Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL026W88887244270.0
Kwal_14.217590988632880.0
KLLA0C17512g89288332860.0
Scas_707.4492990032720.0
YPR019W (CDC54)93390432690.0
CAGL0K02431g92490531980.0
KLLA0E23276g8265618831e-105
ADR041W8136178821e-105
CAGL0J06424g9725868791e-103
AGR276W7347088491e-101
CAGL0F04939g7727348511e-101
Scas_590.67677788451e-100
Kwal_56.232827617218441e-100
YGL201C (MCM6)10176708601e-100
KLLA0F10087g10035958571e-100
CAGL0M05423g8125238378e-99
Scas_712.4910195868462e-98
Scas_721.368555238338e-98
Kwal_27.120028335888273e-97
Kwal_47.1896610445908384e-97
AFR546W10055848233e-95
KLLA0D09262g7466928074e-95
YLR274W (CDC46)7757328051e-94
YBR202W (CDC47)8455598091e-94
Sklu_2098.48465538031e-93
Sklu_1863.19545908063e-93
KLLA0E22330g9317187887e-91
KLLA0F12584g8776657831e-90
Scas_710.218746857742e-89
CAGL0J04444g8796717673e-88
AFR178W8856767631e-87
Kwal_14.20908606727532e-86
YBL023C (MCM2)8686787532e-86
Sklu_2087.48846917453e-85
Kwal_27.101749456637467e-85
YEL032W (MCM3)9715887328e-83
Scas_499.29855837101e-79
CAGL0L01397g9456587001e-78
AFR355C9435896895e-77
KLLA0D06171g804148703.1
Scas_716.15105286686.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL026W
         (872 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL026W [1716] [Homologous to ScYPR019W (CDC54) - SH] complement...  1709   0.0  
Kwal_14.2175                                                         1271   0.0  
KLLA0C17512g complement(1537707..1540385) similar to sp|P30665 S...  1270   0.0  
Scas_707.44                                                          1264   0.0  
YPR019W (CDC54) [5453] chr16 (596745..599546) Protein involved i...  1263   0.0  
CAGL0K02431g complement(219027..221801) highly similar to sp|P30...  1236   0.0  
KLLA0E23276g complement(2065845..2068325) similar to sp|P38132 S...   344   e-105
ADR041W [1782] [Homologous to ScYBR202W (CDC47) - SH] complement...   344   e-105
CAGL0J06424g complement(611935..614853) highly similar to sp|P53...   343   e-103
AGR276W [4587] [Homologous to ScYLR274W (CDC46) - SH] complement...   331   e-101
CAGL0F04939g 503890..506208 highly similar to sp|P29496 Saccharo...   332   e-101
Scas_590.6                                                            330   e-100
Kwal_56.23282                                                         329   e-100
YGL201C (MCM6) [1794] chr7 complement(117856..120909) Protein in...   335   e-100
KLLA0F10087g complement(935618..938629) similar to sp|P53091 Sac...   334   e-100
CAGL0M05423g 577097..579535 highly similar to sp|P38132 Saccharo...   327   8e-99
Scas_712.49                                                           330   2e-98
Scas_721.36                                                           325   8e-98
Kwal_27.12002                                                         323   3e-97
Kwal_47.18966                                                         327   4e-97
AFR546W [3738] [Homologous to ScYGL201C (MCM6) - SH] complement(...   321   3e-95
KLLA0D09262g 780273..782513 similar to sp|P29496 Saccharomyces c...   315   4e-95
YLR274W (CDC46) [3667] chr12 (691557..693884) Member of the MCM/...   314   1e-94
YBR202W (CDC47) [385] chr2 (625729..628266) Member of MCM/P1 fam...   316   1e-94
Sklu_2098.4 YBR202W, Contig c2098 6426-8966 reverse complement        313   1e-93
Sklu_1863.1 YEL032W, Contig c1863 2885-5749                           315   3e-93
KLLA0E22330g 1981275..1984070 similar to sp|P24279 Saccharomyces...   308   7e-91
KLLA0F12584g complement(1165710..1168343) similar to sp|P29469 S...   306   1e-90
Scas_710.21                                                           302   2e-89
CAGL0J04444g 417656..420295 highly similar to sp|P29469 Saccharo...   300   3e-88
AFR178W [3370] [Homologous to ScYBL023C (MCM2) - SH] complement(...   298   1e-87
Kwal_14.2090                                                          294   2e-86
YBL023C (MCM2) [172] chr2 complement(174885..177491) Member of t...   294   2e-86
Sklu_2087.4 YBL023C, Contig c2087 7202-9856                           291   3e-85
Kwal_27.10174                                                         291   7e-85
YEL032W (MCM3) [1393] chr5 (86937..89852) Member of the MCM/P1 f...   286   8e-83
Scas_499.2                                                            278   1e-79
CAGL0L01397g 152718..155555 highly similar to sp|P24279 Saccharo...   274   1e-78
AFR355C [3547] [Homologous to ScYEL032W (MCM3) - SH] (1082128..1...   270   5e-77
KLLA0D06171g complement(528904..531318) similar to sp|P15274 Sac...    32   3.1  
Scas_716.15                                                            31   6.5  

>ADL026W [1716] [Homologous to ScYPR019W (CDC54) - SH]
           complement(653657..656323) [2667 bp, 888 aa]
          Length = 888

 Score = 1709 bits (4427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 836/872 (95%), Positives = 836/872 (95%)

Query: 1   MTSSPSRPQEASSPALFYNPSSSSQPDTYERGQQNAGNMIGSSPFHYPXXXXXXXNTRSN 60
           MTSSPSRPQEASSPALFYNPSSSSQPDTYERGQQNAGNMIGSSPFHYP       NTRSN
Sbjct: 1   MTSSPSRPQEASSPALFYNPSSSSQPDTYERGQQNAGNMIGSSPFHYPSSSQSQQNTRSN 60

Query: 61  RGGAFSSQGVPRSERSYAGSSLPGTARTRLQHYGRSDIHASDLSSPRRMVNFNXXXXXXX 120
           RGGAFSSQGVPRSERSYAGSSLPGTARTRLQHYGRSDIHASDLSSPRRMVNFN       
Sbjct: 61  RGGAFSSQGVPRSERSYAGSSLPGTARTRLQHYGRSDIHASDLSSPRRMVNFNSPSTLSS 120

Query: 121 XXXXXXXXXXMRIIWGTNVSIQEVACTFKNFLMTFKYKYRKIKDEQELFINETTDEELYY 180
                     MRIIWGTNVSIQEVACTFKNFLMTFKYKYRKIKDEQELFINETTDEELYY
Sbjct: 121 SDPPSENDEPMRIIWGTNVSIQEVACTFKNFLMTFKYKYRKIKDEQELFINETTDEELYY 180

Query: 181 VNQLHQMRQLGTCNLNLDVRNLISFPGTEKLYHQLLNYPQEVISIMDQAVKDCMVQLAVD 240
           VNQLHQMRQLGTCNLNLDVRNLISFPGTEKLYHQLLNYPQEVISIMDQAVKDCMVQLAVD
Sbjct: 181 VNQLHQMRQLGTCNLNLDVRNLISFPGTEKLYHQLLNYPQEVISIMDQAVKDCMVQLAVD 240

Query: 241 IDGAEGNENLIEVESKIYKIRPYNLDSERGMRELNPNDIDKLVSIKGLVLRSTPVIPDMK 300
           IDGAEGNENLIEVESKIYKIRPYNLDSERGMRELNPNDIDKLVSIKGLVLRSTPVIPDMK
Sbjct: 241 IDGAEGNENLIEVESKIYKIRPYNLDSERGMRELNPNDIDKLVSIKGLVLRSTPVIPDMK 300

Query: 301 LAFFKCSVCDHTTAVEIDRGIIQEPLRCPRVACNQRNSMSLIHNRCSFADKQVIKLQETP 360
           LAFFKCSVCDHTTAVEIDRGIIQEPLRCPRVACNQRNSMSLIHNRCSFADKQVIKLQETP
Sbjct: 301 LAFFKCSVCDHTTAVEIDRGIIQEPLRCPRVACNQRNSMSLIHNRCSFADKQVIKLQETP 360

Query: 361 DLVPDGQTPHSVSLCIYDELVDSCRAGDRIEVTGIFRSIPIRANQRQRALKSLYKTYLDV 420
           DLVPDGQTPHSVSLCIYDELVDSCRAGDRIEVTGIFRSIPIRANQRQRALKSLYKTYLDV
Sbjct: 361 DLVPDGQTPHSVSLCIYDELVDSCRAGDRIEVTGIFRSIPIRANQRQRALKSLYKTYLDV 420

Query: 421 VHVRKVSARRLDIDTSTVEQQILQNQMDNVEELRKVTDEDIAKINAVAARPDVYEVLARS 480
           VHVRKVSARRLDIDTSTVEQQILQNQMDNVEELRKVTDEDIAKINAVAARPDVYEVLARS
Sbjct: 421 VHVRKVSARRLDIDTSTVEQQILQNQMDNVEELRKVTDEDIAKINAVAARPDVYEVLARS 480

Query: 481 IAPSIYELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIA 540
           IAPSIYELDDIKKGILLQL            RYRGDINILLCGDPSTSKSQILQYVHKIA
Sbjct: 481 IAPSIYELDDIKKGILLQLFGGTNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKIA 540

Query: 541 PRGVYTSGKGSSAVGLTAYITRDADTKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVL 600
           PRGVYTSGKGSSAVGLTAYITRDADTKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVL
Sbjct: 541 PRGVYTSGKGSSAVGLTAYITRDADTKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVL 600

Query: 601 HEVMKQQPISVAKAGIITTLNARTSILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLV 660
           HEVMKQQPISVAKAGIITTLNARTSILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLV
Sbjct: 601 HEVMKQQPISVAKAGIITTLNARTSILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLV 660

Query: 661 YLVLDKVSESTDRELAKHLTSLYLEDKPAHVSESDILPVHFLTMYINYAKQHIHPVITEG 720
           YLVLDKVSESTDRELAKHLTSLYLEDKPAHVSESDILPVHFLTMYINYAKQHIHPVITEG
Sbjct: 661 YLVLDKVSESTDRELAKHLTSLYLEDKPAHVSESDILPVHFLTMYINYAKQHIHPVITEG 720

Query: 721 AKTELVRAYVNMRSMGDDSRADEKRITATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEA 780
           AKTELVRAYVNMRSMGDDSRADEKRITATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEA
Sbjct: 721 AKTELVRAYVNMRSMGDDSRADEKRITATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEA 780

Query: 781 VRLIKSAIKDYAIDPKTGKIDMNLIQTGKSVIQRKLQEDLAREIVRLLTERSADVITYNE 840
           VRLIKSAIKDYAIDPKTGKIDMNLIQTGKSVIQRKLQEDLAREIVRLLTERSADVITYNE
Sbjct: 781 VRLIKSAIKDYAIDPKTGKIDMNLIQTGKSVIQRKLQEDLAREIVRLLTERSADVITYNE 840

Query: 841 LARLLNENSQDRLDNMTISDALNRLQQEDKIV 872
           LARLLNENSQDRLDNMTISDALNRLQQEDKIV
Sbjct: 841 LARLLNENSQDRLDNMTISDALNRLQQEDKIV 872

>Kwal_14.2175
          Length = 909

 Score = 1271 bits (3288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 634/886 (71%), Positives = 721/886 (81%), Gaps = 26/886 (2%)

Query: 3   SSPSRPQEASSPALFYNPSSSSQPDTYERGQQNAGNMIGSSPFHYPXXXXXXXNTRSNRG 62
           ++P      SSP LFYNPSSSSQPDTYE  Q+     +GSSPF YP       +  S+  
Sbjct: 18  AAPPSSFGGSSPPLFYNPSSSSQPDTYESQQRQ--RTVGSSPFRYPSSSQDHPHVTSD-- 73

Query: 63  GAFSSQGVPRSERSYA-----------GSSLPGTARTRLQHYG--RSDIHASDLSSPRRM 109
             F+SQ   R++RS             G      +    QH    RSD+HASDLSSPRRM
Sbjct: 74  -TFASQS--RTQRSSGPGRFTDFSSDGGILSSSLSGRGSQHAAQRRSDLHASDLSSPRRM 130

Query: 110 VNFNXXXXXXXXXXXXXXXXX-MRIIWGTNVSIQEVACTFKNFLMTFKYKYRKIKDEQEL 168
           V+ +                  +RIIWGTNVSIQE A  F+NFLM+FKYK+RK  D  E 
Sbjct: 131 VDLDSQPPPNSSSDPVSEATEPLRIIWGTNVSIQECATNFRNFLMSFKYKFRKTLDGNED 190

Query: 169 FINETTDEELYYVNQLHQMRQLGTCNLNLDVRNLISFPGTEKLYHQLLNYPQEVISIMDQ 228
           F+NET DEELYYV +L+QMR++G+ NLNLD RNL+SF  TEKLY+QL++YPQE+ISIMDQ
Sbjct: 191 FLNETDDEELYYVKRLNQMREMGSLNLNLDARNLLSFKATEKLYYQLMSYPQEIISIMDQ 250

Query: 229 AVKDCMVQLAVDIDGAEGNENLIEVESKIYKIRPYNLDSERGMRELNPNDIDKLVSIKGL 288
            VKDCMV L VD +   G   L E+ESK YKIRPYN+++++GMRELNPNDIDKL+S+KGL
Sbjct: 251 TVKDCMVSLVVDNNLESG---LDEIESKFYKIRPYNIETQKGMRELNPNDIDKLISVKGL 307

Query: 289 VLRSTPVIPDMKLAFFKCSVCDHTTAVEIDRGIIQEPLRCPRVACNQRNSMSLIHNRCSF 348
           VLRSTP+IPDMK+AFFKC++CDHT  VEIDRG+IQEP RCPRVACNQ+NSM+L+HNRCSF
Sbjct: 308 VLRSTPIIPDMKVAFFKCNICDHTAVVEIDRGVIQEPARCPRVACNQQNSMTLVHNRCSF 367

Query: 349 ADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAGDRIEVTGIFRSIPIRANQRQR 408
           ADKQVIKLQETPD VPDGQTPHSVSLC+YDELVDSCRAGDRIE+TGIFRSIPIRA+  QR
Sbjct: 368 ADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAGDRIEITGIFRSIPIRASTTQR 427

Query: 409 ALKSLYKTYLDVVHVRKVSARRLDIDTSTVEQQILQNQMD--NVEELRKVTDEDIAKINA 466
           ALKSLYKTYLDVVHV+KV+  RL  DTSTVEQ++LQN+M+  +V+E+ ++TDE I K++A
Sbjct: 428 ALKSLYKTYLDVVHVKKVTNDRLGADTSTVEQELLQNEMNHSDVQEIPQITDEQIRKLHA 487

Query: 467 VAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPS 526
           +AAR DVYEVLARS+APSI+ELDDIKKGILLQL            RYRGDINILLCGDPS
Sbjct: 488 IAARDDVYEVLARSVAPSIFELDDIKKGILLQLFGGTNKTFTKGGRYRGDINILLCGDPS 547

Query: 527 TSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDADTKQSVLESGALVLSDGGVCCI 586
           TSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRD DTKQ VLESGALVLSDGGVCCI
Sbjct: 548 TSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVLESGALVLSDGGVCCI 607

Query: 587 DEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTSILASANPIGSRYNTNLPVTEN 646
           DEFDKMSDSTRSVLHEVM+QQ IS+AKAGIITTLNARTSILASANPIGSRYN NLPVTEN
Sbjct: 608 DEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPIGSRYNPNLPVTEN 667

Query: 647 IDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLEDKPAHVSESDILPVHFLTMYI 706
           IDLPPPLLSRFDLVYLVLDKV E+TDRELAKHLT+LYLED P + ++ D+LPV  LT+YI
Sbjct: 668 IDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLYLEDAPTNETDGDVLPVELLTLYI 727

Query: 707 NYAKQHIHPVITEGAKTELVRAYVNMRSMGDDSRADEKRITATTRQLESMIRLSEAHAKV 766
           NYAKQ   PVI E AKTELVRAYV MR MGDDSR+DEKRITATTRQLESMIRL+EAHAK+
Sbjct: 728 NYAKQQYAPVIIEQAKTELVRAYVTMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKM 787

Query: 767 RLSQQVEVSDVQEAVRLIKSAIKDYAIDPKTGKIDMNLIQTGKSVIQRKLQEDLAREIVR 826
           RLSQ VE+ DVQEAVRLIKSAIKDYA DPKTGKIDMNL+QTGKSVIQRKLQEDLARE+V 
Sbjct: 788 RLSQTVELQDVQEAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLAREVVS 847

Query: 827 LLTERSADVITYNELARLLNENSQDRLDNMTISDALNRLQQEDKIV 872
           +L  RS   I+YNEL R +NE SQD+++   IS+AL RLQQEDK+V
Sbjct: 848 ILGARSNLTISYNELLRSINEQSQDKVEAADISEALVRLQQEDKVV 893

>KLLA0C17512g complement(1537707..1540385) similar to sp|P30665
           Saccharomyces cerevisiae YPR019w CDC54 member of the
           CDC46P/MCM2P/MCM3P family, start by similarity
          Length = 892

 Score = 1270 bits (3286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 629/883 (71%), Positives = 734/883 (83%), Gaps = 18/883 (2%)

Query: 1   MTSSPSRPQEASSPALFYNPSSSSQPDTYERGQQNAGNMIGSSPFHYPXXXXXXXNTRSN 60
           M+S P+  Q+ SSP LFY+PSSS  P   +  Q +    +GSSPFHYP        T+  
Sbjct: 1   MSSPPA--QQPSSPNLFYDPSSSPAPHGTQDSQASQDRGVGSSPFHYPSSSSNA--TQET 56

Query: 61  RGGAFSSQGVP----RSERSYAGSSLPGTART-RLQHYGRSDIHASDLSSPRRMVNFNXX 115
              A SS G+     RS+     SSL  +AR  R     R +I+ASDLSSPRR+V FN  
Sbjct: 57  ARAAPSSSGLRSNNLRSDLLNYSSSLSSSAREGRHSRSRRGEINASDLSSPRRIVTFNNL 116

Query: 116 XXXXXXX------XXXXXXXXMRIIWGTNVSIQEVACTFKNFLMTFKYKYRKIKDEQELF 169
                                ++IIWGTNVSIQE   +F+ FLM+FK KYRK  D+QE+F
Sbjct: 117 SSSDNGFSSSSRPASEAADQPLKIIWGTNVSIQECGNSFREFLMSFKLKYRKELDDQEIF 176

Query: 170 INETTDEELYYVNQLHQMRQLGTCNLNLDVRNLISFPGTEKLYHQLLNYPQEVISIMDQA 229
           INETTD+ELYYVNQL+QMRQLGT NLNLD+RNL+++  TEKL+HQ+L YPQE+I+IMDQ 
Sbjct: 177 INETTDQELYYVNQLNQMRQLGTSNLNLDIRNLLAYKHTEKLFHQILYYPQEIIAIMDQT 236

Query: 230 VKDCMVQLAVDIDGAEGNENLIEVESKIYKIRPYNLDSERGMRELNPNDIDKLVSIKGLV 289
           VKDCMV LA+D +G E   N  E+ESK++K+RPYN+++++GMRELNPNDIDKLVSIKGLV
Sbjct: 237 VKDCMVSLALD-NGLESYLN--EIESKLFKVRPYNVETKKGMRELNPNDIDKLVSIKGLV 293

Query: 290 LRSTPVIPDMKLAFFKCSVCDHTTAVEIDRGIIQEPLRCPRVACNQRNSMSLIHNRCSFA 349
           LRSTP+IPDM +AFFKC+VC+HT  VEIDRGIIQEP+RCPRV CN  NSM L+HNRC+F 
Sbjct: 294 LRSTPIIPDMSVAFFKCNVCNHTVEVEIDRGIIQEPVRCPRVVCNSPNSMVLVHNRCTFQ 353

Query: 350 DKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAGDRIEVTGIFRSIPIRANQRQRA 409
           D+QVIKLQETPDLVPDGQTPHSVSLC+YDELVDSCRAGDRIEV+GIFRSIPIR+N +QRA
Sbjct: 354 DRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVSGIFRSIPIRSNPKQRA 413

Query: 410 LKSLYKTYLDVVHVRKVSARRLDIDTSTVEQQILQNQMDNVEELRKVTDEDIAKINAVAA 469
           LKSLYKTY+DVVH++KV+  R+ +DTSTVEQQ+LQNQ+DNVEE+R ++ EDI +I   A 
Sbjct: 414 LKSLYKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQNQIDNVEEIRTLSSEDIRRIKETAR 473

Query: 470 RPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSK 529
           R DVY+VL+RSIAPSIYELDD+KKGILLQL            RYRGDINILLCGDPSTSK
Sbjct: 474 RSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGRYRGDINILLCGDPSTSK 533

Query: 530 SQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDADTKQSVLESGALVLSDGGVCCIDEF 589
           SQILQYVHKIAPRGVYTSGKGSSAVGLTAY+TRD DTKQ VLESGALVLSDGGVCCIDEF
Sbjct: 534 SQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLESGALVLSDGGVCCIDEF 593

Query: 590 DKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTSILASANPIGSRYNTNLPVTENIDL 649
           DKM+D+TRSVLHEVM+QQ IS+AKAGIITTLNARTSILASANPI SRYN NLPVTENIDL
Sbjct: 594 DKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPINSRYNPNLPVTENIDL 653

Query: 650 PPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLEDKPAHVSESDILPVHFLTMYINYA 709
           PPPLLSRFDLVYLVLDKV+E++DRELAKHLTSLYLED+P  VS+ DILPV FLT YINYA
Sbjct: 654 PPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDRPDSVSQGDILPVEFLTAYINYA 713

Query: 710 KQHIHPVITEGAKTELVRAYVNMRSMGDDSRADEKRITATTRQLESMIRLSEAHAKVRLS 769
           KQ+IHPVITE AKTELVRAYV MR MGDDSR+DEKRITATTRQLESMIRLSEAHAK+RLS
Sbjct: 714 KQNIHPVITESAKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLSEAHAKMRLS 773

Query: 770 QQVEVSDVQEAVRLIKSAIKDYAIDPKTGKIDMNLIQTGKSVIQRKLQEDLAREIVRLLT 829
           ++VE+ DV+EAVRLIKSAIKDYA DPKTGKIDMNL+QTGKSV+QRKL EDLAREI+++LT
Sbjct: 774 ERVELEDVEEAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSVVQRKLLEDLAREILKILT 833

Query: 830 ERSADVITYNELARLLNENSQDRLDNMTISDALNRLQQEDKIV 872
           ER+ D I++NEL++L+NE SQD+++++ +S+AL RLQQEDK+V
Sbjct: 834 ERTTDTISFNELSKLINEQSQDKVESIELSNALTRLQQEDKVV 876

>Scas_707.44
          Length = 929

 Score = 1264 bits (3272), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 627/900 (69%), Positives = 730/900 (81%), Gaps = 33/900 (3%)

Query: 2   TSSP-----SRPQEASSPALFYNPSSSSQPDTYERGQQNAGNM-----IGSSPFHYPXXX 51
           +SSP     S P + SSPALFYN SSSSQ D + R    AG        GSSP +YP   
Sbjct: 18  SSSPAPTAGSIPAQPSSPALFYN-SSSSQSDIFGRHGSQAGTARNNAAFGSSPMNYPSSS 76

Query: 52  XXXXN--------TRSNRGGAFSSQGVPRSERSYAGSSLPGTARTRLQHYG-----RSDI 98
               +        TR   G + ++ G  R     +  ++P ++ +           R+DI
Sbjct: 77  QNQSSDLLNPQRRTRRPGGSSTNTPGTTRFSDIRSDRNIPSSSSSFGSSRNNIRMRRNDI 136

Query: 99  HASDLSSPRRMVNFNXXXXXXXXXXXXX----XXXXMRIIWGTNVSIQEVACTFKNFLMT 154
           HASDLSSPRR+V+F+                     +RIIWGTNVSIQE A  F+NFLM+
Sbjct: 137 HASDLSSPRRIVDFDSHSGVHTSSSSAVPTSDANEPLRIIWGTNVSIQECATKFRNFLMS 196

Query: 155 FKYKYRKIKDEQELFINETTDEELYYVNQLHQMRQLGTCNLNLDVRNLISFPGTEKLYHQ 214
           FKYK+RK  DE+E FIN TTDEELYYV QL++MR++G CNLNLD RNL++F  TE+LY+Q
Sbjct: 197 FKYKFRKTLDEREQFINSTTDEELYYVQQLNEMREVGNCNLNLDARNLLAFKQTEELYYQ 256

Query: 215 LLNYPQEVISIMDQAVKDCMVQLAVDIDGAEGNENLIEVESKIYKIRPYNLDSERGMREL 274
           LLNYPQEVISIMDQ +KDCMV L VD      + NL ++E+K YK+RPYN+ + +GMREL
Sbjct: 257 LLNYPQEVISIMDQTIKDCMVSLVVD---NHLDFNLDDIETKFYKVRPYNVGTVKGMREL 313

Query: 275 NPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEIDRGIIQEPLRCPRVACN 334
           NPNDIDKL+S+KGLVLR+TPVIPDMK+AFFKC+VCDHT  VEIDRG+IQEP RC RV C 
Sbjct: 314 NPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNVCDHTMVVEIDRGVIQEPARCERVDCG 373

Query: 335 QRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAGDRIEVTG 394
           ++NSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPH+VSLC+YDELVDSCRAGDRIEVTG
Sbjct: 374 EQNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHAVSLCVYDELVDSCRAGDRIEVTG 433

Query: 395 IFRSIPIRANQRQRALKSLYKTYLDVVHVRKVSARRLDIDTSTVEQQILQNQMDN--VEE 452
            FRSIPIRAN RQR LKSLYKTY+DVVH++KVS  RL +DTST+EQ+++QN++D+  VEE
Sbjct: 434 TFRSIPIRANSRQRILKSLYKTYIDVVHIKKVSDTRLGVDTSTIEQELMQNKLDHNEVEE 493

Query: 453 LRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXXXXXXXXR 512
           ++K+TD+DIAKI  VA R D+Y+VL+RSIAPSI+ELDD+KKGILLQL            R
Sbjct: 494 VKKITDQDIAKIRDVANREDLYDVLSRSIAPSIFELDDVKKGILLQLFGGANKVFKKGGR 553

Query: 513 YRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDADTKQSVLE 572
           YRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRD DTKQ VLE
Sbjct: 554 YRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLE 613

Query: 573 SGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTSILASANP 632
           SGALVLSDGG+CCIDEFDKMSDSTRSVLHEVM+QQ IS+AKAGIITTLNAR+SILASANP
Sbjct: 614 SGALVLSDGGICCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANP 673

Query: 633 IGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLEDKPAHVS 692
           IGSRYN NLPVTENIDLPPPLLSRFDLVYLVLDKV ESTDRELAKHLTSLYL+DKP HVS
Sbjct: 674 IGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDESTDRELAKHLTSLYLQDKPEHVS 733

Query: 693 ESDILPVHFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRSMGDDSRADEKRITATTRQ 752
            +DILPV FLTMYINYAK+HIHPVI E AK ELVRAYV MR +GDDSR+DEKRITATTRQ
Sbjct: 734 NADILPVEFLTMYINYAKEHIHPVILEEAKIELVRAYVGMRKLGDDSRSDEKRITATTRQ 793

Query: 753 LESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAIKDYAIDPKTGKIDMNLIQTGKSVI 812
           LESMIRL+EAHAK+RLS +V++ DVQEAVRL+KSAIKDYA DPKTGKIDMNL+QTGKSVI
Sbjct: 794 LESMIRLAEAHAKMRLSNEVQLEDVQEAVRLMKSAIKDYATDPKTGKIDMNLVQTGKSVI 853

Query: 813 QRKLQEDLAREIVRLLTERSADVITYNELARLLNENSQDRLDNMTISDALNRLQQEDKIV 872
           QRKLQEDL RE++R+LT  ++D +++NEL + +NE+SQDR+++  ISD L+RLQQEDK++
Sbjct: 854 QRKLQEDLTREVLRVLTNHTSDSMSFNELIKQINEHSQDRVESSDISDVLSRLQQEDKVI 913

>YPR019W (CDC54) [5453] chr16 (596745..599546) Protein involved in
           DNA synthesis initiation, member of the MCM family of
           DNA-dependent ATPases required for initiation of DNA
           replication [2802 bp, 933 aa]
          Length = 933

 Score = 1263 bits (3269), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 628/904 (69%), Positives = 731/904 (80%), Gaps = 48/904 (5%)

Query: 6   SRPQEASSPALFYNPSSSSQPDTYERGQ-----QNAGNM---IGSSPFHYPXXXXXXXNT 57
           S P + SSPALFY+ SSSSQ D Y R       Q  GN+   IGSSP ++P       ++
Sbjct: 25  SVPPQLSSPALFYS-SSSSQGDIYGRNNSQNLSQGEGNIRAAIGSSPLNFPS------SS 77

Query: 58  RSNRGGAFSSQGVP-------------------RSERSY--AGSSLPGTARTRLQHYGRS 96
           +      F SQG                     RS+R+   + SSL    + R+ H  R+
Sbjct: 78  QRQNSDVFQSQGRQGRIRSSASASGRSRYHSDLRSDRALPTSSSSLGRNGQNRV-HMRRN 136

Query: 97  DIHASDLSSPRRMVNF------NXXXXXXXXXXXXXXXXXMRIIWGTNVSIQEVACTFKN 150
           DIH SDLSSPRR+V+F      N                 +RIIWGTNVSIQE    F+N
Sbjct: 137 DIHTSDLSSPRRIVDFDTRSGVNTLDTSSSSAPPSEASEPLRIIWGTNVSIQECTTNFRN 196

Query: 151 FLMTFKYKYRKIKDEQELFINETTDEELYYVNQLHQMRQLGTCNLNLDVRNLISFPGTEK 210
           FLM+FKYK+RKI DE+E FIN TTDEELYY+ QL++MR+LGT NLNLD RNL+++  TE 
Sbjct: 197 FLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSNLNLDARNLLAYKQTED 256

Query: 211 LYHQLLNYPQEVISIMDQAVKDCMVQLAVDIDGAEGNENLIEVESKIYKIRPYNLDSERG 270
           LYHQLLNYPQEVISIMDQ +KDCMV L VD      + +L E+E+K YK+RPYN+ S +G
Sbjct: 257 LYHQLLNYPQEVISIMDQTIKDCMVSLIVD---NNLDYDLDEIETKFYKVRPYNVGSCKG 313

Query: 271 MRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEIDRGIIQEPLRCPR 330
           MRELNPNDIDKL+++KGLVLRSTPVIPDMK+AFFKC+VCDHT AVEIDRG+IQEP RC R
Sbjct: 314 MRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEIDRGVIQEPARCER 373

Query: 331 VACNQRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAGDRI 390
           + CN+ NSMSLIHNRCSFADKQVIKLQETPD VPDGQTPHS+SLC+YDELVDSCRAGDRI
Sbjct: 374 IDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRI 433

Query: 391 EVTGIFRSIPIRANQRQRALKSLYKTYLDVVHVRKVSARRLDIDTSTVEQQILQNQMDN- 449
           EVTG FRSIPIRAN RQR LKSLYKTY+DVVHV+KVS +RLD+DTST+EQ+++QN++D+ 
Sbjct: 434 EVTGTFRSIPIRANSRQRVLKSLYKTYVDVVHVKKVSDKRLDVDTSTIEQELMQNKVDHN 493

Query: 450 -VEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXXXXX 508
            VEE+R++TD+D+AKI  VAAR D+Y +LARSIAPSIYEL+D+KKGILLQL         
Sbjct: 494 EVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLFGGTNKTFT 553

Query: 509 XXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDADTKQ 568
              RYRGDINILLCGDPSTSKSQILQYVHKI PRGVYTSGKGSSAVGLTAYITRD DTKQ
Sbjct: 554 KGGRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQ 613

Query: 569 SVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTSILA 628
            VLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVM+QQ IS+AKAGIITTLNAR+SILA
Sbjct: 614 LVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILA 673

Query: 629 SANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLEDKP 688
           SANPIGSRYN NLPVTENIDLPPPLLSRFDLVYLVLDKV E  DRELAKHLT+LYLEDKP
Sbjct: 674 SANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKP 733

Query: 689 AHVSESDILPVHFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRSMGDDSRADEKRITA 748
            H+S+ D+LPV FLTMYI+YAK+HIHP+ITE AKTELVRAYV MR MGDDSR+DEKRITA
Sbjct: 734 EHISQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRSDEKRITA 793

Query: 749 TTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAIKDYAIDPKTGKIDMNLIQTG 808
           TTRQLESMIRL+EAHAK++L   VE+ DVQEAVRLI+SAIKDYA DPKTGKIDMNL+QTG
Sbjct: 794 TTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATDPKTGKIDMNLVQTG 853

Query: 809 KSVIQRKLQEDLAREIVRLLTERSADVITYNELARLLNENSQDRLDNMTISDALNRLQQE 868
           KSVIQRKLQEDL+REI+ +L ++++D +++NEL + +NE+SQDR+++  I +AL+RLQQE
Sbjct: 854 KSVIQRKLQEDLSREIMNVLKDQASDSMSFNELIKQINEHSQDRVESSDIQEALSRLQQE 913

Query: 869 DKIV 872
           DK++
Sbjct: 914 DKVI 917

>CAGL0K02431g complement(219027..221801) highly similar to sp|P30665
           Saccharomyces cerevisiae YPR019w Cell division control
           protein, start by similarity
          Length = 924

 Score = 1236 bits (3198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 615/905 (67%), Positives = 726/905 (80%), Gaps = 47/905 (5%)

Query: 2   TSSPSRPQ--------EASSPALFYNPSSSSQPDTYERGQQNAGNMIGSSPFHYPXXXXX 53
           +SSP R Q        + SSPALF+N SSSSQP      Q ++  +  SSP H+P     
Sbjct: 17  SSSPGRNQPSSMGPNGDPSSPALFFN-SSSSQP------QGDSQPVAPSSPIHFPSSSNR 69

Query: 54  XXNT-------RSNRG----------GAFSSQGVPRSERSYAGSSLPG--TARTRLQHYG 94
             ++       RSNR           G FS  G  R     + S++ G  + RT L+   
Sbjct: 70  PMSSDVHSQGRRSNRNHLAANRSSALGRFSDYGSDRQVLHSSSSNMGGYPSQRTNLR--- 126

Query: 95  RSDIHASDLSSPRRMVNFNXXXXXXXXXXXX-----XXXXXMRIIWGTNVSIQEVACTFK 149
           R+DIHASDLSSPRR+V+F+                      +RIIWGTNVSIQE A +F+
Sbjct: 127 RNDIHASDLSSPRRIVDFDSRSGIQQPSSSSSSMPSEATEPLRIIWGTNVSIQECANSFR 186

Query: 150 NFLMTFKYKYRKIKDEQELFINETTDEELYYVNQLHQMRQLGTCNLNLDVRNLISFPGTE 209
           NFLM+FKYKYR++ D +    ++  +EELYYV QL++MR+LGT NLNLD RNL++F  TE
Sbjct: 187 NFLMSFKYKYRRVLDGKTDITDDEAEEELYYVKQLNEMRELGTSNLNLDARNLLAFKQTE 246

Query: 210 KLYHQLLNYPQEVISIMDQAVKDCMVQLAVDIDGAEGNENLIEVESKIYKIRPYNLDSER 269
           +LY+QLLNYPQEVISIMDQ +KDCMV L VD    +    L E+ESK YK+RPYN+++++
Sbjct: 247 ELYYQLLNYPQEVISIMDQTIKDCMVSLVVD---NQLEHELDEIESKFYKVRPYNVETQK 303

Query: 270 GMRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEIDRGIIQEPLRCP 329
           GMRELNPNDIDKL+S+KGLVLR+TPVIPDMK+AFFKC++CDHT AVEIDRG+IQEP RC 
Sbjct: 304 GMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMAVEIDRGVIQEPARCE 363

Query: 330 RVACNQRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAGDR 389
           RV CN+ NSM+LIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLC+YDELVDSCRAGDR
Sbjct: 364 RVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDR 423

Query: 390 IEVTGIFRSIPIRANQRQRALKSLYKTYLDVVHVRKVSARRLDIDTSTVEQQILQNQMDN 449
           IEVTG FRSIPI+AN RQR LKSLYKTY+DVVHV+KVS  R+ +D ST+EQ++LQN++DN
Sbjct: 424 IEVTGTFRSIPIKANSRQRVLKSLYKTYIDVVHVKKVSNTRIGVDVSTIEQELLQNKLDN 483

Query: 450 --VEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXXXX 507
             VEE+R+++D +I KI  VA RPD+Y++LARSIAPSIYELDD+KKGILLQL        
Sbjct: 484 NDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLFGGTNKTF 543

Query: 508 XXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDADTK 567
               RYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAY+TRD D+K
Sbjct: 544 KKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDSK 603

Query: 568 QSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTSIL 627
           Q VLESGALVLSDGG+CCIDEFDKMS+STRSVLHEVM+QQ ISVAKAGIITTLNAR+SIL
Sbjct: 604 QLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTLNARSSIL 663

Query: 628 ASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLEDK 687
           ASANPIGSRYN NLPVTENIDLPPPLLSRFDLVY++LDKV ESTDR+LAKHLTSLYLEDK
Sbjct: 664 ASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLTSLYLEDK 723

Query: 688 PAHVSESDILPVHFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRSMGDDSRADEKRIT 747
           PAHV+  D+LP+ FLT YINY KQ++HP++TE AK ELV+AYV MR MGDDSR+DEKRIT
Sbjct: 724 PAHVTTDDVLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRSDEKRIT 783

Query: 748 ATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAIKDYAIDPKTGKIDMNLIQT 807
           ATTRQLESMIRLSEAHAK+RLS  V++ DV+EAVRL+KSAIKDYA DPKTGKIDMNL+QT
Sbjct: 784 ATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAIKDYATDPKTGKIDMNLVQT 843

Query: 808 GKSVIQRKLQEDLAREIVRLLTERSADVITYNELARLLNENSQDRLDNMTISDALNRLQQ 867
           GKSVIQRKLQEDLAREI+R+L E  AD +++NEL + +NE +QDR++   +S  L+RLQQ
Sbjct: 844 GKSVIQRKLQEDLAREIIRILKEYPADSMSFNELIKQINEQAQDRVEPSQVSSTLSRLQQ 903

Query: 868 EDKIV 872
           EDK++
Sbjct: 904 EDKVI 908

>KLLA0E23276g complement(2065845..2068325) similar to sp|P38132
           Saccharomyces cerevisiae YBR202w CDC47 cell division
           control protein, start by similarity
          Length = 826

 Score =  344 bits (883), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 220/561 (39%), Positives = 321/561 (57%), Gaps = 44/561 (7%)

Query: 271 MRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEIDRGIIQEPLRCPR 330
           +RE+  + + KL++++G++ R + V P + +  + C  C H    E+++      + CP 
Sbjct: 218 VREIKGSYLGKLITVRGIITRVSDVKPSVTVNAYTCDQCGHEVFQEVNKRTFTPIIECPS 277

Query: 331 VAC--NQRNSMSLIHNRCS-FADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAG 387
             C  NQ      +  R S F+  Q  K+QE  D VP G  P ++++ I   L  S   G
Sbjct: 278 AQCSENQTKGQLFMSTRASKFSAFQECKIQELSDQVPIGHIPRTLTIHINGPLTRSMIPG 337

Query: 388 DRIEVTGIFRSIPIRANQRQRALKS--LYKTYLDVV----HVRKVSARRLDIDTSTVEQQ 441
           D ++VTGI+   P       RALK+  L +TYL+      H +K ++ ++D         
Sbjct: 338 DVVDVTGIYLPSPYTGF---RALKAGLLTETYLETQFVYQHKKKFASFQVD--------- 385

Query: 442 ILQNQMDNVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXX 501
                    ++L+    E +AKI     + DVY  LA+SIAP IY   D+KK +LL L  
Sbjct: 386 ---------DQLK----ERVAKI---VNQGDVYNRLAKSIAPEIYGNLDVKKSLLLLLVG 429

Query: 502 XXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYIT 561
                     + RGDINI L GDP  +KSQ+L+ + KI+PRGVYT+GKGSS VGLTA + 
Sbjct: 430 GVEKKVGDGLKIRGDINICLMGDPGVAKSQLLKSICKISPRGVYTTGKGSSGVGLTAAVM 489

Query: 562 RDADTKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLN 621
           +D  T + VLE GALVL+D G+CCIDEFDKM +S R+ +HEVM+QQ IS++KAGI TTLN
Sbjct: 490 KDPVTDEMVLEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLN 549

Query: 622 ARTSILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTS 681
           AR SILA+ANP+  RYN  L   ENI+LP  LLSRFD+++L+LD  S+  D +LA+H+T 
Sbjct: 550 ARASILAAANPLYGRYNPRLSPLENINLPAALLSRFDIMFLLLDMPSKENDEKLAEHVTY 609

Query: 682 LYLEDKPAHVSESDILPVHFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRSMGDDSRA 741
           +++ D+        I P   +  YI YAK    PV++      +V +Y  MR   D  +A
Sbjct: 610 VHMYDRQPDFGFEPI-PSSEMREYIAYAKTK-RPVLSADVNEHIVLSYTRMRQ--DSKKA 665

Query: 742 DEKRIT---ATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAIKDYAIDPKTG 798
            + + +   AT R L ++IRLS+A AK+RLS  VE+ DV EA+RL++ + +    D K  
Sbjct: 666 LDSKFSFGQATPRTLLAIIRLSQALAKLRLSDTVEIEDVDEALRLVEVSKESLYSDRKNP 725

Query: 799 KIDMNLIQTGKSVIQRKLQED 819
             D N      ++I++   E+
Sbjct: 726 YEDENPTTRIYTIIKKMATEN 746

>ADR041W [1782] [Homologous to ScYBR202W (CDC47) - SH]
           complement(777754..780195) [2442 bp, 813 aa]
          Length = 813

 Score =  344 bits (882), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 224/617 (36%), Positives = 338/617 (54%), Gaps = 58/617 (9%)

Query: 272 RELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEIDRGIIQEPLRCPRV 331
           RE+  + + KL+++ G+V R + V P + +  + C  C      E+++      L C   
Sbjct: 215 REVKGSHLGKLITVSGIVTRISDVKPAVLVTAYTCDQCGAEVFQEVNKRTFTPFLECTSR 274

Query: 332 AC--NQRNSMSLIHNRCS-FADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAGD 388
            C  NQ      +  R S F+  Q  K+QE    VP G  P ++++ +   LV S   GD
Sbjct: 275 QCQQNQNKGQLFMSTRASKFSAFQECKIQEMSHQVPIGHIPRTLTIHVNGPLVRSMVPGD 334

Query: 389 RIEVTGIFRSIPIRANQRQRALKS--LYKTYLDVVHVRKVSARRLDID-TSTVEQQILQN 445
            ++VTGI+   P       +ALK+  L +TYL+  +VR+   +    + TS VE++++  
Sbjct: 335 IVDVTGIYLPAPYTGF---KALKAGLLTETYLEAQYVRQHKKKFSSFEITSDVEKRVM-- 389

Query: 446 QMDNVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXX 505
                               ++  + DVY  LA+SIAP IY   D+KK +LL +      
Sbjct: 390 --------------------SIVQQGDVYTRLAKSIAPEIYGNLDVKKALLLLMVGGVHK 429

Query: 506 XXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDAD 565
                 + RGDINI L GDP  +KSQ+L+ + KI PRGVYT+GKGSS VGLTA + +D  
Sbjct: 430 TVGDGMKIRGDINICLMGDPGVAKSQLLKSICKITPRGVYTTGKGSSGVGLTAAVMKDPV 489

Query: 566 TKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTS 625
           T + VLE GALVL+D G+CCIDEFDKM +S R+ +HEVM+QQ IS++KAGI TTLNARTS
Sbjct: 490 TDEMVLEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNARTS 549

Query: 626 ILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLE 685
           ILA+ANP+  RYN  L   ENI+LP  LLSRFD+++L+LD      D +LA+H+  +++ 
Sbjct: 550 ILAAANPVYGRYNPRLSPLENINLPAALLSRFDIMFLLLDMPHRENDEKLAEHVAYVHMH 609

Query: 686 DKPAHVSESDILPVHFLTM--YINYAKQHIHPVITEGAKTELVRAYVNMRSMGDDSRADE 743
           ++     E D  P+    M  +I +AK    P++T+     +V++Y+ MR        D 
Sbjct: 610 NRQ---PELDFEPIEPAAMREFIAFAKTK-RPIMTQEVNELVVQSYIRMRQ-------DS 658

Query: 744 KRIT--------ATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAIKDYAIDP 795
           K +T        AT R L ++IR+S+A AK+R S QV+V DV+EA+RLI+ +      D 
Sbjct: 659 KNVTDPKQQFGQATPRTLLAVIRISQALAKLRFSDQVDVEDVEEALRLIQVSKDSLYNDT 718

Query: 796 KTGKIDMNLIQTGKSVIQRKLQEDLAREIVRLLTERSADVITYNELARLLNENSQDR-LD 854
           +T   D        ++I++     +A E  RL      D IT    +R   +   D  ++
Sbjct: 719 QTRADDETPTTKIFTIIKK-----MAMETARLNKNLPMDTITKIVRSRGFTQQQLDACVE 773

Query: 855 NMTISDALNRLQQEDKI 871
             T  +  ++L++E+ +
Sbjct: 774 EYTYLNVWHKLEEENAL 790

>CAGL0J06424g complement(611935..614853) highly similar to sp|P53091
           Saccharomyces cerevisiae YGL201c MCM6, start by
           similarity
          Length = 972

 Score =  343 bits (879), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 219/586 (37%), Positives = 310/586 (52%), Gaps = 54/586 (9%)

Query: 249 NLIEVESKIYKIRPYNLDSERGMRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSV 308
           N  E   ++++I  +NL +   +RE+  + I  L+ I G V R++ V P++  A F C +
Sbjct: 241 NSPEQTERLFQISFFNLPTVHRIREIRSDKIGSLMCISGTVTRTSEVRPELYKASFTCDM 300

Query: 309 CDHTTAVEIDRGIIQEPLRCPRVACNQRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQT 368
           C              EP  CP  AC  R   +L  +R  F D Q +++QE  + +P+G  
Sbjct: 301 CRAMVDNVEQSFKYTEPTFCPNPACENRAFWTLNVSRSKFLDWQKVRIQENTNEIPNGSM 360

Query: 369 PHSVSLCIYDELVDSCRAGDRIEVTGIFRSIP-----------------IRA-------- 403
           P ++ + +  + VD  + GD+ + TG+   +P                  R         
Sbjct: 361 PRTLDVILRGDAVDRAKPGDKCQFTGVEIVVPDVSQLMLPGVKPSSSLDTRGIARSSEGL 420

Query: 404 NQRQRALKSL------YKTYLDVVHVRKVSARRLDIDTSTVEQQI-----LQN------- 445
           N     LKSL      YK      HV  V +     + S+ E  +     LQN       
Sbjct: 421 NSGVTGLKSLGVRDLTYKITFLGSHVVSVGSNMNPNENSSAETNLQFISKLQNNDIYSDR 480

Query: 446 QMDNVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXX 505
           + D    L  ++ ++I ++  +     VY+ L RSIAPS++  + IKKGILLQ+      
Sbjct: 481 EKDQEIFLSSLSPDEINELQDMVKDDHVYDKLVRSIAPSVFGHEAIKKGILLQMLGGVHK 540

Query: 506 XXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDAD 565
                 + RGDINI + GDPSTSKSQ L+YV + APR VYTSGK SSA GLTA + RD +
Sbjct: 541 TTVEGIKLRGDINICIVGDPSTSKSQFLKYVCRFAPRSVYTSGKASSAAGLTAAVVRDEE 600

Query: 566 TKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTS 625
                +E+GAL+L+D G+CCIDEFDKM  S +  +HE M+QQ IS+AKAGI  TLNARTS
Sbjct: 601 GGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTS 660

Query: 626 ILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLE 685
           ILA+ANPIG RYN    +  N+++  P++SRFDL ++VLD  +E  D ELA H+  L+++
Sbjct: 661 ILAAANPIGGRYNRKTSLRANLNMTAPIMSRFDLFFVVLDDCNEKIDTELASHIIDLHMK 720

Query: 686 DKPAHVSESDILPVHFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRSMGDDSRADEK- 744
              A  S         L  YI YAK    PVI + A+  LV  Y  +R   DD++   + 
Sbjct: 721 QDEAITSP---YSAEQLQRYIKYAKT-FKPVINKEARKFLVEKYKALRK--DDAQGYSRS 774

Query: 745 --RITATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAI 788
             RI  T RQLESM+RLSEA A+   S ++    V EA  L+K +I
Sbjct: 775 SYRI--TVRQLESMVRLSEAIARANCSDEITPEFVAEAYDLLKQSI 818

>AGR276W [4587] [Homologous to ScYLR274W (CDC46) - SH]
           complement(1257348..1259552) [2205 bp, 734 aa]
          Length = 734

 Score =  331 bits (849), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 226/708 (31%), Positives = 361/708 (50%), Gaps = 78/708 (11%)

Query: 143 EVACTFKNFLMTFKYKYRKIKDEQELFINETTDEELYYVNQLHQMRQLGTCNLNLDVRNL 202
           EV  +F++F++ F+                  D    Y  QL     +    L ++  +L
Sbjct: 26  EVVRSFRDFVLEFRL-----------------DARFVYREQLRNNLLVRRYALRVNTEHL 68

Query: 203 ISFPGTEKLYHQLLNYPQEVISIMDQAVKDCMVQLAVDIDGAEGNENLIEVESKIYKIRP 262
           I +   E LY  + + P E + + +QAV +   ++A       G    ++VE +      
Sbjct: 69  IGY--NEALYKLVRDEPVETVPLFEQAVTEIARRMARLRAEDAGALPAVQVELQ------ 120

Query: 263 YNLDSERGMRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEID--RG 320
            +  +E  +R+L+   + +LV + G+V+ ++ +          C  C HTTA++++  + 
Sbjct: 121 -SAAAETALRQLDSQSVSRLVRLSGIVVSTSVLTSRATHVALMCRNCRHTTALDLNNFQS 179

Query: 321 IIQEPLRCPRVA---------------CNQRNSMSLIHNRCSFADKQVIKLQETPDLVPD 365
           +    +  PR                 C Q   M ++H    F D+Q +KLQE P+ VP 
Sbjct: 180 LAGSNVALPRACLADHSNDDGSAAGNPCGQDPYM-IVHESSRFVDQQFLKLQEVPESVPI 238

Query: 366 GQTPHSVSLCIYDELVDSCRAGDRIEVTGIFRSIPIRANQRQRALKSLYKTYLDVVHVRK 425
           G+ P ++ L     L +    G R+ V GI+               ++Y++       R 
Sbjct: 239 GEMPRNLLLTCDRYLTNRVVPGTRVTVVGIY---------------AIYQSKGGQGGARA 283

Query: 426 VSARRLDIDTSTVEQQILQNQMDNVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSI 485
           V+ R   +    +E Q           L   ++E+  +   +A  P++Y++ A SIAPSI
Sbjct: 284 VAIRNPYVKVLGIEAQ----AGSPAGVLSMFSEEEEEEFLRLARTPNLYQLFAESIAPSI 339

Query: 486 YELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVY 545
           Y  +DIKK I+  L            R RGDIN+LL GDP T+KSQ+L++V K++P  VY
Sbjct: 340 YGNEDIKKAIVCLLMGGSKKLLPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKVSPIAVY 399

Query: 546 TSGKGSSAVGLTAYITRDADTKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMK 605
           TSGKGSSA GLTA + RD +T++  LE GA+VL+DGGV CIDEFDKM D  R  +HE M+
Sbjct: 400 TSGKGSSAAGLTASVQRDPNTREFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAME 459

Query: 606 QQPISVAKAGIITTLNARTSILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLD 665
           QQ IS+AKAGI T LN+RTS+LA+ANPI  RY+      ENID    +LSRFD++++V D
Sbjct: 460 QQTISIAKAGITTVLNSRTSVLAAANPIYGRYDELKSPGENIDFQTTILSRFDMIFIVKD 519

Query: 666 KVSESTDRELAKHLTSLY-----LEDKPAHVSESDILPVHFLTMYINYAKQHIHPVITEG 720
           + +E  D  +A+H+ +++     + D  A  ++ +I P+  +  YI Y +    P ++  
Sbjct: 520 EHNEQRDMSIAQHVMNIHTGRTAVPDAGAAGADREI-PIDKMRRYITYCRSKCAPRLSTH 578

Query: 721 AKTELVRAYVNMRS---MGDDSRADEKRITATTRQLESMIRLSEAHAKVRLSQQVEVSDV 777
           A  +L   +V +R    + +    ++  I  T RQLE++IR+SE+ AK+ LS   E   V
Sbjct: 579 AAEKLSSHFVTIRKQLLINELESKEKSSIPITVRQLEAIIRISESLAKLELSSVAEERHV 638

Query: 778 QEAVRLIKSAIKDYAI-DPKTGKIDMNLIQTGKSVIQRKLQEDLAREI 824
            EA+RL +++  D A  DP  G  + N++        R L+ +L R +
Sbjct: 639 DEAIRLFQASTMDAASQDPIGGMQNSNVVSE-----VRNLEAELKRRL 681

>CAGL0F04939g 503890..506208 highly similar to sp|P29496
           Saccharomyces cerevisiae YLR274w CDC46 cell division
           control protein, start by similarity
          Length = 772

 Score =  332 bits (851), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 238/734 (32%), Positives = 370/734 (50%), Gaps = 92/734 (12%)

Query: 143 EVACTFKNFLMTFKYKYRKIKDEQELFINETTDEELYYVNQLHQMRQLGTCNLNLDVRNL 202
           E+   FK F++ F+                  D +  Y +QL     +   +L++D+ +L
Sbjct: 26  EIIKAFKRFILEFRL-----------------DSQFLYRDQLRNSLLVKNYSLSVDLEHL 68

Query: 203 ISFPGTEKLYHQLLNYPQEVISIMDQAVKDCMVQLAV------------DIDGAEGNENL 250
           I +   E LY +L + P +VI + + A+     ++ +            DID  E + +L
Sbjct: 69  IGY--NEDLYKRLSDEPSDVIPLFETAITQVAKRIMILNKSSNTNDGLDDID--ENSNDL 124

Query: 251 IEVESKIYKIRPYNL-----DSERGMRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFK 305
            + E  I  I  + L      ++  +R+LN   +  +V + G+++ ++ +          
Sbjct: 125 ADDEDGITDIPVFQLILSSRANQVSLRQLNSEHVSNIVRLSGIIVSASVLSQRATHLSLM 184

Query: 306 CSVCDHTTAVEIDR--GIIQEPLRCPRVACNQRNSMS----------------------- 340
           C  C HT ++ I+    I    +  P  +C   N+ S                       
Sbjct: 185 CRNCRHTMSLNINNFNSITGNSVTLPH-SCQSTNNNSTAAYIHDTGDDPTGSGAASKNCG 243

Query: 341 -----LIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAGDRIEVTGI 395
                +IH    F D+Q +KLQE P+LVP  + P ++++     L +    G R+ + GI
Sbjct: 244 PDPYIIIHESSKFIDQQFLKLQEVPELVPVSEMPRNITMTCDRYLTNRVNPGTRVTIEGI 303

Query: 396 FRSIPIRANQRQRALKSLYKTYLDVVHVRKVSARRLDIDTSTVEQQILQNQMDNVEELRK 455
           + SI    N ++R+  +        V +R    + L I T  VE   + N M        
Sbjct: 304 Y-SI---YNSKKRSGAAGQSG--SGVAIRTPYIKVLGIQTD-VEASSIWNSM------TM 350

Query: 456 VTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXXXXXXXXRYRG 515
            ++E+  +   ++ RPD+YE+LA SIAPSI+   DIKK I+  L            R RG
Sbjct: 351 FSEEEEEEFLQLSRRPDIYELLANSIAPSIFGNQDIKKAIVCLLMGGSKKLLPDGMRLRG 410

Query: 516 DINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDADTKQSVLESGA 575
           DIN+LL GDP T+KSQ+L++V K++P  VYTSGKGSSA GLTA + RD  TK+  LE GA
Sbjct: 411 DINVLLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPITKEFFLEGGA 470

Query: 576 LVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTSILASANPIGS 635
           +VL+DGGV CIDEFDKM D  R  +HE M+QQ IS+AKAGI T LN+RTS+LA+ANPI  
Sbjct: 471 MVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYG 530

Query: 636 RYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLEDKPAHV-SES 694
           RY+      ENID    +LSRFD++++V D+ +E  D  +A H+ +++     A + +  
Sbjct: 531 RYDELKSPGENIDFQTTILSRFDMIFIVKDEHNEERDISIANHVMNIHTGHTDAQLEANG 590

Query: 695 DILPVHFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRS---MGDDSRADEKRITATTR 751
             L +  +  YI Y K    P +T  A  +L   +V +R    + +    +   I  T R
Sbjct: 591 SELSIEKMKRYITYCKSRCAPRLTPEAAEKLSSQFVTIRKQLLINELESTERSSIPITIR 650

Query: 752 QLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAIKDYAI-DPKTGKIDMNLIQTGKS 810
           QLE++IR++E+ AK+ LS   E   V EA+RL +++  D A  DP  G   MN  QT   
Sbjct: 651 QLEAIIRITESLAKLELSPIAEERHVDEAIRLFQASTMDAAAQDPIGG---MN--QTNSL 705

Query: 811 VIQRKLQEDLAREI 824
              R+++++L R +
Sbjct: 706 SDIRRVEQELKRRL 719

>Scas_590.6
          Length = 767

 Score =  330 bits (845), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 244/778 (31%), Positives = 398/778 (51%), Gaps = 99/778 (12%)

Query: 143 EVACTFKNFLMTFKYKYRKIKDEQELFINETTDEELYYVNQLHQMRQLGTCNLNLDVRNL 202
           E+  +FKNF++ F+                  D +  Y +QL     +   +LN+++ +L
Sbjct: 26  EIIKSFKNFILEFRL-----------------DSQFIYRDQLRNSLLVKNYSLNVNMEHL 68

Query: 203 ISFPGTEKLYHQLLNYPQEVISIMDQAVKDCMVQLAVDIDGAEGNENLIEVESK------ 256
           I +   E L+ +L + P +VI + + A+     ++ + ++ +  NEN    E+       
Sbjct: 69  IGY--NEDLFKRLSDGPSDVIPLFETAITQVAKRITL-LNRSSQNENGTANETDDLDTRN 125

Query: 257 --------IYKIRPYNLDSERGMRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSV 308
                    +++   +  ++  +R L+   + K+V + G+++ ++ +          C  
Sbjct: 126 SISSALIPNFQLILTSTANQTPLRSLDSEHVSKIVRLSGIIISASVLSSRATHLSLMCRS 185

Query: 309 CDHTTAVEIDR--GIIQEPLRCPRVAC-------------NQRNSMS----LIHNRCSFA 349
           C HTT+++ID    I    +  P  AC             N +N       +IH   +F 
Sbjct: 186 CRHTTSIKIDNFNSITGNSVTLPH-ACLSSVTATDTGDDSNNKNCGPDPYLIIHESSTFI 244

Query: 350 DKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAGDRIEVTGIFRSIPIRANQRQRA 409
           D+Q +KLQE P+LVP G+ P ++++     L +    G R+ + GI+ SI    + ++R 
Sbjct: 245 DQQFLKLQEIPELVPVGEMPRNITMSCDRYLTNRVIPGTRVTIVGIY-SI---YSSKKRG 300

Query: 410 LKSLYKTYLDVVHVR----KVSARRLDIDTSTVEQQILQNQMDNVEELRKVTDEDIAKIN 465
             S        V +R    KV   + D++TS++   +     +  EE  +++        
Sbjct: 301 YNS--NNDGGGVAIRNPFIKVLGIQTDVETSSIWNSVTMFSEEEEEEFLQLS-------- 350

Query: 466 AVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDP 525
               R D+YEVL +SIAPSI+  +DIKK I+  L            R RGDIN+LL GDP
Sbjct: 351 ---RREDLYEVLTKSIAPSIFGNEDIKKAIVCLLMGGSKKLLPDGMRLRGDINVLLLGDP 407

Query: 526 STSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDADTKQSVLESGALVLSDGGVCC 585
            T+KSQ+L++V K++P  VYTSGKGSSA GLTA + RD  T++  LE GA+VL+DGGV C
Sbjct: 408 GTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPATREFYLEGGAMVLADGGVVC 467

Query: 586 IDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTSILASANPIGSRYNTNLPVTE 645
           IDEFDKM D  R  +HE M+QQ IS+AKAGI T LN+RTS+LA+ANPI  RY+      E
Sbjct: 468 IDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGE 527

Query: 646 NIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYL------EDKPAHVSESDILPV 699
           NID    +LSRFD++++V D+ +E+ D  +A H+ +++       +D+    S S+ L +
Sbjct: 528 NIDFQTTILSRFDMIFIVKDEHNEARDISIANHVINIHTGNSTTQQDQDLENSGSE-LSM 586

Query: 700 HFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRS---MGDDSRADEKRITATTRQLESM 756
             +  YI Y +    P ++  A  +L   +V +R    + +    +   I  T RQLE++
Sbjct: 587 EKMKRYITYCRIKCAPRLSVQAAEKLSSQFVTIRKQLLINELESTERSSIPITIRQLEAI 646

Query: 757 IRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAIKDYAI-DPKTGKIDMNLIQTGKSVIQ-- 813
           IR++E+ AK+ LS       V+EA+RL +++  D A  DP  G   +N    G +++   
Sbjct: 647 IRITESLAKLELSPVAHERHVEEAIRLFQASTMDAASQDPIGG---LNQTGNGSNIMAEI 703

Query: 814 RKLQEDLAREIVRLLTERSADVITYNELARLLNENSQDRLDNMTISDALNRLQQEDKI 871
           R+++ +L R   RL    S    +Y  L R   E+  +R     +  AL  L++ D I
Sbjct: 704 RRIESELKR---RLPIGWST---SYQTLRREFVES--NRFSQGALDKALYALEKHDTI 753

>Kwal_56.23282
          Length = 761

 Score =  329 bits (844), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 221/721 (30%), Positives = 360/721 (49%), Gaps = 77/721 (10%)

Query: 143 EVACTFKNFLMTFKYKYRKIKDEQELFINETTDEELYYVNQLHQMRQLGTCNLNLDVRNL 202
           E+  +F NF++ F+                  D    Y  QL     +   ++ +D  +L
Sbjct: 26  EIVKSFHNFVLEFRL-----------------DAHFVYREQLRSNLLVKNYSITVDTAHL 68

Query: 203 ISFPGTEKLYHQLLNYPQEVISIMDQAVKDCMVQLAV----------------DIDGAEG 246
           I +   E LY +L + P +V+ + +QAV     ++A+                  D A  
Sbjct: 69  IGY--NEDLYKRLYDEPTDVLPLFEQAVSQVARRIALLSRDPNMDPNNQLENASTDDAPN 126

Query: 247 NENLIEVESKIYKIRPYNLDSERGMRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKC 306
           +   +  +    ++   +  SE  +R L   ++ K+V + G+V+ ++ +          C
Sbjct: 127 SGASLAFDIPTCQVMLISDSSETSLRVLGSENVSKIVRVSGIVVSASVLSSRATFLTLMC 186

Query: 307 SVCDHTTAVEIDR------GIIQEPLRC--------PRVACNQRNSMSLIHNRCSFADKQ 352
             C H T + ++         +  P  C            C Q   M ++H    F D+Q
Sbjct: 187 RNCRHVTTMHLNSFGSLGGNHVSLPRNCLADHSRETGSNPCGQDPYM-IVHESSRFVDQQ 245

Query: 353 VIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAGDRIEVTGIFRSIPIRANQRQRALKS 412
            +KLQE P+LVP G+ P ++ +     L +    G R  + GI+     ++     A   
Sbjct: 246 FLKLQEIPELVPVGEMPRNILMSCDRYLTNRIVPGTRATIVGIYSIYQAKSRGAGTAASG 305

Query: 413 LYKTYLDVVHVRKVSARRLDIDTSTVEQQILQNQMDNVEELRKVTDEDIAKINAVAARPD 472
                      + V+ R   +    ++  +  N M N       TDE+  +   ++ RPD
Sbjct: 306 ----------GKAVAIRNPYVKILGIQTDLDGNPMSNTVVF---TDEEEEQFLTLSRRPD 352

Query: 473 VYEVLARSIAPSIYELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQI 532
           +YE+  +SIAPSIY  +DIKK I+  L            R RGDIN+LL GDP T+KSQ+
Sbjct: 353 LYEIFTKSIAPSIYGNEDIKKAIVCLLMGGSKKLLPDGMRLRGDINVLLLGDPGTAKSQL 412

Query: 533 LQYVHKIAPRGVYTSGKGSSAVGLTAYITRDADTKQSVLESGALVLSDGGVCCIDEFDKM 592
           L++V K++P  VYTSGKGSSA GLTA + RD  T++  LE GA+VL+DGGV CIDEFDKM
Sbjct: 413 LKFVEKVSPISVYTSGKGSSAAGLTASVQRDPATREFYLEGGAMVLADGGVVCIDEFDKM 472

Query: 593 SDSTRSVLHEVMKQQPISVAKAGIITTLNARTSILASANPIGSRYNTNLPVTENIDLPPP 652
            D  R  +HE M+QQ IS+AKAGI T LN+RTS+LA+ANPI  RY+      ENID    
Sbjct: 473 RDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGENIDFQTT 532

Query: 653 LLSRFDLVYLVLDKVSESTDRELAKHLTSLY----LEDKPAHVSESDILPVHFLTMYINY 708
           +LSRFD++++V D  +E  D  +A H+ +++      ++    + ++ +P+  +  YI Y
Sbjct: 533 ILSRFDMIFIVKDHHNEERDISIANHVMNIHTGRTATNEEEREAAANEIPIEKMKRYITY 592

Query: 709 AKQHIHPVITEGAKTELVRAYVNMRS--MGDDSRADEK-RITATTRQLESMIRLSEAHAK 765
            +    P ++  A  +L   +V +R   + ++ +++++  I  T RQLE++IR+SE+ AK
Sbjct: 593 CRMKCAPRLSPQAAEKLSSHFVGIRKKLLINELQSEQRSSIPITVRQLEAIIRISESLAK 652

Query: 766 VRLSQQVEVSDVQEAVRLIKSAIKDYAIDPKTGKIDMNLIQTGKSVIQ--RKLQEDLARE 823
           + LS       V EA+RL +++  D A     G +  N     + ++Q  R+++E+L R 
Sbjct: 653 LELSPVAHERHVDEAIRLFQASTMDAASQDPIGGLGQN-----QDLVQDVRRIEEELKRR 707

Query: 824 I 824
           +
Sbjct: 708 L 708

>YGL201C (MCM6) [1794] chr7 complement(117856..120909) Protein
           involved in DNA replication, member of the MCM/P1 family
           of proteins [3054 bp, 1017 aa]
          Length = 1017

 Score =  335 bits (860), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 224/670 (33%), Positives = 340/670 (50%), Gaps = 87/670 (12%)

Query: 252 EVESKIYKIRPYNLDSERGMRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDH 311
           E   ++++I  +NL +   +R++    I  L+SI G V R++ V P++  A F C +C  
Sbjct: 257 EQTERVFQISFFNLPTVHRIRDIRSEKIGSLLSISGTVTRTSEVRPELYKASFTCDMCRA 316

Query: 312 TTAVEIDRGIIQEPLRCPRVACNQRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHS 371
                       EP  CP  +C  R   +L   R  F D Q +++QE  + +P G  P +
Sbjct: 317 IVDNVEQSFKYTEPTFCPNPSCENRAFWTLNVTRSRFLDWQKVRIQENANEIPTGSMPRT 376

Query: 372 VSLCIYDELVDSCRAGDRIEVTGIFRSIP-----------------IRA--------NQR 406
           + + +  + V+  + GDR + TG+   +P                  R         N  
Sbjct: 377 LDVILRGDSVERAKPGDRCKFTGVEIVVPDVTQLGLPGVKPSSTLDTRGISKTTEGLNSG 436

Query: 407 QRALKSL------YKTYLDVVHV----RKVSARRLDIDTSTVEQQI-----LQ------- 444
              L+SL      YK      HV      + A   D +++  E ++     LQ       
Sbjct: 437 VTGLRSLGVRDLTYKISFLACHVISIGSNIGASSPDANSNNRETELQMAANLQANNVYQD 496

Query: 445 NQMDNVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXX 504
           N+ D    L  ++ ++I ++  +     +Y+ L RSIAP+++  + +KKGILLQ+     
Sbjct: 497 NERDQEVFLNSLSSDEINELKEMVKDEHIYDKLVRSIAPAVFGHEAVKKGILLQMLGGVH 556

Query: 505 XXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDA 564
                  + RGDINI + GDPSTSKSQ L+YV   APR VYTSGK SSA GLTA + RD 
Sbjct: 557 KSTVEGIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSGKASSAAGLTAAVVRDE 616

Query: 565 DTKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNART 624
           +     +E+GAL+L+D G+CCIDEFDKM  S +  +HE M+QQ IS+AKAGI  TLNART
Sbjct: 617 EGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNART 676

Query: 625 SILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYL 684
           SILA+ANP+G RYN  L +  N+++  P++SRFDL +++LD  +E  D ELA H+  L++
Sbjct: 677 SILAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHIVDLHM 736

Query: 685 ED----KPAHVSESDILPVHFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRSMGDDSR 740
           +     +P   +E        L  YI YA+    P++T+ A++ LV  Y  +R   DD++
Sbjct: 737 KRDEAIEPPFSAEQ-------LRRYIKYART-FKPILTKEARSYLVEKYKELRK--DDAQ 786

Query: 741 ADEK---RITATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAIKDYAID--- 794
              +   RI  T RQLESMIRLSEA A+     ++  S + EA  L++ +I    +D   
Sbjct: 787 GFSRSSYRI--TVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSIIRVDVDDVE 844

Query: 795 -------------PKTGKIDMNLIQTGKSVIQRK----LQEDLAREIVRLLT-ERSADVI 836
                          +G  D N   TG  VI  +    ++E  +    R  T E+    +
Sbjct: 845 MDEEFDNIESQSHAASGNNDDNDDGTGSGVITSEPPADIEEGQSEATARPGTSEKKKTTV 904

Query: 837 TYNELARLLN 846
           TY++   ++N
Sbjct: 905 TYDKYVSMMN 914

>KLLA0F10087g complement(935618..938629) similar to sp|P53091
           Saccharomyces cerevisiae YGL201c MCM6 involved in
           replication, start by similarity
          Length = 1003

 Score =  334 bits (857), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 215/595 (36%), Positives = 318/595 (53%), Gaps = 82/595 (13%)

Query: 256 KIYKIRPYNLDSERGMRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAV 315
           ++ +I   NL +   +R++  N I  L++I G V R++ + P++  A F C +C      
Sbjct: 243 RVLQISFLNLPTVHRIRDIRANKIGSLMAISGTVTRTSEIRPELYKASFTCELC------ 296

Query: 316 EIDRGIIQ---------EPLRCPRVACNQRNSMSLIHNRCSFADKQVIKLQETPDLVPDG 366
              R +I          EP  CP   C  ++  SL  NR  F D Q +++QE  + +P G
Sbjct: 297 ---RAVIDNVEQVFKYTEPTSCPNPTCENQSFWSLNVNRSKFLDWQKVRIQENSNEIPSG 353

Query: 367 QTPHSVSLCIYDELVDSCRAGDRIEVTGIFRSIP---------IRA-------------- 403
             P ++ + +  + V+  + GDR +  G    +P         ++A              
Sbjct: 354 SMPRTLDIILRGDCVERAKPGDRCKFIGTEIVVPDVSQLGLPGVKASSTPDSRGISRTTE 413

Query: 404 --NQRQRALKSL------YKTYLDVVHVRKV----SARRL---DID-TSTVEQQILQN-- 445
             N     LKSL      YK      HV  V    +  R+   D D TS  +   L+N  
Sbjct: 414 GLNSGISGLKSLGVRDLTYKISFLACHVENVGTSFNGSRINEEDADKTSKFDYINLRNYQ 473

Query: 446 ------QMDNVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQL 499
                 + D    L ++  ++I ++  +    ++Y+ L +SIAP+++  + IKKGILLQ+
Sbjct: 474 NYEMAAETDQEIFLTRLDSDEINELKEMVKDENIYDKLVKSIAPAVFGHETIKKGILLQM 533

Query: 500 XXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAY 559
                       + RGDINI + GDPSTSKSQ L+YV   +PR VYTSGK SSA GLTA 
Sbjct: 534 LSGVHKTTVEGIKLRGDINICIVGDPSTSKSQFLKYVCNFSPRAVYTSGKASSAAGLTAA 593

Query: 560 ITRDADTKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITT 619
           + +D +     +E+GAL+L+D GVCCIDEFDKM  + +  +HE M+QQ IS+AKAGI  T
Sbjct: 594 VVKDEEGGDFTIEAGALMLADNGVCCIDEFDKMDIADQVAIHEAMEQQTISIAKAGIHAT 653

Query: 620 LNARTSILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHL 679
           LNARTSILA+ANP+G RYN  L +  N+++  P++SRFDL +++LD  +E  D ELA H+
Sbjct: 654 LNARTSILAAANPVGGRYNRKLTLRSNLNMSAPIMSRFDLFFVILDDCNEKIDTELASHI 713

Query: 680 TSLYLEDKPAHVSESDILP---VHFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRSMG 736
             L+++       +S I P      L+ YINYAK    PV+T+ A+  LV+ Y  +R   
Sbjct: 714 VDLHMK------RDSAINPPFSAEQLSRYINYAKT-FKPVMTKEARDYLVKRYTELRK-- 764

Query: 737 DDSRADEK---RITATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAI 788
           DD++   K   RIT   RQLES+IRLSEA A+     ++  S V EA  L++ +I
Sbjct: 765 DDAQGYSKSSYRITV--RQLESLIRLSEAIARANCVDEIVPSFVAEAYDLLRQSI 817

>CAGL0M05423g 577097..579535 highly similar to sp|P38132
           Saccharomyces cerevisiae YBR202w CDC47, start by
           similarity
          Length = 812

 Score =  327 bits (837), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 205/523 (39%), Positives = 304/523 (58%), Gaps = 36/523 (6%)

Query: 271 MRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEIDRGIIQEPLRCPR 330
           +R++    + +L++++G++ R + V P + +  + C  C +    E++       + C  
Sbjct: 221 VRQIKGELLGELITVRGIITRVSDVKPAVTVIAYTCDQCGYEIFQEVNSKTFTPLVECTS 280

Query: 331 VAC--NQRNSMSLIHNRCS-FADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAG 387
             C  NQ      +  R S F   Q  K+QE    VP G  P S+++ +   LV S   G
Sbjct: 281 RECSQNQTKGQLFMSTRASKFNAFQECKIQELSQQVPVGHIPRSLTIHVNGPLVRSVTPG 340

Query: 388 DRIEVTGIFRSIPIRANQRQRALKS--LYKTYLDVVHVRKVSARRLDIDTSTVEQQILQN 445
           D +++ GIF   P       +ALK+  L +TYL+  HVR+             +++    
Sbjct: 341 DIVDIAGIFLPSPYTGF---KALKAGLLTETYLEAHHVRQH------------KKKFASF 385

Query: 446 QMDNVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXX 505
           QM         T +  + ++A+A   +VYE LA+SIAP IY   D+KK +LL L      
Sbjct: 386 QM---------TPQVRSNVDALAQSGNVYERLAKSIAPEIYGNLDVKKALLLLLVGGVDK 436

Query: 506 XXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDAD 565
                 + RGDINI L GDP  +KSQ+L+ + KI PRGVYT+GKGSS VGLTA + +D  
Sbjct: 437 RVGDGMKIRGDINICLMGDPGVAKSQLLKAICKITPRGVYTTGKGSSGVGLTAAVMKDPV 496

Query: 566 TKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTS 625
           T + +LE GALVL+D G+CCIDEFDKM +S R+ +HEVM+QQ IS++KAGI TTLNARTS
Sbjct: 497 TDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNARTS 556

Query: 626 ILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLE 685
           ILA+ANP+  RYN  L   ENI+LP  LLSRFD+++L+LD  +   D +LA H+  +++ 
Sbjct: 557 ILAAANPLYGRYNPRLSPLENINLPAALLSRFDVMFLLLDTPNRENDEQLANHVAYVHMY 616

Query: 686 DKPAHVSESDILPVHFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRSMGDDSRADEKR 745
           +K   +    I P   +  +I YA+  + PV+T      +V AY+ +R   D  R  + +
Sbjct: 617 NKQPDLDFEPIEPT-MMREFIAYART-MRPVMTAEINDHVVSAYIRLRQ--DSKREMDSK 672

Query: 746 IT---ATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIK 785
            +   AT R L ++IRLS+A AK+RLS+ V++ DV+EA+RLI+
Sbjct: 673 FSFGQATPRTLLAIIRLSQALAKLRLSETVDIDDVEEALRLIR 715

>Scas_712.49
          Length = 1019

 Score =  330 bits (846), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 207/586 (35%), Positives = 305/586 (52%), Gaps = 54/586 (9%)

Query: 249 NLIEVESKIYKIRPYNLDSERGMRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSV 308
           N  E   +I++I  +NL +   +R++    I  L+SI G V R++ V P++  A F C +
Sbjct: 242 NSPEQSERIFQISFFNLPTVFRIRDIRSEKIGSLLSISGTVTRTSEVRPELYKASFTCDL 301

Query: 309 CDHTTAVEIDRGIIQEPLRCPRVACNQRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQT 368
           C              EP  CP  +C  R   +L   R  F D Q +++QE  + +P G  
Sbjct: 302 CRAQVDNVEQSFKYTEPTFCPNPSCENRAFWTLNVTRSKFLDWQKVRIQENANEIPSGSM 361

Query: 369 PHSVSLCIYDELVDSCRAGDRIEVTGIFRSIP-----------------IRA-------- 403
           P ++ + +  + V+  + GDR + TG    +P                  R         
Sbjct: 362 PRTLDVILRGDCVERAKPGDRCKFTGTEIVVPDVTQLGLPGIKPTSSMDTRGIARSTEGL 421

Query: 404 NQRQRALKSL------YKTYLDVVHVRKVSAR-----------RLDIDTSTVEQQILQN- 445
           N     L++L      YK      HV  + +             L +  +     + Q+ 
Sbjct: 422 NNGVSGLRALGVRDLTYKISFLACHVISIGSNTDASSNGNTENELQLAATLHGSNVYQDY 481

Query: 446 QMDNVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXX 505
           + D    L  +  E+I ++  +     +Y+ L RSIAP+++  + +KKGILLQ+      
Sbjct: 482 EKDQEVFLNSLNSEEINELKEMVKDEHIYDKLVRSIAPAVFGHEAVKKGILLQMLGGVHK 541

Query: 506 XXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDAD 565
                 + RGDINI + GDPSTSKSQ L+YV    PR VYTSGK SSA GLTA + RD +
Sbjct: 542 STVEGIKLRGDINICIVGDPSTSKSQFLKYVCGFVPRSVYTSGKASSAAGLTAAVVRDEE 601

Query: 566 TKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTS 625
                +E+GAL+L+D G+CCIDEFDKM  S +  +HE M+QQ IS+AKAGI  TLNARTS
Sbjct: 602 GGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTS 661

Query: 626 ILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLE 685
           ILA+ANPIG RYN  L +  N+++  P++SRFDL +++LD  +E  D ELA H+  L+++
Sbjct: 662 ILAAANPIGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHIVDLHMK 721

Query: 686 DKPAHVSESDILPVHFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRSMGDDSRADEK- 744
              A  S         L  YI YA+    P++T+ A+  LV  Y ++R   DD++   K 
Sbjct: 722 RDAAIHSP---FTAEQLRRYIRYART-FKPILTKEARQYLVEKYKDLRK--DDAQGYSKS 775

Query: 745 --RITATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAI 788
             RIT   RQLESMIRLSEA A+     ++  + + EA  L++ +I
Sbjct: 776 SYRITV--RQLESMIRLSEAIARANCVDEITPAFIAEAYDLLRQSI 819

>Scas_721.36
          Length = 855

 Score =  325 bits (833), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 203/523 (38%), Positives = 298/523 (56%), Gaps = 36/523 (6%)

Query: 271 MRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEIDRGIIQEPLRCPR 330
           +RE+  + + +L++++G+V R + V P + +  + C  C +    E+        + C  
Sbjct: 227 VREIKGDFLGQLITVRGIVTRVSDVKPSVLVIAYTCDQCGYEVFQEVHSRTFTPLIDCTS 286

Query: 331 VAC--NQRNSMSLIHNRCS-FADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAG 387
             C  NQ      +  R S F+  Q +K+QE    VP G  P S+S+ +   LV S   G
Sbjct: 287 EECAQNQTKGQLFMSTRASKFSAFQEVKIQELSQQVPVGHIPRSLSIHVNGALVRSMTPG 346

Query: 388 DRIEVTGIFRSIPIRANQRQRALKS--LYKTYLDVVHVRKVSARRLDIDTSTVEQQILQN 445
           D ++V+GIF   P       +ALK+  L +TYL+   VR+   +    D S+        
Sbjct: 347 DIVDVSGIFLPSPYTGF---KALKAGLLTETYLEAQFVRQHKKKFASFDLSS-------G 396

Query: 446 QMDNVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXX 505
             D V E+               A+ DVY  +A+SIAP IY   D+KK +LL L      
Sbjct: 397 MEDRVTEM--------------IAQGDVYNRMAKSIAPEIYGNLDVKKALLLLLVGGVDK 442

Query: 506 XXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDAD 565
                 + RGDIN+ L GDP  +KSQ+L+ + KI+PRGVYT+GKGSS VGLTA + +D  
Sbjct: 443 KVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRGVYTTGKGSSGVGLTAAVMKDPV 502

Query: 566 TKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTS 625
           T + +LE GALVL+D G+CCIDEFDKM +S R+ +HEVM+QQ IS++KAGI TTLNAR S
Sbjct: 503 TDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNARAS 562

Query: 626 ILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLE 685
           ILA+ANP+  RYN  L   ENI+LP  LLSRFD+++L+LD  +   D +LA+H+  +++ 
Sbjct: 563 ILAAANPLYGRYNPRLSPLENINLPAALLSRFDILFLLLDTPNRENDEKLAEHVAYVHMH 622

Query: 686 DKPAHVSESDILPVHFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRSMGDDSRADEKR 745
                +    I P   +  YI +AK    PV+ E     +++AY+ +R   D  R  + +
Sbjct: 623 QSQPDLEFEPIEPAR-MREYIAFAKSK-RPVMNEAVNEYVIQAYIRLRQ--DSKREMDSK 678

Query: 746 IT---ATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIK 785
            +   AT R L  +IRLS+  AK+RLS  V++ DV+EA+RL++
Sbjct: 679 FSFGQATPRTLLGIIRLSQGLAKLRLSDTVDIDDVEEALRLVR 721

>Kwal_27.12002
          Length = 833

 Score =  323 bits (827), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 223/588 (37%), Positives = 324/588 (55%), Gaps = 51/588 (8%)

Query: 271 MRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEIDRGIIQEPLRCPR 330
           +R++  + +  L++ +G+V R + V P + +  + C  C +    E++         C  
Sbjct: 217 VRQIRGDLLGNLITARGIVTRVSDVKPSVMVNAYTCDQCGYEVFQEVNSRTFTPLAECTS 276

Query: 331 VAC--NQRNSMSLIHNRCS-FADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAG 387
             C  NQ      +  R S F+  Q  K+QE  + VP G  P ++++ I   LV S   G
Sbjct: 277 EQCSQNQTKGQLFMSTRASKFSAFQECKIQEMSEQVPIGHIPRTLTIHINGALVRSLTPG 336

Query: 388 DRIEVTGIFRSIPIRANQRQRALKS--LYKTYLDVVHVRKVSARRLDIDTSTVEQQILQN 445
           D ++VTGI+   P       +ALK+  L +TYL+  +V +   +      +T E      
Sbjct: 337 DVVDVTGIYMPAPYTGF---KALKAGLLTETYLEAQYVFQHKKK-----FATFE------ 382

Query: 446 QMDNVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXX 505
                     +T E  A++  +A + DVY  LA+SIAP IY   D+KK +LL L      
Sbjct: 383 ----------ITPETEARVFNIARQGDVYNRLAKSIAPEIYGNLDVKKALLLLLVGGVDK 432

Query: 506 XXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDAD 565
                 + RGDINI L GDP  +KSQ+L+ + KI+PRGVYT+GKGSS VGLTA + +D  
Sbjct: 433 KVGDGMKIRGDINICLMGDPGVAKSQLLKSICKISPRGVYTTGKGSSGVGLTAAVMKDPV 492

Query: 566 TKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTS 625
           T + VLE GALVLSD G+CCIDEFDKM +  R+ +HEVM+QQ IS++KAGI TTLNARTS
Sbjct: 493 TDEMVLEGGALVLSDNGICCIDEFDKMDEGDRTAIHEVMEQQTISISKAGINTTLNARTS 552

Query: 626 ILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLE 685
           ILA+ANP+  RYN  L   ENI+LP  LLSRFD+++L+LD  +   D +LA+H+  +++ 
Sbjct: 553 ILAAANPLYGRYNPRLSPLENINLPAALLSRFDILFLLLDTPNREDDEKLAEHVAFVHMH 612

Query: 686 DKPAHVSESDILPVHFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRSMGDDSRADEKR 745
           +K   +    I P   +  +I YAK    P ++      +V++Y+ MR   D  +A + R
Sbjct: 613 NKQPDLGFEPIEPSD-MREFIAYAKTK-RPTMSSEVNEYVVQSYIRMRQ--DSKKAMDSR 668

Query: 746 IT---ATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLI-----------KSAIKDY 791
            +   AT R L ++IRLS+  AK+R S  VEV D++EA+RLI           K + +D 
Sbjct: 669 FSFGQATPRTLLAIIRLSQGLAKLRFSDIVEVDDIEEALRLIQVSKESLYQENKKSREDD 728

Query: 792 AIDPKTGKIDMNLIQTGKSVIQRKLQEDLAREIVRLLTERSADVITYN 839
               K   I  NL + G   IQ+ L  DL   IVR +  R   ++  N
Sbjct: 729 NPTTKIYTIIKNLARDGPH-IQQSLPYDL---IVRAVRSRGFTMLQLN 772

>Kwal_47.18966
          Length = 1044

 Score =  327 bits (838), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 210/590 (35%), Positives = 308/590 (52%), Gaps = 70/590 (11%)

Query: 252 EVESKIYKIRPYNLDSERGMRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDH 311
           E   +I++I  +NL +   +R++    I  L+SI G V R++ V P++  A F C +C  
Sbjct: 274 EQTERIFQISFFNLPTVNRIRDIRAEKIGSLMSISGTVTRTSEVRPELYKASFTCEMC-- 331

Query: 312 TTAVEIDRGIIQ--EPLRCPRVACNQRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTP 369
              V+    + +  +P  CP  +C  +   +L   R  F D Q +++QE  + +P G  P
Sbjct: 332 RAVVDNVEQVFKYTQPTYCPNPSCENQAFWTLSVGRSKFLDWQKVRIQENANEIPTGSMP 391

Query: 370 HSVSLCIYDELVDSCRAGDRIEVTGIFRSIP---------------------IRA----N 404
            ++ + +  + V+  + GDR + TG    +P                      R+    N
Sbjct: 392 RTLDVVLRGDCVERAKPGDRCKFTGTEIVVPDITQLGLPGVKPSSTMDNRGIARSSEGLN 451

Query: 405 QRQRALKSL------YKTYLDVVHVRKVSARRLDIDTSTVEQQ----ILQNQMDNVEE-- 452
                LKSL      YK      HV        D + +   Q     +L  Q++NV    
Sbjct: 452 TGVSGLKSLGVRDLTYKISFLACHVTPTGK---DANNNANAQDEGGDLLSMQVNNVGNDD 508

Query: 453 -------LRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXX 505
                  L  +  ++I ++  +     +Y+ L RSIAP+++  + +KKGILLQ+      
Sbjct: 509 ERDQEIFLNSLNSQEINELKEMVKDEQIYDKLVRSIAPAVFGHNTVKKGILLQMLGGVHK 568

Query: 506 XXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDAD 565
                   RGDINI + GDPSTSKSQ L+YV   APR VYTSGK SSA GLTA + +D +
Sbjct: 569 TTVEGINLRGDINICIVGDPSTSKSQFLKYVCGFAPRAVYTSGKASSAAGLTAAVVKDEE 628

Query: 566 TKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTS 625
                +E+GAL+L+D G+CCIDEFDKM  S +  +HE M+QQ IS+AKAGI  TLNARTS
Sbjct: 629 AGDFTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTS 688

Query: 626 ILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLE 685
           ILA+ANP+G RYN  L +  N+++  P++SRFDL ++VLD  +E  D ELA H+  L+++
Sbjct: 689 ILAAANPVGGRYNRKLTLRGNLNMTAPIMSRFDLFFVVLDDCNEKIDTELAAHIVDLHMK 748

Query: 686 D----KPAHVSESDILPVHFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRSMGDDSRA 741
                 P   +E        L  YI YA+    PV+ E A+  LV  Y  +R   DD++ 
Sbjct: 749 RDEAIDPPFTAEQ-------LRRYIKYART-FKPVMNEEARNYLVEKYKELRR--DDAQG 798

Query: 742 DEK---RITATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAI 788
             K   RI  T RQLESMIRLSE  A+     ++  + V EA  L++ +I
Sbjct: 799 FSKSSYRI--TVRQLESMIRLSEGIARANCVDEITPNFVAEAYDLLRQSI 846

>AFR546W [3738] [Homologous to ScYGL201C (MCM6) - SH]
           complement(1415577..1418594) [3018 bp, 1005 aa]
          Length = 1005

 Score =  321 bits (823), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 199/584 (34%), Positives = 306/584 (52%), Gaps = 57/584 (9%)

Query: 252 EVESKIYKIRPYNLDSERGMRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDH 311
           E   +I++I  +N+     +R++    +  L++I G V R++ V P++  A F C +C  
Sbjct: 263 EQTERIFQISFFNIPVTNRIRDIRAEKVGTLMTISGTVTRTSEVRPELFKASFTCDMCRA 322

Query: 312 TTAVEIDRGIIQEPLRCPRVACNQRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHS 371
                       EP  CP  +C  +   +L   R  F D Q +++QE  + +P G  P +
Sbjct: 323 VVDNVEQVFKFTEPTFCPNPSCENQAFWTLNIGRSRFLDWQRVRIQENSNEIPTGSMPRT 382

Query: 372 VSLCIYDELVDSCRAGDRIEVTGIFRSIP-----------------IRA--------NQR 406
           + + +  + V+  + GDR   TG    +P                  R         N  
Sbjct: 383 LDVILRGDCVERAKPGDRCRFTGTEIVMPDVTQLGLAGMKPSSAPDTRGISRTMEGLNSG 442

Query: 407 QRALKSL------YKTYLDVVHVRKV---SARRLDIDTSTVEQQILQN---QMDNVEE-- 452
              LK+L      YK      HV  V   S  + D+ +  ++  +LQ+    +D+ E   
Sbjct: 443 VSGLKTLGVRDLTYKIAFLACHVMGVGNNSNPQGDVLSHELDVNMLQHLNKGIDDTERDQ 502

Query: 453 ---LRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXXXXXX 509
              L  ++ ++I ++  +     +Y+ L +SIAP+++  + +KKG+LLQ+          
Sbjct: 503 ELFLNSLSSDEINELKEMVKDERIYDKLVQSIAPAVFGHETVKKGLLLQMLGGVHKTTVE 562

Query: 510 XXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDADTKQS 569
             + RGDINI + GDPSTSKSQ L+YV    PR VYTSGK SSA GLTA + +D +    
Sbjct: 563 GIKLRGDINICIVGDPSTSKSQFLKYVCAFVPRAVYTSGKASSAAGLTAAVVKDEEGGDF 622

Query: 570 VLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTSILAS 629
            +E+GAL+L+D G+CCIDEFDKM  S +  +HE M+QQ IS+AKAGI  TLNARTSILA+
Sbjct: 623 TIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAA 682

Query: 630 ANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLE---- 685
           ANP+G RYN  L +  N+++  P++SRFDL +++LD  ++  D ELA H+ +L+++    
Sbjct: 683 ANPVGGRYNRKLTLRGNLNMTAPIMSRFDLFFVILDDCNQKVDTELASHIVNLHMKCDDA 742

Query: 686 -DKPAHVSESDILPVHFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRSMGDDSRADEK 744
            D P  + +        L  YI YA+    P++TE A+  LV  Y  +R   D     + 
Sbjct: 743 IDPPFTMDQ--------LRRYIKYART-FKPILTEDARQFLVEKYKELRK-NDIQGYSKS 792

Query: 745 RITATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAI 788
               T RQLESMIRLSEA A+     ++  + V EA  L++ +I
Sbjct: 793 SYRITVRQLESMIRLSEAIARANCVDEITPAFVAEAYDLLRQSI 836

>KLLA0D09262g 780273..782513 similar to sp|P29496 Saccharomyces
           cerevisiae YLR274w CDC46 cell division control protein,
           start by similarity
          Length = 746

 Score =  315 bits (807), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 214/692 (30%), Positives = 355/692 (51%), Gaps = 70/692 (10%)

Query: 132 RIIWGTNVSIQE---VACTFKNFLMTFKYKYRKIKDEQELFINETTDEELYYVNQLHQMR 188
           R++ G  +S  E   +  +FK+F++ F+                  D    Y  QL    
Sbjct: 12  RVLAGEELSSNENSEIIKSFKSFILEFRL-----------------DSNFVYREQLRNNL 54

Query: 189 QLGTCNLNLDVRNLISFPGTEKLYHQLLNYPQEVISIMDQAVKDCMVQLAV-----DIDG 243
            +    L+++  +LI +   E LY +L + P ++I + +QA+     ++ +     DID 
Sbjct: 55  LVHKYFLDVNTEHLIGY--NEDLYKKLQDEPIDIIPLFEQAITQVAKRIVLLSQDSDIDP 112

Query: 244 AEGNENLIEVESKIYKIRPYNLDSERGMRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAF 303
                N       + ++   +   E  +R L+ + + K+V I G+++ S+ +        
Sbjct: 113 ETALSNF-----PLCQLILNSSSMEIPLRSLDSDHVSKIVRITGIIISSSVLTSRATQLS 167

Query: 304 FKCSVCDHTTAVEIDRGIIQE------PLRCPRVACNQRNSMS---------LIHNRCSF 348
             C  C H T ++++            P  C     N+ +  +         ++H    F
Sbjct: 168 LMCRSCKHMTTLKLNNFQNLNNNNVQLPRECLADRSNETDETAASCGPDPYLIVHESSQF 227

Query: 349 ADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAGDRIEVTGIFRSIPIRANQRQR 408
            D+Q +KLQE P+ VP G+ P ++ +     L +    G R+ + GI+       +  Q 
Sbjct: 228 IDQQFLKLQELPESVPIGELPRNLLMTCDRYLTNQVVPGTRVTIIGIY-------SIYQS 280

Query: 409 ALKSLYKTYLDVVHVRKVSARRLDIDTSTVEQQILQNQMDNVEELRKVTDEDIAKINAVA 468
             KS+  +    V +R    + + I      + +  N ++N   L   ++ +  +   ++
Sbjct: 281 KNKSINSSGNKAVAIRNPYVKVIGI------KHLSNNPLNN--SLSMFSESEEQEFLELS 332

Query: 469 ARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTS 528
            RPD+YE+ A SIAPSIY   DIKK I+  L            R RGDIN+LL GDP T+
Sbjct: 333 QRPDLYELFANSIAPSIYGNTDIKKAIVCLLMGGSKKLLPDGMRLRGDINVLLLGDPGTA 392

Query: 529 KSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDADTKQSVLESGALVLSDGGVCCIDE 588
           KSQ+L++V K++P  VYTSGKGSSA GLTA + RD  T++  LE GA+VL+DGGV CIDE
Sbjct: 393 KSQLLKFVEKVSPISVYTSGKGSSAAGLTASVQRDPTTREFYLEGGAMVLADGGVVCIDE 452

Query: 589 FDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTSILASANPIGSRYNTNLPVTENID 648
           FDKM D  R  +HE M+QQ IS+AKAGI T LN+RTS+LA+ANP+  RY+      ENID
Sbjct: 453 FDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPVYGRYDDLKSPGENID 512

Query: 649 LPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYL-----EDKPAHVSESDILPVHFLT 703
               +LSRFD++++V D  +E+ D ++A H+ +++       D   + + ++ +P+  + 
Sbjct: 513 FQTTILSRFDMIFIVKDDHNEARDIQIANHVMNIHTGRTQQNDPNDNSNSNNEIPIETMK 572

Query: 704 MYINYAKQHIHPVITEGAKTELVRAYVNMRS-MGDDSRADEKR--ITATTRQLESMIRLS 760
            Y++Y +    P ++  A T+L   ++ +R  + +  R   +R  I  T RQLE++IR++
Sbjct: 573 RYVSYCRLKCAPRLSPEAATKLSSHFITIRKQLQESERHSNERSSIPITVRQLEAIIRIT 632

Query: 761 EAHAKVRLSQQVEVSDVQEAVRLIKSAIKDYA 792
           E+ AK+ L+       V EA+RL +++  D A
Sbjct: 633 ESLAKLELNPVATEKHVDEAIRLFQASTMDAA 664

>YLR274W (CDC46) [3667] chr12 (691557..693884) Member of the MCM/P1
           family, component of the MCM complex that binds at ARS
           elements to initiate DNA replication [2328 bp, 775 aa]
          Length = 775

 Score =  314 bits (805), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 218/732 (29%), Positives = 364/732 (49%), Gaps = 85/732 (11%)

Query: 143 EVACTFKNFLMTFKYKYRKIKDEQELFINETTDEELYYVNQLHQMRQLGTCNLNLDVRNL 202
           E+  +FKNF++ F+                  D +  Y +QL     +   +L +++ +L
Sbjct: 26  EIIKSFKNFILEFRL-----------------DSQFIYRDQLRNNILVKNYSLTVNMEHL 68

Query: 203 ISFPGTEKLYHQLLNYPQEVISIMDQAVKDCMVQLAVDIDGAEGNENLIEVESKIYKIRP 262
           I +   E +Y +L + P ++I + + A+     ++++       N N  + E+       
Sbjct: 69  IGY--NEDIYKKLSDEPSDIIPLFETAITQVAKRISILSRAQSANNNDKDPENTSMDTDS 126

Query: 263 YNLDS-------------ERGMRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVC 309
             L+S             +  +R+L+   + K+V + G+++ ++ +          C  C
Sbjct: 127 LLLNSLPTFQLILNSNANQIPLRDLDSEHVSKIVRLSGIIISTSVLSSRATYLSIMCRNC 186

Query: 310 DHTTAVEIDR--GIIQEPLRCPRVACNQRNSMS-----------------------LIHN 344
            HTT++ I+    I    +  PR   +   S S                       +IH 
Sbjct: 187 RHTTSITINNFNSITGNTVSLPRSCLSTIESESSMANESNIGDESTKKNCGPDPYIIIHE 246

Query: 345 RCSFADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAGDRIEVTGIFRSIPIRAN 404
              F D+Q +KLQE P+LVP G+ P ++++     L +    G R+ + GI+ SI    N
Sbjct: 247 SSKFIDQQFLKLQEIPELVPVGEMPRNLTMTCDRYLTNKVIPGTRVTIVGIY-SIYNSKN 305

Query: 405 QRQRALKSLYKTYLDVVHVR----KVSARRLDIDTSTVEQQILQNQMDNVEELRKVTDED 460
                          V  +R    K+   + D++TS++   +              T+E+
Sbjct: 306 GAGSGRSGGGNGGSGVA-IRTPYIKILGIQSDVETSSIWNSVTM-----------FTEEE 353

Query: 461 IAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXXXXXXXXRYRGDINIL 520
             +   ++  P +YE+L  SIAPSI+  +DIKK I+  L            R RGDIN+L
Sbjct: 354 EEEFLQLSRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMRLRGDINVL 413

Query: 521 LCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDADTKQSVLESGALVLSD 580
           L GDP T+KSQ+L++V K++P  VYTSGKGSSA GLTA + RD  T++  LE GA+VL+D
Sbjct: 414 LLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLAD 473

Query: 581 GGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTSILASANPIGSRYNTN 640
           GGV CIDEFDKM D  R  +HE M+QQ IS+AKAGI T LN+RTS+LA+ANPI  RY+  
Sbjct: 474 GGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDL 533

Query: 641 LPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLEDKPAHVSESD----I 696
               +NID    +LSRFD++++V D  +E  D  +A H+ +++  +  A  ++ +     
Sbjct: 534 KSPGDNIDFQTTILSRFDMIFIVKDDHNEERDISIANHVINIHTGNANAMQNQQEENGSE 593

Query: 697 LPVHFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRS---MGDDSRADEKRITATTRQL 753
           + +  +  YI Y +    P ++  A  +L   +V +R    + +    +   I  T RQL
Sbjct: 594 ISIEKMKRYITYCRLKCAPRLSPQAAEKLSSNFVTIRKQLLINELESTERSSIPITIRQL 653

Query: 754 ESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAIKDYAIDPKTGKIDMNLIQTGKSVIQ 813
           E++IR++E+ AK+ LS   +   V EA+RL +++  D A     G ++     +G S+ +
Sbjct: 654 EAIIRITESLAKLELSPIAQERHVDEAIRLFQASTMDAASQDPIGGLNQ---ASGTSLSE 710

Query: 814 -RKLQEDLAREI 824
            R+ +++L R +
Sbjct: 711 IRRFEQELKRRL 722

>YBR202W (CDC47) [385] chr2 (625729..628266) Member of MCM/P1 family
           of proteins involved in DNA synthesis initiation [2538
           bp, 845 aa]
          Length = 845

 Score =  316 bits (809), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 208/559 (37%), Positives = 315/559 (56%), Gaps = 42/559 (7%)

Query: 271 MRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEIDRGIIQEPLRCPR 330
           +R++  + + +L++++G++ R + V P +++  + C  C +    E++         C  
Sbjct: 227 VRQIKGDFLGQLITVRGIITRVSDVKPAVEVIAYTCDQCGYEVFQEVNSRTFTPLSECTS 286

Query: 331 VAC--NQRNSMSLIHNRCS-FADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAG 387
             C  NQ      +  R S F+  Q  K+QE    VP G  P S+++ +   LV S   G
Sbjct: 287 EECSQNQTKGQLFMSTRASKFSAFQECKIQELSQQVPVGHIPRSLNIHVNGTLVRSLSPG 346

Query: 388 DRIEVTGIFRSIPIRANQRQRALKS--LYKTYLDVVHVRKVSARRLDID-TSTVEQQILQ 444
           D ++VTGIF   P       +ALK+  L +TYL+   VR+   +      TS VE+++++
Sbjct: 347 DIVDVTGIFLPAPYTGF---KALKAGLLTETYLEAQFVRQHKKKFASFSLTSDVEERVME 403

Query: 445 NQMDNVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXX 504
                                 +    DVY  LA+SIAP IY   D+KK +LL L     
Sbjct: 404 ----------------------LITSGDVYNRLAKSIAPEIYGNLDVKKALLLLLVGGVD 441

Query: 505 XXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDA 564
                  + RGDIN+ L GDP  +KSQ+L+ + KI+PRGVYT+GKGSS VGLTA + +D 
Sbjct: 442 KRVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRGVYTTGKGSSGVGLTAAVMKDP 501

Query: 565 DTKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNART 624
            T + +LE GALVL+D G+CCIDEFDKM +S R+ +HEVM+QQ IS++KA I T   ART
Sbjct: 502 VTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAVINTNPGART 561

Query: 625 SILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYL 684
           SILA+ANP+  R N  L   +NI+LP  LLSRFD+++L+LD  S   D +LA+H+T +++
Sbjct: 562 SILAAANPLYGRINPRLSPLDNINLPAALLSRFDILFLMLDIPSRDDDEKLAEHVTYVHM 621

Query: 685 EDKPAHVSESDILPVHFLTM--YINYAKQHIHPVITEGAKTELVRAYVNMRSMGDDSRAD 742
            +K   +   D  PV    M  YI YAK    PV++E     +V+AY+ +R   D  R  
Sbjct: 622 HNKQPDL---DFTPVEPSKMREYIAYAKTK-RPVMSEAVNDYVVQAYIRLRQ--DSKREM 675

Query: 743 EKRIT---ATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAIKDYAIDPKTGK 799
           + + +   AT R L  +IRLS+A AK+RL+  V++ DV+EA+RL++ + +    +    K
Sbjct: 676 DSKFSFGQATPRTLLGIIRLSQALAKLRLADMVDIDDVEEALRLVRVSKESLYQETNKSK 735

Query: 800 IDMNLIQTGKSVIQRKLQE 818
            D +      ++I++ LQE
Sbjct: 736 EDESPTTKIFTIIKKMLQE 754

>Sklu_2098.4 YBR202W, Contig c2098 6426-8966 reverse complement
          Length = 846

 Score =  313 bits (803), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 205/553 (37%), Positives = 308/553 (55%), Gaps = 38/553 (6%)

Query: 271 MRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEIDRGIIQEPLRCPR 330
           +RE+    + +L++++G++ R + V P + +  + C  C      E++       + C  
Sbjct: 223 VREIKGRYLGQLITVRGIITRVSDVKPAVLVNAYTCDQCGFEVFQEVNSRTFTPLIECTS 282

Query: 331 VAC--NQRNSMSLIHNRCS-FADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAG 387
             C  NQ      +  R S F+  Q  K+QE    V  G  P ++++ +   LV S   G
Sbjct: 283 EQCSQNQTKGQLFMSTRASKFSAFQECKIQELSQQVRIGHIPRTLTIHVNGSLVRSITPG 342

Query: 388 DRIEVTGIFRSIPIRANQRQRALKS--LYKTYLDVVHVRKVSARRLDID-TSTVEQQILQ 444
           D ++VTGI+   P       +ALK+  L +TYL + +VR+   +    + T  VE  +++
Sbjct: 343 DVVDVTGIYLPSPYTGF---KALKAGLLTETYLSMQYVRQHKKKFASFEITPEVESNVME 399

Query: 445 NQMDNVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXX 504
                                 +A++ DVY  LA+SIAP IY   D+KK +LL L     
Sbjct: 400 ----------------------IASQGDVYNRLAKSIAPEIYGHLDVKKALLLLLVGGVD 437

Query: 505 XXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDA 564
                  + RGDINI L GDP  +KSQ+L+ + KI+PR VYT+GKGSS VGLTA + RD 
Sbjct: 438 KKVGDGMKIRGDINICLMGDPGVAKSQLLKTICKISPRSVYTTGKGSSGVGLTAAVMRDP 497

Query: 565 DTKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNART 624
            T + VLE GALVL+D G+CCIDEFDKM +  R+ +HEVM+QQ IS++KAGI TTLNAR 
Sbjct: 498 VTDEMVLEGGALVLADNGICCIDEFDKMDEGDRTAIHEVMEQQTISISKAGINTTLNARA 557

Query: 625 SILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYL 684
           SILA+ANP+  RYN  L   +NI+LP  LLSRFD+++L+LD  +   D +LA+H+  +++
Sbjct: 558 SILAAANPLYGRYNPRLSPLDNINLPAALLSRFDVMFLMLDTPNREDDEKLAEHVAYVHM 617

Query: 685 EDKPAHVSESDILPVHFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRSMGDDSRADEK 744
            +K   +  + I P   +  +I +AK    P + +     LV++Y+ MR   D  R  + 
Sbjct: 618 HNKHPTLDFTPIEPSR-MREFIAFAKTK-RPTMGQEVNEYLVQSYIRMRQ--DSKREMDS 673

Query: 745 RIT---ATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAIKDYAIDPKTGKID 801
           + +   AT R L  +IRLS+A AK+R S  VE  DV+EA+RLI+ + +    D    K D
Sbjct: 674 KFSFGQATPRTLLGVIRLSQALAKLRFSDSVEADDVEEALRLIQVSKESLYQDGNKRKND 733

Query: 802 MNLIQTGKSVIQR 814
            N      ++I++
Sbjct: 734 ENPTTKIYTIIKK 746

>Sklu_1863.1 YEL032W, Contig c1863 2885-5749
          Length = 954

 Score =  315 bits (806), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 207/590 (35%), Positives = 312/590 (52%), Gaps = 98/590 (16%)

Query: 272 RELNPNDIDKLVSIKGLVLRSTPVIPDM--------KLAFFKCSVCDHTTAVEIDRGIIQ 323
           R LN + ++KL+SI+G+V +++ V P +        K   F     D+  A       I 
Sbjct: 143 RTLNSHHLNKLISIEGIVTKTSLVRPKLIRSVHYADKTGRFHYR--DYRDATTTLTTQIP 200

Query: 324 EPLRCPRVACNQRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDS 383
            P   P     + N ++  +   ++ D Q I +QE P+  P GQ P S+ + + ++LVD 
Sbjct: 201 TPAIYP-TEDPEGNKLTTEYGYSTYIDHQRITVQEMPEKAPPGQLPRSIDVILDEDLVDK 259

Query: 384 CRAGDRIEVTGIFRSIPI-----RANQRQRALKSLYKTYLDVVHVRKVSARRLDIDTSTV 438
            + GDRI + G+++S+        A + Q    S ++T +    V  + AR   +     
Sbjct: 260 TKPGDRINIVGVYKSMGAGGLNGAATKEQSNALSGFRTLILGNTVYPLHARSTGVSAK-- 317

Query: 439 EQQILQNQMDNVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQ 498
                QN          ++D DI  IN ++ + D++E++++S+APSIY  + IKK ILL 
Sbjct: 318 -----QN----------LSDSDIRNINKLSKKSDIFEMMSQSLAPSIYGHEQIKKAILLM 362

Query: 499 LXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTA 558
           L              RGDIN+L+ GDPST+KSQ+L++V   A   + T+G+GSS VGLTA
Sbjct: 363 LLGGVEKNLENGSHLRGDINLLMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTA 422

Query: 559 YITRDADTKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIIT 618
            +T D +T +  LE+GA+VL+D G+ CIDEFDKMSD  R  +HEVM+QQ +++AKAGI T
Sbjct: 423 AVTMDKETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGIHT 482

Query: 619 TLNARTSILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKH 678
           TLNAR S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D ++E  DR +++H
Sbjct: 483 TLNARCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRAISEH 542

Query: 679 -------LTSLYLEDKPA------------------------------------------ 689
                  L   YLE +P                                           
Sbjct: 543 VLRTHRYLPPGYLEGEPIREAINLSLAVGDDDIEQMQDDEDDDEEGGKVFEKFNPLLHAG 602

Query: 690 ----------HVSE-SDILPVHFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRSMGDD 738
                     H SE   I+ + FL  Y+ YAK+ I PV+T+ A   +V+ Y ++R   +D
Sbjct: 603 AKLAKNRGNHHGSEIPQIVCIPFLRKYVQYAKERIAPVLTQEAIDVIVKTYSDLR---ND 659

Query: 739 SRADEKRITATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAI 788
           S   +  ITA  R LE++IRLS AHAKVRLS+ VE  D + A  L++ A+
Sbjct: 660 SNTKKSPITA--RTLETLIRLSSAHAKVRLSKIVERQDSRVAANLLRFAL 707

>KLLA0E22330g 1981275..1984070 similar to sp|P24279 Saccharomyces
           cerevisiae YEL032w MCM3 replication initiation protein,
           start by similarity
          Length = 931

 Score =  308 bits (788), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 228/718 (31%), Positives = 357/718 (49%), Gaps = 105/718 (14%)

Query: 148 FKNFLMTFKYKYRKIKDEQELFIN----ETTDEELYYVNQL------HQMRQLGTCNLNL 197
           F+ FL T  +  R+I+   E   N    + TD++  Y+N        H   QL    + +
Sbjct: 20  FQEFLDTHSHYTREIRSILEFNSNVVKEKKTDDD--YLNTADKDTMDHDTNQL-PLRITV 76

Query: 198 DVRNLISFPGTEKLYHQLLNYPQEVISIMDQAVKDCMVQLAVDIDGAEGNENLIEVESKI 257
            + +L  F  T   +  LL  P   +   ++AV +  + L     G  G +N    + ++
Sbjct: 77  SLDDLREFDKT--FWTGLLQVPSFFLPPAERAVSETAMALDDSPLGFRGFQNDPSRQWRL 134

Query: 258 YKIRPYNLDSERGMRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEI 317
                +  +S    R LN   ++KL+S++G+V R++ V P +  +        H    + 
Sbjct: 135 SFKGSFGPNS-LSPRTLNSTHLNKLISVEGIVTRTSLVRPKLLRSVHYAQTTGHHHYRDY 193

Query: 318 DRGIIQEPLRCPRVAC-----NQRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHSV 372
                      P  A       + N +   +  C + D Q I +QE P+  P GQ P S+
Sbjct: 194 RDATTTLTTSVPTPAIYPEEDQEGNKLVTEYGFCHYMDHQRITVQEMPEKAPPGQLPRSI 253

Query: 373 SLCIYDELVDSCRAGDRIEVTGIFRSIPIRA-------NQRQRALKSLYKTYLDVVHVRK 425
            + + D+LVD  + GDRI + G+++S+           N +     S ++T +    V  
Sbjct: 254 DVILDDDLVDKTKPGDRINIVGVYKSLGAGGLTGGSNNNDKGNGALSGFRTVVIGNTVYP 313

Query: 426 VSARRLDIDTSTVEQQILQNQMDNVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSI 485
           + AR   +  S VE                ++D DI  IN ++   ++++ L++S+APSI
Sbjct: 314 LHARSTGV--SAVE---------------TLSDNDIRNINKLSMHDNIFDTLSQSLAPSI 356

Query: 486 YELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVY 545
           Y  + IKK ILL L              RGDINIL+ GDPST+KSQ+L++V   A   + 
Sbjct: 357 YGHEHIKKAILLMLMGGVEKNLPNGSHLRGDINILMVGDPSTAKSQMLRFVLNTAALAIA 416

Query: 546 TSGKGSSAVGLTAYITRDADTKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMK 605
           T+G+GSS VGLTA +T D +T +  LE+GA+VL+D G+ CIDEFDKMSD  R  +HEVM+
Sbjct: 417 TTGRGSSGVGLTAAVTTDKETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVAIHEVME 476

Query: 606 QQPISVAKAGIITTLNARTSILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLD 665
           QQ +++AKAGI TTLNAR S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D
Sbjct: 477 QQTVTIAKAGIHTTLNARCSVIAAANPVFGQYDVNKDPHKNIALPDSLLSRFDLLFVVTD 536

Query: 666 KVSESTDRELAKH-------LTSLYLEDKPA----------------------------- 689
            +++  DR +++H       L   YLE +P                              
Sbjct: 537 DINDIRDRAISEHVLRTHRYLPPGYLEGEPVREQINLSLAVGEDIENEEEDDDEDVVFEK 596

Query: 690 -----HVSES--------------DILPVHFLTMYINYAKQHIHPVITEGAKTELVRAYV 730
                H                   I+ + F+  YI YAK+ I P +T+ A   ++++Y 
Sbjct: 597 FNPLLHAGAKLAKNRGDSNGSELPQIVAIPFIRKYIQYAKERIIPQLTQEAVDVIIKSYS 656

Query: 731 NMRSMGDDSRADEKRITATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAI 788
           N+R   +D    +  ITA  R LE++IRLS AHAKVRLS++VE+ D + A +L++ A+
Sbjct: 657 NLR---NDQNTKKSPITA--RTLETLIRLSSAHAKVRLSKKVELEDAKVATQLLRFAL 709

>KLLA0F12584g complement(1165710..1168343) similar to sp|P29469
           Saccharomyces cerevisiae YBL023c MCM2 member of the
           MCM2P, MCM3P, CDC46P family, start by similarity
          Length = 877

 Score =  306 bits (783), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 212/665 (31%), Positives = 329/665 (49%), Gaps = 72/665 (10%)

Query: 160 RKIKDEQELFINETTDE--ELYYVNQLHQMRQLGTCNLNLDVRNLISFPGTEKLYHQLLN 217
           R I  E + F+ E TDE  +  Y  ++  + ++ + +L ++ R+L+       L+  L  
Sbjct: 215 RTIARELKSFLLEYTDESGKSVYGARIRTLGEMNSESLEVNYRHLVESKAILALF--LAK 272

Query: 218 YPQEVISIMDQAVKDCMVQLAVDIDGAEGNENLIEVESKIYKIRPYNLDSERGMRELNPN 277
            P+E++ I D    +   QL           +   + S+I+ +R  +  S   +R L   
Sbjct: 273 SPEEMLKIFDTVAMEA-TQLHY--------PDYTRIHSEIH-VRISDFPSILNLRALRET 322

Query: 278 DIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEIDRGIIQEPLRCPRVA-CNQR 336
            ++ LV + G+V R T V P +K   F C  C  T           E ++      C  +
Sbjct: 323 HLNSLVRVSGVVTRRTGVFPQLKYVKFNCLKCGATLGPYYQDS--NEEIKISFCTNCRSK 380

Query: 337 NSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAGDRIEVTGIF 396
               +   +  + + Q I +QE+P  VP G+ P    + +  +LVD  + G+ +EVTGI+
Sbjct: 381 GPFRINMEKTLYRNYQRITIQESPGSVPAGRLPRHREVILLWDLVDIAKPGEEVEVTGIY 440

Query: 397 RSIPIRANQRQRALKSLYKTYLDVVHVRKVSARRLDIDTSTVEQQILQNQMDNVEELRKV 456
           ++     N   +    ++ T L+   V++      D D           + D   E RK+
Sbjct: 441 KNT-YDGNLNAKNGFPVFATVLEANSVKRREGGLHDGDEHEGLDAFSWTE-DEEREFRKM 498

Query: 457 TDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXXXXXXXXRYRGD 516
           +  D   I+ + +          S+APSIY   DIK  I   L              RGD
Sbjct: 499 S-RDRGIIDKIIS----------SMAPSIYGHRDIKTAIACSLFGGVPKNINGKHSIRGD 547

Query: 517 INILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDADTKQSVLESGAL 576
           INILL GDP T+KSQIL+YV K A R V+ +G+G+SAVGLTA + +D  TK+  LE GAL
Sbjct: 548 INILLLGDPGTAKSQILKYVEKTANRAVFATGQGASAVGLTASVRKDQITKEWTLEGGAL 607

Query: 577 VLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTSILASANPIGSR 636
           VL+D GVC IDEFDKM+D  R+ +HE M+QQ IS++KAGI+TTL AR SILA+ANPIG R
Sbjct: 608 VLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSILAAANPIGGR 667

Query: 637 YNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLEDKPAHVS---- 692
           YN+ LP+++N++L  P+LSRFD++ +V D V E +D  LA  +   ++   P        
Sbjct: 668 YNSTLPLSQNVNLTEPILSRFDILCVVRDLVDEESDNRLASFVVDSHIRSHPDKDLDDFD 727

Query: 693 --------------------------------ESDILPV--HFLTMYINYAKQHIHPVIT 718
                                           E +I P+  H L  YI+YA+  ++P + 
Sbjct: 728 DGNVPTENPNGEGDEETPLSAKQRRLQNLRKREEEISPISQHMLMKYIHYARTKVYPKLH 787

Query: 719 EGAKTELVRAYVNMRSMGDDSRADEKRITATTRQLESMIRLSEAHAKVRLSQQVEVSDVQ 778
           +    ++ R Y ++R               T R LES++R++EA AK+RLS+ V   D+ 
Sbjct: 788 QMDMDKVSRVYADLRR----ESVTTGSFPITVRHLESILRIAEAFAKMRLSEFVSSWDLD 843

Query: 779 EAVRL 783
            A+++
Sbjct: 844 RAIKV 848

>Scas_710.21
          Length = 874

 Score =  302 bits (774), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 209/685 (30%), Positives = 332/685 (48%), Gaps = 96/685 (14%)

Query: 160 RKIKDEQELFINETTDE--ELYYVNQLHQMRQLGTCNLNLDVRNLISFPGTEKLYHQLLN 217
           R I  E + F+ E TDE     Y  ++  + ++   +L ++ R+L        L+  L  
Sbjct: 207 RTIARELKSFLLEYTDETGRSVYGARIRTLGEMNAESLEVNYRHLAESKAILALF--LAK 264

Query: 218 YPQEVISIMDQAVKDCMVQLAVDIDGAEGNENLIEVESKIYKIRPYNLDSERGMRELNPN 277
            P+E++ I D    +       D            + S+I+ +R  +  +   +REL  +
Sbjct: 265 CPEEMLKIFDLVAMEATELHYPD---------YARIHSEIH-VRISDFPTIHSLRELRES 314

Query: 278 DIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEIDRGIIQEPL----------- 326
           ++  LV + G+V R T V P +K   F C  C          G I  P            
Sbjct: 315 NLSSLVRVTGVVTRRTGVFPQLKYVKFNCIKC----------GTILGPFFQDSNEEIKIS 364

Query: 327 RCPRVACNQRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRA 386
            C  V C  +   ++   +  + + Q I LQE+P  VP G+ P    + +  +LVD  + 
Sbjct: 365 YC--VNCKSKGPFTVNGEKTVYRNYQRITLQESPGTVPAGRLPRHREVILLADLVDVSKP 422

Query: 387 GDRIEVTGIFRSIPIRANQRQRALKSLYKTYLDVVHVRKVSARRLDIDTSTVEQQILQNQ 446
           G+ +EVTGI+              K+ Y   L+  +   V A  L+ ++    +    N+
Sbjct: 423 GEEVEVTGIY--------------KNNYDGNLNAKNGFPVFATILEANSVKRREGNSANE 468

Query: 447 MDNVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXXX 506
            +   ++   T+E+  +   ++    + + +  S+APSIY   DIK  +   L       
Sbjct: 469 GEEGLDVFGWTEEEEREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKN 528

Query: 507 XXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDADT 566
                  RGDIN+LL GDP T+KSQIL+YV K A R V+ +G+G+SAVGLTA + +D  T
Sbjct: 529 VNGKHSIRGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPIT 588

Query: 567 KQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTSI 626
           K+  LE GALVL+D GVC IDEFDKM+D  R+ +HE M+QQ IS++KAGI+TTL AR SI
Sbjct: 589 KEWTLEGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSI 648

Query: 627 LASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLED 686
           +A+ANP G RYN+ +P+ +N+ L  P+LSRFD++ +V D V E  D  LA  +   +L  
Sbjct: 649 IAAANPNGGRYNSTIPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHLRS 708

Query: 687 KPAHV---------------------------------------SESDILPV--HFLTMY 705
            P ++                                        E +I P+    L  Y
Sbjct: 709 HPENIDGNLTGEGQPDGDENMDGNNEDGVEPLSARQRRLQSQKKKEEEISPIPQELLMKY 768

Query: 706 INYAKQHIHPVITEGAKTELVRAYVNMRSMGDDSRADEKRITATTRQLESMIRLSEAHAK 765
           I+YA+  IHP + +    ++ R Y ++R     + +       T R LES++R++E+ AK
Sbjct: 769 IHYARTKIHPKLHQMDMDKVSRVYADLRRESISTGS----FPITVRHLESILRIAESFAK 824

Query: 766 VRLSQQVEVSDVQEAVRLIKSAIKD 790
           +RLS+ V   D+  A++++  +  D
Sbjct: 825 MRLSEFVSSWDLDRAIKVVVDSFVD 849

>CAGL0J04444g 417656..420295 highly similar to sp|P29469
           Saccharomyces cerevisiae YBL023c MCM2, start by
           similarity
          Length = 879

 Score =  300 bits (767), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 203/671 (30%), Positives = 333/671 (49%), Gaps = 75/671 (11%)

Query: 160 RKIKDEQELFINETTDE--ELYYVNQLHQMRQLGTCNLNLDVRNLISFPGTEKLYHQLLN 217
           R I  E + F+ E TDE     Y  ++  + ++ + +L ++ R+L        L+  L  
Sbjct: 222 RTIARELKSFLLEYTDETGRSVYGARIRVLGEMNSESLEVNFRHLAESKAILALF--LAK 279

Query: 218 YPQEVISIMDQAVKDCMVQLAVDIDGAEGNENLIEVESKIYKIRPYNLDSERGMRELNPN 277
            P+E++ I D    +       D            + S+I+ +R  +  +   +REL  +
Sbjct: 280 CPEEMLKIFDLVAMEATELHYPDYS---------RIHSEIH-VRISDFPTIHNLRELRQS 329

Query: 278 DIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEIDRGIIQEPLRCPRVA----C 333
           ++  LV + G+V R T V P +K   F C  C             Q+     +++    C
Sbjct: 330 NLSTLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGP-----FFQDSNEEIKISFCTNC 384

Query: 334 NQRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAGDRIEVT 393
             +   S+   +  + + Q I LQE P  VP G+ P    + +  +LVD  + G+ IEVT
Sbjct: 385 KSKGPFSINGEKTVYRNYQRITLQEAPGTVPAGRLPRHREVILLADLVDVSKPGEEIEVT 444

Query: 394 GIFRSIPIRANQRQRALKSLYKTYLDVVHVRKVSARRLDIDTSTVEQQILQNQMDNVEEL 453
           GI+++     N   +    ++ T ++   VR+                 L N+ +    +
Sbjct: 445 GIYKN-NYDGNLNAKNGFPVFATIIEANAVRRREGN-------------LANENEEGLNV 490

Query: 454 RKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXXXXXXXXRY 513
              T+E+  +   ++    + + +  S+APSIY   DIK  +   L              
Sbjct: 491 FSWTEEEEREFRKLSKDRGIVDKIIASMAPSIYGHKDIKTAVACSLFSGVPKNINGKHAI 550

Query: 514 RGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDADTKQSVLES 573
           RGDIN+L+ GDP T+KSQIL+YV K A R V+ +G+G+SAVGLTA + +D  TK+  LE 
Sbjct: 551 RGDINVLVLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEG 610

Query: 574 GALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTSILASANPI 633
           GALVL+D GVC IDEFDKM+D  R+ +HE M+QQ IS++KAGI+TTL AR SI+A+ANP 
Sbjct: 611 GALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPN 670

Query: 634 GSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLEDKPAHVS- 692
           G RYN+ LP+++N+ L  P+LSRFD++ +V D V E +D  LA  +   ++   P + S 
Sbjct: 671 GGRYNSTLPLSQNVSLTEPILSRFDILCVVRDVVDEESDERLASFVVDSHVRSHPGYDSI 730

Query: 693 -------------------------------ESDILPV--HFLTMYINYAKQHIHPVITE 719
                                          E +I P+    L  YI+YA+  ++P + +
Sbjct: 731 DDEEGKDGEQKNDDDIQLSNRQKRAERQRKKEEEISPIPQELLIKYIHYARTKVYPRLHQ 790

Query: 720 GAKTELVRAYVNMRSMGDDSRADEKRITATTRQLESMIRLSEAHAKVRLSQQVEVSDVQE 779
               ++ + Y ++R     + +       T R LES++R++E+ AK+RLS+ V   D+  
Sbjct: 791 MDMDKVSKVYADLRRESITTGS----FPITVRHLESILRIAESFAKMRLSEFVSSWDLDR 846

Query: 780 AVRLIKSAIKD 790
           A++++  +  D
Sbjct: 847 AIKVVVDSFVD 857

>AFR178W [3370] [Homologous to ScYBL023C (MCM2) - SH]
           complement(763632..766289) [2658 bp, 885 aa]
          Length = 885

 Score =  298 bits (763), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 211/676 (31%), Positives = 333/676 (49%), Gaps = 96/676 (14%)

Query: 160 RKIKDEQELFINETTDE--ELYYVNQLHQMRQLGTCNLNLDVRNLISFPGTEKLYHQLLN 217
           R I  E + F+ E TDE  +  Y  ++  + +L + +L ++ R+L        L+  L  
Sbjct: 224 RTIARELKSFLLEYTDEYGKSVYGARIRTLGELNSESLEVNYRHLAESKAILALF--LAR 281

Query: 218 YPQEVISIMDQAVKDCMVQLAVDIDGAEGNENLIEVESKIYKIRPYNLDSERGMRELNPN 277
            P+E++ I D    +   QL               + S+I+ +R  +  +   +REL   
Sbjct: 282 CPEEMLKIFDTVAMEA-TQLHY--------PEYTRIHSEIH-VRISDFPTIHNLRELREA 331

Query: 278 DIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVC---------DHTTAVEIDRGIIQEPLRC 328
           +++ LV + G+V R T V P +K   F C  C         D    ++I          C
Sbjct: 332 NLNSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPYYQDSNEEIKISF--------C 383

Query: 329 PRVACNQRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAGD 388
               C  +        +  + + Q + LQE+P  VP G+ P    + +  +LVD  + G+
Sbjct: 384 --TNCRSKGPFRTNMEKTLYRNYQRLTLQESPGTVPAGRLPRHREVILLWDLVDVAKPGE 441

Query: 389 RIEVTGIFRSIPIRANQRQRALKSLYKTYLDVVHVRKVSARRLDIDTSTVEQQILQNQMD 448
            +EVTGI+              K+ Y   L+  +   V A  L+ ++    +  L +  D
Sbjct: 442 EVEVTGIY--------------KNTYDGNLNARNGFPVFATVLEANSIKRREGGLHSGDD 487

Query: 449 NVEELRKV---TDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXX 505
             +E   V   T+E+  +   ++    + + +  SIAPSIY   DIK  +   L      
Sbjct: 488 AGDEGLDVFGWTEEEEREFRKMSRDRGIIDKIISSIAPSIYGHRDIKTAVACSLFGGVPK 547

Query: 506 XXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDAD 565
                   RGDIN+LL GDP T+KSQIL+YV K A R V+ +G+G+SAVGLTA + +D  
Sbjct: 548 NVNGKHSIRGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPI 607

Query: 566 TKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTS 625
           TK+  LE GALVL+D GVC IDEFDKM+D  R+ +HE M+QQ IS++KAGI+TTL AR S
Sbjct: 608 TKEWTLEGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCS 667

Query: 626 ILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLE 685
           I+A+ANP G RYN+ LP+++N+DL  P+LSRFD++ +V D V E +D  LA  +   ++ 
Sbjct: 668 IIAAANPNGGRYNSTLPLSQNVDLTEPILSRFDILCVVRDLVDEESDERLATFVVDSHIR 727

Query: 686 DKPAHVSESDI--------------------------------------LPVHFLTMYIN 707
             P    ESDI                                      +P   L  YI+
Sbjct: 728 SHP----ESDIHQEPADEDMEEADAGTAALSNRQKKLKRHRDKEGEISPIPQEVLMKYIH 783

Query: 708 YAKQHIHPVITEGAKTELVRAYVNMRSMGDDSRADEKRITATTRQLESMIRLSEAHAKVR 767
           YA+  ++P + +    ++ + Y ++R     + +       T R LES++R++E+ AK+R
Sbjct: 784 YARTKVNPKLHQMDMGKVSKVYADLRRESITTGS----FPITVRHLESILRIAESFAKMR 839

Query: 768 LSQQVEVSDVQEAVRL 783
           LS+ V   D+  A+++
Sbjct: 840 LSEFVSSWDLDRAIKV 855

>Kwal_14.2090
          Length = 860

 Score =  294 bits (753), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 214/672 (31%), Positives = 329/672 (48%), Gaps = 87/672 (12%)

Query: 160 RKIKDEQELFINETTDE--ELYYVNQLHQMRQLGTCNLNLDVRNLISFPGTEKLYHQLLN 217
           R I  E + F+ E TDE     Y  ++  + +L + +L ++ R+L        L+  L  
Sbjct: 195 RTIARELKSFLLEYTDEWGRSVYGARIRTLGELNSESLEVNYRHLAESKAILALF--LAK 252

Query: 218 YPQEVISIMDQAVKDCMVQLAVDIDGAEGNENLIEVESKIYKIRPYNLDSERGMRELNPN 277
            P+E++ I D    D   QL           +   + ++I+ +R  +  +   +REL  +
Sbjct: 253 CPEEMLKIFDIVAMDA-TQLHY--------PDYARIHAEIH-VRISDFPTVLNLRELRES 302

Query: 278 DIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEIDRGIIQEPLRCPRVA-CNQR 336
           +++ LV + G+V R T V P +K   F C  C              E ++      C  +
Sbjct: 303 NLNSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGAVLGPYFQDS--NEEIKISFCTNCRSK 360

Query: 337 NSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAGDRIEVTGIF 396
                   +  + + Q + LQE P  VP G+ P    + +  +LVD  + G+ IEVTGI+
Sbjct: 361 GPFRTNAEKTLYRNYQRLTLQEAPGTVPAGRLPRHREVILLWDLVDIAKPGEEIEVTGIY 420

Query: 397 RSIPIRANQRQRALKSLYKTYLDVVHVRKVSARR--------LDIDTSTVEQQILQNQMD 448
           ++     N   R    ++ T ++   VR+    R        LD+   T E++       
Sbjct: 421 KNT-YDGNLNARNGFPVFATIIEANAVRRREGGRRSGDDEEGLDVFGWTEEEE------- 472

Query: 449 NVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXXXXX 508
              E RK++  D   I+ V +          SIAPSIY   DIK  +   L         
Sbjct: 473 --REFRKLS-RDRGIIDKVIS----------SIAPSIYGHKDIKTAVACALFSGVPKNVN 519

Query: 509 XXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDADTKQ 568
                RGDIN+LL GDP T+KSQIL+YV K A R V+ +G+G+SAVGLTA + +D  T++
Sbjct: 520 GKHSIRGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITRE 579

Query: 569 SVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTSILA 628
             LE GALVL+D GVC IDEFDKM+D  R+ +HE M+QQ IS++KAGI+T+L AR SI+A
Sbjct: 580 WTLEGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQNISISKAGIVTSLQARCSIIA 639

Query: 629 SANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLEDKP 688
           +ANP G RYN+ LP+ +N+DL  P+LSRFD++ +V D V E  D  LA+ +   +L   P
Sbjct: 640 AANPNGGRYNSALPLAQNVDLTEPILSRFDILCVVRDLVDEVKDERLARFVVDSHLRSHP 699

Query: 689 AH-----------------------------------VSESDILPV--HFLTMYINYAKQ 711
            H                                     E +I P+    L  YI YA+ 
Sbjct: 700 LHDRLDDGDDDDGDNDAMNEDANEPLSARQRRQQKDREREEEISPIPQETLMKYIQYART 759

Query: 712 HIHPVITEGAKTELVRAYVNMRSMGDDSRADEKRITATTRQLESMIRLSEAHAKVRLSQQ 771
            + P + +    ++ R Y ++R     + +       T R LES++R+SE+ AK+RLS+ 
Sbjct: 760 RVFPKLHQMDMDKVSRVYADLRRESITTGS----FPITVRHLESILRISESFAKMRLSEF 815

Query: 772 VEVSDVQEAVRL 783
           V   D+  A+++
Sbjct: 816 VSSWDLDRAIKV 827

>YBL023C (MCM2) [172] chr2 complement(174885..177491) Member of the
           MCM/P1 family that acts as a complex at ARS sequences to
           initiate DNA replication [2607 bp, 868 aa]
          Length = 868

 Score =  294 bits (753), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 203/678 (29%), Positives = 330/678 (48%), Gaps = 82/678 (12%)

Query: 160 RKIKDEQELFINETTDE--ELYYVNQLHQMRQLGTCNLNLDVRNLISFPGTEKLYHQLLN 217
           R I  E + F+ E TDE     Y  ++  + ++ + +L ++ R+L        L+  L  
Sbjct: 205 RTIARELKSFLLEYTDETGRSVYGARIRTLGEMNSESLEVNYRHLAESKAILALF--LAK 262

Query: 218 YPQEVISIMDQAVKDCMVQLAVDIDGAEGNENLIEVESKIYKIRPYNLDSERGMRELNPN 277
            P+E++ I D    +       D            + S+I+ +R  +  +   +REL  +
Sbjct: 263 CPEEMLKIFDLVAMEATELHYPD---------YARIHSEIH-VRISDFPTIYSLRELRES 312

Query: 278 DIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEIDRGIIQEPLRCPRVA----C 333
           ++  LV + G+V R T V P +K   F C  C             Q+     R++    C
Sbjct: 313 NLSSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILG-----PFFQDSNEEIRISFCTNC 367

Query: 334 NQRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAGDRIEVT 393
             +    +   +  + + Q + LQE P  VP G+ P    + +  +LVD  + G+ +EVT
Sbjct: 368 KSKGPFRVNGEKTVYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKPGEEVEVT 427

Query: 394 GIFRSIPIRANQRQRALKSLYKTYLDVVHVRKVSARRLDIDTSTVEQQILQNQMDNVEEL 453
           GI+              K+ Y   L+  +   V A  ++ ++    +    N+ +   ++
Sbjct: 428 GIY--------------KNNYDGNLNAKNGFPVFATIIEANSIKRREGNTANEGEEGLDV 473

Query: 454 RKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXXXXXXXXRY 513
              T+E+  +   ++    + + +  S+APSIY   DIK  +   L              
Sbjct: 474 FSWTEEEEREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSI 533

Query: 514 RGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDADTKQSVLES 573
           RGDIN+LL GDP T+KSQIL+YV K A R V+ +G+G+SAVGLTA + +D  TK+  LE 
Sbjct: 534 RGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEG 593

Query: 574 GALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTSILASANPI 633
           GALVL+D GVC IDEFDKM+D  R+ +HE M+QQ IS++KAGI+TTL AR SI+A+ANP 
Sbjct: 594 GALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPN 653

Query: 634 GSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLEDKPAH--- 690
           G RYN+ LP+ +N+ L  P+LSRFD++ +V D V E  D  LA  +   ++   P +   
Sbjct: 654 GGRYNSTLPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDED 713

Query: 691 ------------------------------------VSESDILPV--HFLTMYINYAKQH 712
                                                 E +I P+    L  YI+YA+  
Sbjct: 714 REGEELKNNGESAIEQGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTK 773

Query: 713 IHPVITEGAKTELVRAYVNMRSMGDDSRADEKRITATTRQLESMIRLSEAHAKVRLSQQV 772
           I+P + +    ++ R Y ++R     + +       T R LES++R++E+ AK+RLS+ V
Sbjct: 774 IYPKLHQMDMDKVSRVYADLRRESISTGS----FPITVRHLESILRIAESFAKMRLSEFV 829

Query: 773 EVSDVQEAVRLIKSAIKD 790
              D+  A++++  +  D
Sbjct: 830 SSYDLDRAIKVVVDSFVD 847

>Sklu_2087.4 YBL023C, Contig c2087 7202-9856
          Length = 884

 Score =  291 bits (745), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 206/691 (29%), Positives = 345/691 (49%), Gaps = 78/691 (11%)

Query: 140 SIQEVACTFKNFLMTFKYKYRKIKDEQELFINETTDE--ELYYVNQLHQMRQLGTCNLNL 197
           S+ ++  T  +  +T     R I  E + F+ E TDE  +  Y  ++  + ++ + +L +
Sbjct: 193 SLGDIKATSYSEWITQPNVSRTIARELKSFLLEYTDESGKSVYGARIRTLGEVNSESLEV 252

Query: 198 DVRNLISFPGTEKLYHQLLNYPQEVISIMDQAVKDCMVQLAVDIDGAEGNENLIEVESKI 257
           + R+L        L+  L   P+E++ I D    +       D            + S+I
Sbjct: 253 NYRHLAESKAILALF--LAKCPEEMLKIFDLVAMEATELHYPDYS---------RIHSEI 301

Query: 258 YKIRPYNLDSERGMRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEI 317
           + +R  +  +   +REL  ++++ LV + G+V R T V P +K   F C  C        
Sbjct: 302 H-VRISDFPTVHNLRELRESNLNSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGP-- 358

Query: 318 DRGIIQEPLRCPRVA----CNQRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVS 373
                Q+     +++    C  +        +  + + Q I LQE P  VP G+ P    
Sbjct: 359 ---FFQDSNEEVKISFCTNCRSKGPFRTNAEKTLYRNYQRITLQEAPGTVPAGRLPRHRE 415

Query: 374 LCIYDELVDSCRAGDRIEVTGIFRSIPIRANQRQRALKSLYKTYLDVVHVRKVSARRLDI 433
           + +  +LVD  + G+ +EVTG++++     N   +    ++ T ++   +++    R  I
Sbjct: 416 VILLWDLVDVAKPGEEVEVTGVYKNT-YDGNLNAKNGFPVFATVIEANSIKRREGGR--I 472

Query: 434 DTSTVEQQILQNQMDNVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKK 493
              ++E +      + ++      +E+         R  + ++++ S+APSIY   DIK 
Sbjct: 473 SNESIEDE------EGLDPFSWTEEEEREFRRMSRDRAIIDKIIS-SMAPSIYGHKDIKT 525

Query: 494 GILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSA 553
            +   L              RGDIN+LL GDP T+KSQIL+Y+ K A R V+ +G+G+SA
Sbjct: 526 AVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTAKSQILKYIEKTAHRAVFATGQGASA 585

Query: 554 VGLTAYITRDADTKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAK 613
           VGLTA + +D  T++  LE GALVL+D GVC IDEFDKM+D  R+ +HE M+QQ IS++K
Sbjct: 586 VGLTASVRKDPITREWTLEGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISK 645

Query: 614 AGIITTLNARTSILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDR 673
           AGI+TTL AR SI+A+ANP G RYN+ LP+ +N+DL  P+LSRFD++ +V D V E  D 
Sbjct: 646 AGIVTTLQARCSIIAAANPNGGRYNSTLPLAQNVDLTEPILSRFDILCVVRDLVDEEADE 705

Query: 674 ELAKHLTSLYL---------------------------EDKPAHVS------------ES 694
            LA  + S ++                           +D+PA +S            E 
Sbjct: 706 RLATFVVSSHVRSHPDSDRLREDPQDDDLDQQTEDEREDDEPAPMSARQKRLQRQREKEG 765

Query: 695 DILPV--HFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRSMGDDSRADEKRITATTRQ 752
           +I P+    L  YI+YA+  I+P + +    ++ R Y ++R     + +       T R 
Sbjct: 766 EISPIPQDTLMKYIHYARIKIYPKLHQMDMDKVSRVYADLRRESITTGS----FPITVRH 821

Query: 753 LESMIRLSEAHAKVRLSQQVEVSDVQEAVRL 783
           LES++R++E+ AK+RLS+ V   D+  A+++
Sbjct: 822 LESILRIAESFAKMRLSEFVSSWDLDRAIKV 852

>Kwal_27.10174
          Length = 945

 Score =  291 bits (746), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 215/663 (32%), Positives = 331/663 (49%), Gaps = 125/663 (18%)

Query: 211 LYHQLLNYPQEVISIMDQAVKDCMVQLAVDIDGAEGNENLIEVESKIYKIRPYNLDSERG 270
            +  +LN P + +   ++A+ D  + L     G     N +   S+ +K+      S RG
Sbjct: 79  FWTGILNMPAQYVPAAERALGDTAMTLEETRSG-----NTVSPGSQSWKL------SFRG 127

Query: 271 M--------RELNPNDIDKLVSIKGLVLRSTPVIPDMKLA---------FFKCSVCDHTT 313
                    R LN + ++KL+SI+G+V + + V P +  +         F      D TT
Sbjct: 128 SFGAHALSPRTLNSHYLNKLLSIEGIVTKVSLVRPKLLRSVHYAEKTGRFHYRDYRDATT 187

Query: 314 AVEIDRGIIQEPLRCPRVACNQ---RNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPH 370
            +     I Q P   P +   +    N ++  +   ++ D Q I +QE P+  P GQ P 
Sbjct: 188 TL-----ITQIP--TPAIYPTEDPEGNKLTTEYGYSTYIDHQRITVQEMPEKAPPGQLPR 240

Query: 371 SVSLCIYDELVDSCRAGDRIEVTGIFRSIPIRANQR------QRALKSLYKTYLDVVHVR 424
           S+ + + ++LVD  + GDRI + GI++S+             Q +  S ++T +      
Sbjct: 241 SIDVIMDEDLVDKTKPGDRINIVGIYKSLGGGGLSSSGSSNDQGSSLSGFRTMVLANTAY 300

Query: 425 KVSARRLDIDTSTVEQQILQNQMDNVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPS 484
            + AR     T    +Q L             TD DI  IN ++ + D++++L++S+APS
Sbjct: 301 PLHAR----STGVAARQAL-------------TDSDIRNINKLSKKDDIFDLLSQSLAPS 343

Query: 485 IYELDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGV 544
           IY  D IKK ILL L              RGDIN+L+ GDPST+KSQ+L++V   A   +
Sbjct: 344 IYGHDHIKKAILLMLMGGVEKNLENGSHLRGDINLLMVGDPSTAKSQLLRFVLNTASLAI 403

Query: 545 YTSGKGSSAVGLTAYITRDADTKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVM 604
            T+G+GSS VGLTA +T D +T +  LE+GA+VL+D G+ CIDEFDKMSD  R  +HEVM
Sbjct: 404 ATTGRGSSGVGLTAAVTMDKETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVAIHEVM 463

Query: 605 KQQPISVAKAGIITTLNARTSILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVL 664
           +QQ +++AKAGI TTLNAR S++A+ANP+  +Y+ N     NI LP  LLSRFDL+++V 
Sbjct: 464 EQQTVTIAKAGIHTTLNARCSVIAAANPVFGQYDLNKDPHYNIALPDSLLSRFDLLFVVT 523

Query: 665 DKVSESTDRELAKH-------LTSLYLEDKPAHVSESDILPVHFLTMYINYAK------- 710
           D ++E+TDR +++H       L   YLE +P   + +  L V     + N  +       
Sbjct: 524 DDINENTDRAISEHVLRTHRYLPPGYLEGEPIGEAINLSLSVGDDNGFANEEEDDDDDEG 583

Query: 711 ---QHIHPVITEGAK----------TEL-------------------------------- 725
              +  +P++  GAK          TEL                                
Sbjct: 584 KVFEKFNPLLHAGAKLARNKGNRQGTELPQIVSIPFLRKYVQYAKERVVPMLSQEAVNIV 643

Query: 726 VRAYVNMRSMGDDSRADEKRITATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIK 785
           VR Y  +R     +  + K+   T R LE++IRL+ AHAKVRLS+ V+  D + A  L++
Sbjct: 644 VRTYTELR-----NDQNTKKSPITPRTLETLIRLASAHAKVRLSKTVDREDARVAAHLLR 698

Query: 786 SAI 788
            A+
Sbjct: 699 FAL 701

>YEL032W (MCM3) [1393] chr5 (86937..89852) Member of the MCM/P1
           family, part of the MCM complex that assembles at ARS
           elements to initiate replication [2916 bp, 971 aa]
          Length = 971

 Score =  286 bits (732), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 202/588 (34%), Positives = 303/588 (51%), Gaps = 90/588 (15%)

Query: 272 RELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEIDRGIIQEPLRCPRV 331
           R L    ++KLVS++G+V +++ V P +  +    +        +          R P  
Sbjct: 169 RTLTAQHLNKLVSVEGIVTKTSLVRPKLIRSVHYAAKTGRFHYRDYTDATTTLTTRIPTP 228

Query: 332 AC-----NQRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRA 386
           A       + N ++  +   +F D Q I +QE P++ P GQ P S+ + + D+LVD  + 
Sbjct: 229 AIYPTEDTEGNKLTTEYGYSTFIDHQRITVQEMPEMAPAGQLPRSIDVILDDDLVDKTKP 288

Query: 387 GDRIEVTGIFRSIPIRA-NQRQRALKSLYKTYLDVVHVRKVSARRLDIDTSTVEQQILQN 445
           GDR+ V G+F+S+     NQ        +KT +    V  + AR     T    +Q+L  
Sbjct: 289 GDRVNVVGVFKSLGAGGMNQSNSNTLIGFKTLILGNTVYPLHAR----STGVAARQML-- 342

Query: 446 QMDNVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXXXX 505
                      TD DI  IN ++ + D++++L++S+APSIY  D IKK ILL L      
Sbjct: 343 -----------TDFDIRNINKLSKKKDIFDILSQSLAPSIYGHDHIKKAILLMLMGGVEK 391

Query: 506 XXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDAD 565
                   RGDINIL+ GDPST+KSQ+L++V   A   + T+G+GSS VGLTA +T D +
Sbjct: 392 NLENGSHLRGDINILMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAAVTTDRE 451

Query: 566 TKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTS 625
           T +  LE+GA+VL+D GV CIDEFDKM+D  R  +HEVM+QQ +++AKAGI TTLNAR S
Sbjct: 452 TGERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHTTLNARCS 511

Query: 626 ILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKH------- 678
           ++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D ++E  DR +++H       
Sbjct: 512 VIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSISEHVLRTHRY 571

Query: 679 LTSLYLEDKP---------AHVSESDILPVHFLTMYI----------NYAKQHIHPVITE 719
           L   YLE +P         A   ++DI P                  ++  +  +P++  
Sbjct: 572 LPPGYLEGEPVRERLNLSLAVGEDADINPEEHSNSGAGVENEGEDDEDHVFEKFNPLLQA 631

Query: 720 GAK----------TEL--------VRAYV---------------------NMRSMGDDSR 740
           GAK          TE+        +R YV                     N   + +D  
Sbjct: 632 GAKLAKNKGNYNGTEIPKLVTIPFLRKYVQYAKERVIPQLTQEAINVIVKNYTDLRNDDN 691

Query: 741 ADEKRITATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAI 788
             +  ITA  R LE++IRL+ AHAKVRLS+ V   D + A  L++ A+
Sbjct: 692 TKKSPITA--RTLETLIRLATAHAKVRLSKTVNKVDAKVAANLLRFAL 737

>Scas_499.2
          Length = 985

 Score =  278 bits (710), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 200/583 (34%), Positives = 299/583 (51%), Gaps = 80/583 (13%)

Query: 272 RELNPNDIDKLVSIKGLVLRSTPVIPDM--------KLAFFKCSVCDHTTAVEIDRGIIQ 323
           R LN   ++KL+SI+G+V R++ V P +        K   F     D+T A       I 
Sbjct: 177 RTLNSQFLNKLISIEGIVTRTSLVRPKLIRSVHYAEKTGRFHYR--DYTDATTTLTTKIP 234

Query: 324 EPLRCPRVACNQRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDS 383
            P   P    +  N +   +   +F D Q I +QE P++ P GQ P S+ + + D+LVD 
Sbjct: 235 TPAIYPTEDTDG-NKLITEYGYSTFVDHQRITIQEMPEMAPAGQLPRSIDVILDDDLVDK 293

Query: 384 CRAGDRIEVTGIFRSIPIRANQRQRALKSLYKTYLDVVHVRKVSARRLDIDTSTVEQQIL 443
            + GDR+ V G+F+S+                          +S  R  I  +TV    L
Sbjct: 294 TKPGDRVNVIGVFKSLGAGGLNNGGNGGGADSGA-------SMSGFRTLIIGNTVYP--L 344

Query: 444 QNQMDNVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLXXXX 503
             +   V   + +TD DI  IN ++ + D+++VLA+S+APSIY  + IK+ ILL L    
Sbjct: 345 HARSTGVSARQTLTDFDIRNINKLSKKKDIFDVLAQSLAPSIYGHEHIKRAILLMLMGGV 404

Query: 504 XXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRD 563
                     RGDINIL+ GDPST+KSQ+L++V   A   + T+G+GSS VGLTA +T D
Sbjct: 405 EKNLENGSHLRGDINILMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAAVTND 464

Query: 564 ADTKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNAR 623
            +T +  LE+GA+VL+D GV CIDEFDKM+D  R  +HEVM+QQ +++AKAGI TTLNAR
Sbjct: 465 RETGERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHTTLNAR 524

Query: 624 TSILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLY 683
            S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D ++E  DR +++H+   +
Sbjct: 525 CSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSISEHVLRTH 584

Query: 684 LEDKPAHVSESDILPVHFLTMYI-------------------NYAKQHIHPVITEGAK-- 722
               P ++    I     L++ +                   +   +  +P++  GAK  
Sbjct: 585 RYLPPGYLEGEPIRERLNLSLAVGVDDNINEENKDGGEEDEEDQVFEKFNPLLQAGAKLA 644

Query: 723 --------TEL--------VRAYV---------------------NMRSMGDDSRADEKR 745
                   TE+        +R YV                     N   + +D    +  
Sbjct: 645 KNKGNHNGTEIPKLVTIPFLRKYVQYAKERVIPQLTQQAIDVIVKNYADLRNDENTKKSP 704

Query: 746 ITATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAI 788
           ITA  R LE++IRL+ AHAKVRLS+ V   D   A  L++ A+
Sbjct: 705 ITA--RTLETLIRLATAHAKVRLSKTVNKRDANVAAGLLRYAL 745

>CAGL0L01397g 152718..155555 highly similar to sp|P24279
           Saccharomyces cerevisiae YEL032w MCM3 replication
           initiation protein, hypothetical start
          Length = 945

 Score =  274 bits (700), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 205/658 (31%), Positives = 325/658 (49%), Gaps = 116/658 (17%)

Query: 210 KLYHQLLNYPQEVISIMDQAVKDCMVQLAVDIDGAEGNENLIEVESKIYKIRPYNLD--S 267
           K +  +LN P   I   ++A+     ++A  +D +  N  +  V +K    RP+ L    
Sbjct: 102 KFWRGVLNEPAYYIPPAERALS----EIATALDDSPRN-TVDAVSAK----RPWRLSFKG 152

Query: 268 ERGMRELNPNDID-----KLVSIKGLVLRSTPVIPDMKLA---------FFKCSVCDHTT 313
             G   L+P  ++     KLVSI+G+V +++ V P +  +         F      D TT
Sbjct: 153 SFGSHTLSPGTLNAMYLNKLVSIEGIVTKTSLVRPKLMRSVHYAEKTGRFHYRDYTDSTT 212

Query: 314 AVEIDRGIIQEPLRCPRVACN-----QRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQT 368
           ++           R P  A         N ++  +   ++ D Q I +QE P++   G  
Sbjct: 213 SLTT---------RVPTPAIYPTEDPDGNKLTTEYGFSTYIDHQRITVQEMPEMAQVGPV 263

Query: 369 PHSVSLCIYDELVDSCRAGDRIEVTGIFRSIPIRA-NQRQRALKSLYKTYLDVVHVRKVS 427
           P SV + + D+LVD  + GDRI V G+F+S+     NQ +    + ++T +    V  + 
Sbjct: 264 PRSVDIILDDDLVDKTKPGDRINVVGVFKSVGAGGLNQGESNTLNGFRTLIIGNSVYPLH 323

Query: 428 ARRLDIDTSTVEQQILQNQMDNVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYE 487
           AR   +                      + D DI  IN ++ R D++E+LA+S+APSIY 
Sbjct: 324 ARSTGVSAKET-----------------LNDLDIRNINKLSKRGDIFEILAQSLAPSIYG 366

Query: 488 LDDIKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTS 547
            ++IK+ +LL L              RGDINIL+ GDPST+KSQ+L++V   A   + T+
Sbjct: 367 HENIKRAVLLMLFGGVEKNLENGSHLRGDINILMVGDPSTAKSQMLRFVLNTASLAIATT 426

Query: 548 GKGSSAVGLTAYITRDADTKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQ 607
           G+GSS VGLTA +T D +T +  LE+GA+VL+D G+ CIDEFDKM+D  R  +HEVM+QQ
Sbjct: 427 GRGSSGVGLTAAVTTDRETGERRLEAGAMVLADRGIVCIDEFDKMTDVDRVAIHEVMEQQ 486

Query: 608 PISVAKAGIITTLNARTSILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKV 667
            +++AKAGI TTLN+R S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D +
Sbjct: 487 TVTIAKAGIHTTLNSRCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDI 546

Query: 668 SESTDRELAKHLTSLYLEDKPAHVSESDILPVHFLTMYINYAK----------------- 710
           +E+ DR +++H+   +    P  V    +     L++ +   +                 
Sbjct: 547 NEARDRSISEHVLRTHRYLSPGMVEGEPVRDRLNLSLAVGTDEDDENANDNTNQDEEDQV 606

Query: 711 -QHIHPVITEGA------------------KTELVRAYV--------------------- 730
            +  +P++  GA                  K   +R YV                     
Sbjct: 607 FEKFNPLLQAGAMLAKNRGNYNGTEIPKLVKISFLRKYVQYAKERVVPQLTTEAVDVIVK 666

Query: 731 NMRSMGDDSRADEKRITATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAI 788
           N   + +D    +  ITA  R LE++IRL+ AHAKVRLS+ V+  D   A  L++ ++
Sbjct: 667 NYTDLRNDENTKKSPITA--RTLETLIRLATAHAKVRLSRTVDKVDATVAANLLRFSL 722

>AFR355C [3547] [Homologous to ScYEL032W (MCM3) - SH]
           (1082128..1084959) [2832 bp, 943 aa]
          Length = 943

 Score =  270 bits (689), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 198/589 (33%), Positives = 301/589 (51%), Gaps = 97/589 (16%)

Query: 272 RELNPNDIDKLVSIKGLVLRSTPVIPDM---------KLAFFKCSVCDHTTAVEIDRGII 322
           R L    +++LVSI+G+V R++ V P +           A +     D TT +  +   +
Sbjct: 138 RTLMATHLNQLVSIEGIVTRTSIVRPKLLRSVHLSKNTGAHYYRDYRDATTTLVTE---V 194

Query: 323 QEPLRCPRVACNQRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVD 382
             P   P  A  + N ++  +   ++ D Q + +QE P+  P GQ P SV + + D+LVD
Sbjct: 195 PTPAIYPE-ADPEGNPLNTEYGYSTYMDHQRVTVQEMPEKAPPGQLPRSVDVILDDDLVD 253

Query: 383 SCRAGDRIEVTGIFRSIPIRANQRQRALK------SLYKTYLDVVHVRKVSARRLDIDTS 436
             + GDR+ + G+F+SI         +        + +KT +    V  + AR   +  S
Sbjct: 254 KTKPGDRVNIVGVFKSIGAGGMSGGSSSDHGNNGLAGFKTLIIGNTVYPLHARSTGVAAS 313

Query: 437 TVEQQILQNQMDNVEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGIL 496
                             +++D DI  IN +A   DV+++LA+S+APSIY  + IKK +L
Sbjct: 314 -----------------ERLSDTDIRNINKLAKSADVFDLLAQSLAPSIYGHEHIKKAVL 356

Query: 497 LQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGL 556
           L L              RGDINIL+ GDPST+KSQ+L++V   A   + T+G+GSS VGL
Sbjct: 357 LMLMGGVEKNLENGSHLRGDINILMVGDPSTAKSQMLRFVLNTAALAIATTGRGSSGVGL 416

Query: 557 TAYITRDADTKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGI 616
           TA +T D +T +  LE+GA+VL+D G+ CIDEFDKMSD  R  +HEVM+QQ +++AKAGI
Sbjct: 417 TAAVTMDRETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGI 476

Query: 617 ITTLNARTSILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELA 676
            TTLNAR S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D +++  DR ++
Sbjct: 477 HTTLNARCSVIAAANPVFGQYDVNKDPHKNIALPDSLLSRFDLLFVVTDDINDVRDRAIS 536

Query: 677 KH-------LTSLYLEDKPAHVSESDILPVHFLTMYINYAK-----------QHIHPVIT 718
           +H       L   Y+E +P  + E+  L +   T  ++              +   P++ 
Sbjct: 537 EHVLRTHRYLPPGYMEGEP--IREAINLSLSVGTDGVSIDPDADDDTTDKVFEKYDPLLH 594

Query: 719 EGAK------------------TELVRAYVNMRS---------------------MGDDS 739
            GAK                     +R YV                         + +D 
Sbjct: 595 AGAKLAKNRGDHRGAELPKVVSIPFIRKYVQYAKERIVPVLTQDAVNIIVKTYCDLRNDQ 654

Query: 740 RADEKRITATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAI 788
              +  ITA  R LE++IRLS AHAKVRLS+ VE  D   A +L++ A+
Sbjct: 655 NTKKSPITA--RTLETLIRLSNAHAKVRLSKLVEARDANVAAQLLRFAL 701

>KLLA0D06171g complement(528904..531318) similar to sp|P15274
           Saccharomyces cerevisiae YML035c AMD1 AMP deaminase,
           start by similarity
          Length = 804

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 69/148 (46%), Gaps = 8/148 (5%)

Query: 138 NVSIQEVACTFKNFLMTF-KYKYRKIKDEQELFINETTDEELYYVNQLHQMRQLGTCNLN 196
           +  +   AC  +  L+ F K+K R  KDE+ +F     DE++  + ++ Q  +L   +L+
Sbjct: 354 DTHVHHSACMNQKHLLRFIKHKLRHSKDEKVIF----RDEKILTLEEVFQSLKLSGYDLS 409

Query: 197 LDVRNLISFPGTEKLYHQLLNYPQEVISIMDQAVKDCMVQLAVDIDGAEGNENLIEVESK 256
           +D  ++ +   T   +H+   +  +   I +  +++  ++    IDG    E   EV S 
Sbjct: 410 IDTLDMHAHKDT---FHRFDKFNLKYNPIGESRLREIFLKTDNYIDGKYLAEITTEVISD 466

Query: 257 IYKIRPYNLDSERGMRELNPNDIDKLVS 284
           +   +  N +    +   +P++ DKL +
Sbjct: 467 LENSKYQNCEYRISIYGRSPDEWDKLAA 494

>Scas_716.15
          Length = 1052

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 155 FKYKYRKIKDEQE--LFINETTDEELYYVNQLHQMRQLGTCNLNLDV-RNLISFPGTEKL 211
           F +KY++++D+ +  L   +  D      +Q +Q         NLD+ RNL+S P     
Sbjct: 807 FLFKYKQLRDKAKSRLHRKQIIDINASIGSQKYQFTAGNDKKSNLDIPRNLMSLPINTPR 866

Query: 212 YHQLLNYPQEVISIMDQAVKDCMVQL 237
            HQ+L+  Q V    +Q VK+   +L
Sbjct: 867 NHQILSVAQNVFQNEEQTVKNLKTEL 892

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 26,039,468
Number of extensions: 1096073
Number of successful extensions: 4076
Number of sequences better than 10.0: 51
Number of HSP's gapped: 4085
Number of HSP's successfully gapped: 68
Length of query: 872
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 762
Effective length of database: 12,788,129
Effective search space: 9744554298
Effective search space used: 9744554298
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)