisiae YPR016c TIF6 translation
           initiation factor 6 (eIF6) singleton, start by
           similarity
          Length = 245

 Score =  468 bits (1205), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 226/241 (93%), Positives = 235/241 (97%)

Query: 1   MATRTQFENSNEVGVFSKLTNTYCLVTIGGSENFYSAFEAELGDAIPIVHTTIAGTRIVG 60
           MATRTQFENSNE+GVFSKLTN+YCLV +GGSENFYSAFEAELGDAIPI HTTIAGTRIVG
Sbjct: 1   MATRTQFENSNEIGVFSKLTNSYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRIVG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRIEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQELQHLRN LPD+VK+QR+EERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNCLPDAVKVQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 IDNETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP 180
           ID ETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTT+QDQEELSSLLQVP
Sbjct: 121 IDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTVQDQEELSSLLQVP 180

Query: 181 LVAGTINRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDANPDAISGNLRDTL 240
           LVAGT+NRGS VVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDA P+AISGNLRDTL
Sbjct: 181 LVAGTVNRGSQVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPEAISGNLRDTL 240

Query: 241 I 241
           I
Sbjct: 241 I 241

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 33.9 bits (76), Expect = 0.13,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 30/67 (44%), Gaps = 7/67 (10%)

Query: 149 GSYCALSNQGGLVHPQTTIQDQEELSSLLQVPLVAGTINRGSSVVGAGMVVNDYLAVTGL 208
           G   A S+ G LV P      +    +L+  PL+   +  GSSV GAG         TG+
Sbjct: 314 GEQRATSDTGTLVMPSMRASHEFIAPTLVHTPLIMDFLQIGSSVGGAG-------GFTGV 366

Query: 209 DTTAPEL 215
           DT  P L
Sbjct: 367 DTADPTL 373

>Kwal_26.6680
          Length = 416

 Score = 31.2 bits (69), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 43/91 (47%), Gaps = 17/91 (18%)

Query: 119 PDIDNETEELIADV----------------LGVEVFRQTISGNVLVGSYCALSNQGGLVH 162
           P++  ET+ ++A V                +  +V ++ I+G +L+ S+  L+ +    +
Sbjct: 141 PEVQEETDLIVAGVEAQREQGEASWGELFSVKTKVLQRLITG-ILMQSFLQLTGENYFFY 199

Query: 163 PQTTIQDQEELSSLLQVPLVAGTINRGSSVV 193
             TTI D   L+   Q  +V GT+N  SS +
Sbjct: 200 YGTTIFDSIGLTDSFQTSIVLGTVNLASSFI 230

>YKR031C (SPO14) [3286] chr11 complement(500986..506037)
           Phospholipase D, catalyzes hydrolysis of
           phosphatidylcholine to yield phosphatidic acid and
           choline [5052 bp, 1683 aa]
          Length = 1683

 Score = 30.0 bits (66), Expect = 2.4,   Method: Composition-based stats.
 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 1   MATRTQFENSNEVGVFSKL-TNTYCLVTIGGSENFYSAFEAEL 42
           M+T T +   N  G F+ + TN++C   + G + F+S  EA L
Sbjct: 660 MSTSTPWSKPNRFGSFAPVRTNSFCKFLVDGRDYFWSLSEALL 702

>Kwal_56.22285
          Length = 567

 Score = 28.9 bits (63), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 136 EVFRQTISGNVLVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVPLVAGTINRGSSVV 193
           +VF++ I+G +L+ S+  L+ +    +  TTI     L+   Q  +V GT+N  SS +
Sbjct: 319 KVFQRLITG-ILMQSFLQLTGENYFFYYGTTIFKSIGLTDSFQTSIVLGTVNFFSSFL 375

>Kwal_55.19582
          Length = 567

 Score = 28.9 bits (63), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 136 EVFRQTISGNVLVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVPLVAGTINRGSSVV 193
           +VF++ I+G +L+ S+  L+ +    +  TTI     L+   Q  +V GT+N  SS +
Sbjct: 319 KVFQRLITG-ILMQSFLQLTGENYFFYYGTTIFKSIGLTDSFQTSIVLGTVNFFSSFL 375

>Kwal_33.13033
          Length = 332

 Score = 28.9 bits (63), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 2/45 (4%)

Query: 63  TAGNRRGLLVPTQ-TTDQELQHLRNSLPDSVKIQRIEERLSALGN 106
           T+G +  +  PT+  TD + + + N LPDSV++Q +++RL    N
Sbjct: 233 TSGYKSEITNPTEYDTDCDYRKISN-LPDSVRLQNLKDRLCRAKN 276

>YPL006W (NCR1) [5431] chr16 (544626..548138) Protein involved in
           sterol homeostasis and trafficking [3513 bp, 1170 aa]
          Length = 1170

 Score = 28.9 bits (63), Expect = 4.4,   Method: Composition-based stats.
 Identities = 14/30 (46%), Positives = 17/30 (56%)

Query: 20  TNTYCLVTIGGSENFYSAFEAELGDAIPIV 49
           TN Y +  IGG    YS F   LGDA P++
Sbjct: 164 TNGYAMDLIGGGAKNYSQFLKFLGDAKPML 193

>Sklu_2255.2 YLR353W, Contig c2255 1532-3409 reverse complement
          Length = 625

 Score = 28.9 bits (63), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 5/56 (8%)

Query: 177 LQVPLVAGTINRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDANPDAI 232
           L+ PL+ GT NR S +        DY      DT  P++     +F+++  NP  +
Sbjct: 300 LEPPLILGTQNRYSGIASFDDSYLDY-----KDTLNPQIEHAVKLFKMEMKNPQTV 350

>YGL236C (MTO1) [1763] chr7 complement(53756..55795) Protein with a
           role in mitochondrial translational accuracy, has strong
           similarity to E. coli gidA protein [2040 bp, 679 aa]
          Length = 679

 Score = 28.5 bits (62), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 4/61 (6%)

Query: 35  YSAFEAELGDAIPIVHTTIAGTRIVGRMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKI 94
           +SA E + GDA+P+  + +  T  V      +  G    T TT Q    LRN+L  S+ I
Sbjct: 251 FSALEVQKGDALPVPMSFLNETVSVEPTKQLDCFG----THTTPQMHDFLRNNLHQSIHI 306

Query: 95  Q 95
           Q
Sbjct: 307 Q 307

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,405,431
Number of extensions: 299997
Number of successful extensions: 859
Number of sequences better than 10.0: 16
Number of HSP's gapped: 844
Number of HSP's successfully gapped: 16
Length of query: 241
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 142
Effective length of database: 13,168,927
Effective search space: 1869987634
Effective search space used: 1869987634
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)