Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR292W1439141271060.0
KLLA0A04059g1366144620610.0
Scas_505.31364146520220.0
CAGL0G06226g1318144416760.0
Kwal_26.7083140047012021e-141
YAL024C (LTE1)143545511271e-130
CAGL0E03476g15642131852e-13
Kwal_14.231315172301781e-12
YLR310C (CDC25)15892291781e-12
Sklu_2189.415262261762e-12
YLL016W (SDC25)10482201663e-11
KLLA0D09306g15371761592e-10
ADL038W15092161541e-09
Scas_621.1*13232141475e-09
Scas_604.1516762201477e-09
Kwal_33.1359814122161252e-06
CAGL0D06512g13082101073e-04
KLLA0C03410g13602111064e-04
CAGL0B01287g12471401055e-04
Scas_476.213302751020.001
Sklu_2300.3478170840.12
Scas_433.11167143715.3
Scas_675.3262453688.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR292W
         (1412 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR292W [1339] [Homologous to ScYAL024C (LTE1) - SH] complement(...  2741   0.0  
KLLA0A04059g complement(361328..365428) similar to sp|P07866 Sac...   798   0.0  
Scas_505.3                                                            783   0.0  
CAGL0G06226g 592179..596135 similar to sp|P07866 Saccharomyces c...   650   0.0  
Kwal_26.7083                                                          467   e-141
YAL024C (LTE1) [44] chr1 complement(101568..105875) GDP/GTP exch...   438   e-130
CAGL0E03476g complement(318956..323650) similar to sp|P04821 Sac...    76   2e-13
Kwal_14.2313                                                           73   1e-12
YLR310C (CDC25) [3699] chr12 complement(752226..756995) Guanine-...    73   1e-12
Sklu_2189.4 YLR310C, Contig c2189 8340-12920                           72   2e-12
YLL016W (SDC25) [3403] chr12 (112846..115992) Protein of unknown...    69   3e-11
KLLA0D09306g 783852..788465 weakly similar to sp|P04821 Saccharo...    66   2e-10
ADL038W [1703] [Homologous to ScYLR310C (CDC25 ) - SH; ScYLL016W...    64   1e-09
Scas_621.1*                                                            61   5e-09
Scas_604.15                                                            61   7e-09
Kwal_33.13598                                                          53   2e-06
CAGL0D06512g complement(617453..621379) some similarities with s...    46   3e-04
KLLA0C03410g 303739..307821 weakly similar to ca|CA0382|IPF16030...    45   4e-04
CAGL0B01287g 114832..118575 similar to KLLA0C03410g Kluyveromyce...    45   5e-04
Scas_476.2                                                             44   0.001
Sklu_2300.3 YCR038C, Contig c2300 4973-6405 reverse complement         37   0.12 
Scas_433.1                                                             32   5.3  
Scas_675.32                                                            31   8.7  

>ACR292W [1339] [Homologous to ScYAL024C (LTE1) - SH]
            complement(891524..895843) [4320 bp, 1439 aa]
          Length = 1439

 Score = 2741 bits (7106), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1345/1412 (95%), Positives = 1345/1412 (95%)

Query: 1    MRAEGNDMAESGRAVFSAADYYPAPSGRVITYAAGGRGRQIMXXXXXXXXXXXXSPVDGV 60
            MRAEGNDMAESGRAVFSAADYYPAPSGRVITYAAGGRGRQIM            SPVDGV
Sbjct: 1    MRAEGNDMAESGRAVFSAADYYPAPSGRVITYAAGGRGRQIMAADVTALVAALTSPVDGV 60

Query: 61   EYELFADFFLVYRNFXXXXXXXXXXXXXFDWSLGEIGAGRAKARVVGEITLVRTFVLLRH 120
            EYELFADFFLVYRNF             FDWSLGEIGAGRAKARVVGEITLVRTFVLLRH
Sbjct: 61   EYELFADFFLVYRNFLEARRLLELLEARFDWSLGEIGAGRAKARVVGEITLVRTFVLLRH 120

Query: 121  WVINYFAQDFLPDVALRERFLAFVNGLGGAAGGTRPKIVANIVVSLKKTWAYTVRLIWDD 180
            WVINYFAQDFLPDVALRERFLAFVNGLGGAAGGTRPKIVANIVVSLKKTWAYTVRLIWDD
Sbjct: 121  WVINYFAQDFLPDVALRERFLAFVNGLGGAAGGTRPKIVANIVVSLKKTWAYTVRLIWDD 180

Query: 181  LDLEREFELRSADAWLQFQIPDVTQLKTEAGLQRDSRLSFYARQSSTNPSFRNESVLSLY 240
            LDLEREFELRSADAWLQFQIPDVTQLKTEAGLQRDSRLSFYARQSSTNPSFRNESVLSLY
Sbjct: 181  LDLEREFELRSADAWLQFQIPDVTQLKTEAGLQRDSRLSFYARQSSTNPSFRNESVLSLY 240

Query: 241  RPKDNFQLPVRNNDYNIKQGTRIKKRTASMFLYPQDSLNAPSGNQKPQCSLEPPFPAHSH 300
            RPKDNFQLPVRNNDYNIKQGTRIKKRTASMFLYPQDSLNAPSGNQKPQCSLEPPFPAHSH
Sbjct: 241  RPKDNFQLPVRNNDYNIKQGTRIKKRTASMFLYPQDSLNAPSGNQKPQCSLEPPFPAHSH 300

Query: 301  VRKISHISKVTNVSNVIKEVAYPTSPAVESFFPPTPSKKLEFTVNSTYVPPAAAECSREP 360
            VRKISHISKVTNVSNVIKEVAYPTSPAVESFFPPTPSKKLEFTVNSTYVPPAAAECSREP
Sbjct: 301  VRKISHISKVTNVSNVIKEVAYPTSPAVESFFPPTPSKKLEFTVNSTYVPPAAAECSREP 360

Query: 361  SAQKKPRSPNGYRAVTGLLSKWRMNHLSRHKACDRTSTVEPAMDNLIKYVFSISSLESPK 420
            SAQKKPRSPNGYRAVTGLLSKWRMNHLSRHKACDRTSTVEPAMDNLIKYVFSISSLESPK
Sbjct: 361  SAQKKPRSPNGYRAVTGLLSKWRMNHLSRHKACDRTSTVEPAMDNLIKYVFSISSLESPK 420

Query: 421  GDIQEEREISPSKFDILSARTIEEVEHLITVENEVLQKVTAHEGKVPITSSSAREARFPP 480
            GDIQEEREISPSKFDILSARTIEEVEHLITVENEVLQKVTAHEGKVPITSSSAREARFPP
Sbjct: 421  GDIQEEREISPSKFDILSARTIEEVEHLITVENEVLQKVTAHEGKVPITSSSAREARFPP 480

Query: 481  LLNEAPLLDQAPLGNGQEYSVIDNLNLYRTVSTIATSVIKLTRTASQRQTKVTXXXXXXX 540
            LLNEAPLLDQAPLGNGQEYSVIDNLNLYRTVSTIATSVIKLTRTASQRQTKVT       
Sbjct: 481  LLNEAPLLDQAPLGNGQEYSVIDNLNLYRTVSTIATSVIKLTRTASQRQTKVTLPPPPPL 540

Query: 541  XXXXTSLSAFXXXXXXXXXXXXXXXXXYQNSKASLHLRPLASADENAEGSSVQASNPPQV 600
                TSLSAF                 YQNSKASLHLRPLASADENAEGSSVQASNPPQV
Sbjct: 541  RQRPTSLSAFRGSSSRMLLSDSLRRDGYQNSKASLHLRPLASADENAEGSSVQASNPPQV 600

Query: 601  IFHTHALIKTPTDKVFDAKAVEDTSPKTSLVSTQVTDARPPSYESTITYDSDLQDITMRD 660
            IFHTHALIKTPTDKVFDAKAVEDTSPKTSLVSTQVTDARPPSYESTITYDSDLQDITMRD
Sbjct: 601  IFHTHALIKTPTDKVFDAKAVEDTSPKTSLVSTQVTDARPPSYESTITYDSDLQDITMRD 660

Query: 661  YNTSNQTENHNDGTLDTNQPILNRKTNHSNLREFLFEASTSGSPAAHTTQEPTDESTGRL 720
            YNTSNQTENHNDGTLDTNQPILNRKTNHSNLREFLFEASTSGSPAAHTTQEPTDESTGRL
Sbjct: 661  YNTSNQTENHNDGTLDTNQPILNRKTNHSNLREFLFEASTSGSPAAHTTQEPTDESTGRL 720

Query: 721  GACPTVMRSISEPIPTVMRSNNGDTHTKAKPEFNIQSHDDTFSRKPMRPSLLSPPINIRG 780
            GACPTVMRSISEPIPTVMRSNNGDTHTKAKPEFNIQSHDDTFSRKPMRPSLLSPPINIRG
Sbjct: 721  GACPTVMRSISEPIPTVMRSNNGDTHTKAKPEFNIQSHDDTFSRKPMRPSLLSPPINIRG 780

Query: 781  SFDTLHRKNVPAPISVPPNPVTKNASVSPASGRISIIKKSGNRTSPTTRSPLLDTTSAFM 840
            SFDTLHRKNVPAPISVPPNPVTKNASVSPASGRISIIKKSGNRTSPTTRSPLLDTTSAFM
Sbjct: 781  SFDTLHRKNVPAPISVPPNPVTKNASVSPASGRISIIKKSGNRTSPTTRSPLLDTTSAFM 840

Query: 841  EKTDSFAKQEASLNALENDLQAILITTGRRSSTFSKSGTDSTIATNVLLESIQTSPQKNT 900
            EKTDSFAKQEASLNALENDLQAILITTGRRSSTFSKSGTDSTIATNVLLESIQTSPQKNT
Sbjct: 841  EKTDSFAKQEASLNALENDLQAILITTGRRSSTFSKSGTDSTIATNVLLESIQTSPQKNT 900

Query: 901  HLMTNISEDDSASNTDTKPMEFXXXXXXXXXXXXXXFADALCEPANRSSPSHNPYSGQCT 960
            HLMTNISEDDSASNTDTKPMEF              FADALCEPANRSSPSHNPYSGQCT
Sbjct: 901  HLMTNISEDDSASNTDTKPMEFSSVGIESSASNSSSFADALCEPANRSSPSHNPYSGQCT 960

Query: 961  TIEDRYRRSRFASQPDSLLGYINENGNKYIFSPGETAEDASPKKDMETLKTKFMTTKEPP 1020
            TIEDRYRRSRFASQPDSLLGYINENGNKYIFSPGETAEDASPKKDMETLKTKFMTTKEPP
Sbjct: 961  TIEDRYRRSRFASQPDSLLGYINENGNKYIFSPGETAEDASPKKDMETLKTKFMTTKEPP 1020

Query: 1021 VCPSGNDADLALIISKLKETNPSAERIETENPNDDANNLTPPATSSSNNENSSDPVAVAL 1080
            VCPSGNDADLALIISKLKETNPSAERIETENPNDDANNLTPPATSSSNNENSSDPVAVAL
Sbjct: 1021 VCPSGNDADLALIISKLKETNPSAERIETENPNDDANNLTPPATSSSNNENSSDPVAVAL 1080

Query: 1081 MKLEGTFAKPAKEDNTASKLNSPRSSVLAKEVEKLDFQKWRFPSSKTMNKRQSMFIERRR 1140
            MKLEGTFAKPAKEDNTASKLNSPRSSVLAKEVEKLDFQKWRFPSSKTMNKRQSMFIERRR
Sbjct: 1081 MKLEGTFAKPAKEDNTASKLNSPRSSVLAKEVEKLDFQKWRFPSSKTMNKRQSMFIERRR 1140

Query: 1141 TMTDIFSSATEDTSSEEQSPKLSDREIRELLETYKLQDPRLNIKNVEHHVPFILMYDSCS 1200
            TMTDIFSSATEDTSSEEQSPKLSDREIRELLETYKLQDPRLNIKNVEHHVPFILMYDSCS
Sbjct: 1141 TMTDIFSSATEDTSSEEQSPKLSDREIRELLETYKLQDPRLNIKNVEHHVPFILMYDSCS 1200

Query: 1201 IAKQMTLIEREVMNEIDWKDLLDLNMKKSLPRVTSWLQLLLHNEELSGIDLAIARFNLTV 1260
            IAKQMTLIEREVMNEIDWKDLLDLNMKKSLPRVTSWLQLLLHNEELSGIDLAIARFNLTV
Sbjct: 1201 IAKQMTLIEREVMNEIDWKDLLDLNMKKSLPRVTSWLQLLLHNEELSGIDLAIARFNLTV 1260

Query: 1261 DWIISELVMTTDIKLRRNAIQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQKFTSSWRL 1320
            DWIISELVMTTDIKLRRNAIQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQKFTSSWRL
Sbjct: 1261 DWIISELVMTTDIKLRRNAIQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQKFTSSWRL 1320

Query: 1321 IEPADMLTWEHLKSIPSLDRNYHNVRNLLNSIDPIKGCIPFLVVYLSDLALNSEKRDWIV 1380
            IEPADMLTWEHLKSIPSLDRNYHNVRNLLNSIDPIKGCIPFLVVYLSDLALNSEKRDWIV
Sbjct: 1321 IEPADMLTWEHLKSIPSLDRNYHNVRNLLNSIDPIKGCIPFLVVYLSDLALNSEKRDWIV 1380

Query: 1381 PNEIVNYNKFQTNVQIVKNFIQRVQWARFYDI 1412
            PNEIVNYNKFQTNVQIVKNFIQRVQWARFYDI
Sbjct: 1381 PNEIVNYNKFQTNVQIVKNFIQRVQWARFYDI 1412

>KLLA0A04059g complement(361328..365428) similar to sp|P07866
            Saccharomyces cerevisiae YAL024c LTE1 GDP/GTP exchange
            factor, start by similarity
          Length = 1366

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/1446 (37%), Positives = 783/1446 (54%), Gaps = 172/1446 (11%)

Query: 15   VFSAADYYPAPSGRVITYAAGGRGRQIMXXXXXXXXXXXXSPVDGVEYELFADFFLVYRN 74
            +FS  + YP PS  V+T        +I+            SP+D V+Y +  DFFLVYRN
Sbjct: 15   LFSRPELYPVPSESVLTVDLRDGTVRILKCTLPALLVQLSSPLDKVDYSMLTDFFLVYRN 74

Query: 75   FXXXXXXXXXXXXXFDWSLGEIGAG-RAKARVVGEITLVRTFVLLRHWVINYFAQDFLPD 133
            F             F W++    +   ++ ++  E+ LVR FVL+RHW+ NYFAQDF+ D
Sbjct: 75   FMSSQKLLDLIQERFQWAIDLRQSDPSSQEKITSEVILVRMFVLVRHWLSNYFAQDFVVD 134

Query: 134  VALRERFLAFVNGLGGAAGGTRPKIVANIVVSLKKTWAYTVRLIWDDLD-LEREFELRSA 192
             +LR +FL F+NG          + + NI++SLKK W   V+++W+DL+ L  E  + S 
Sbjct: 135  TSLRRQFLQFINGYSPV-----DRFLDNIIISLKKLWVQNVQIMWEDLENLIVENNVVSR 189

Query: 193  DAWLQFQIPDV---TQLKTEAGLQRDSRLSFYARQSSTNPSFRNESVLSLYRPKDNFQLP 249
            D WL+++I DV   +  +T  G  +  RLSF A Q+  NP  RNES+LSL   ++   LP
Sbjct: 190  DDWLKWEIEDVPSGSSSETGEGSTKGKRLSFIALQNINNPVLRNESLLSLLHTREKIPLP 249

Query: 250  VRNNDYNIKQGTRIKKRTASMFLYPQDSLNAPSGNQKPQCSLEPPFPAHSHVRKIS---- 305
             ++ D + KQ TRIK+RT SM L+P+++ N  S N+K   S   P       R+I+    
Sbjct: 250  QQSEDESKKQSTRIKQRTGSMLLFPENASNGLSINEKLTASGVSPEATPKQEREITDPKN 309

Query: 306  ---------HISKVTNVSNVIKEVAYPTSPAVESFFPPTPSKKLEFTVNSTYVPPAAAEC 356
                      +S+VTNVS ++K++ YP++P+V+ F PPTP+K +EF + ++Y+     E 
Sbjct: 310  SKDNKHILPQLSRVTNVSYMMKDLEYPSTPSVDIFVPPTPAKNIEFILQTSYMETDLPEQ 369

Query: 357  SR-EPSAQKKPRSPNGYRAVTGLLSKWRMNHLSRHKACDRTSTVEPA-----MDNLIKYV 410
            S    S      +   ++ + GLLSKW++NH        R  TV P      ++NLIKYV
Sbjct: 370  SNGSDSTNTVNGNNTNHKGILGLLSKWKLNH-------QRKPTVNPVQNPPRVENLIKYV 422

Query: 411  FSISSLESPKGDIQEEREISPSKFDILSARTIEEVEHLITVENEVLQKVTAHEGKVPITS 470
            FSISSL++    + +      S FDILSARTI+EVE+L++VE+++L K+ A +    I+ 
Sbjct: 423  FSISSLDNHANPLPDSLS---SMFDILSARTIDEVEYLVSVESDLLAKLEAKKLTTEISK 479

Query: 471  SSAREARFPPLLNEAPLLDQAPLGNGQEYSVIDNLNLYRTVSTIATSVIKLTRTASQRQT 530
                E                     Q+YSVIDNLNLY+TVS+IA SVI L++T + R  
Sbjct: 480  LETNE------------------DESQDYSVIDNLNLYKTVSSIANSVISLSKTLNVRTN 521

Query: 531  KVTXXXXXXXXXXXTSLSAFXXXXXXXXXXXXXXXXXYQNSKASL--HLRPLASADENAE 588
            K T            S SA                  Y NS+ S+   L  L + ++N  
Sbjct: 522  KSTTHLLS------PSTSALERKNIRNSAPMLYS---YNNSRYSITNALMGLPNTNDN-- 570

Query: 589  GSSVQASNPPQVIFHTHALIKTPTDKVFDAKAVEDTSPKTSLVSTQVTDARPPSYESTIT 648
                  S+P +++FH      +PT K   A  + +             +    S  S +T
Sbjct: 571  ------SSPKRLVFHDPTR-NSPTKKAILANNLNNIGE---------YNGERDSITSIVT 614

Query: 649  YDSDLQDITMRDYNTSNQTENHNDGT--LDTNQPILNRKTNHSNLREFLFEASTSGSPAA 706
            YDS   DI+    ++ N    H   +     + P L RK N ++LR F FE S S     
Sbjct: 615  YDSAFSDIS----SSGNILSQHKGSSNIFMESAPTLKRKLNVNDLRRFNFEKSDS----- 665

Query: 707  HTTQEPTDESTGRLGACPTVMRSISEPIPTVMRSNNGDTHTKAKPEFNIQSHDDTFSRKP 766
                  TD+      +C    R  +E   T M S+  D     + E+  ++ D       
Sbjct: 666  ------TDDR-----SCSPQNREATETSATSMESDANDN--AIQDEYENENED------- 705

Query: 767  MRPSLLSPPINIRGSFDTLHRKNVPAPISVPPN---PVTKNASVSPASGRISIIKKSGNR 823
               SL++         DT  + N  A I  P +    +T+N SV+  +   SI+ KS   
Sbjct: 706  -IASLITAYEESTSEIDTQCQNN--AQIRRPTSGRISITRNYSVASPNSLRSILPKS--- 759

Query: 824  TSPTTRSPLLDTTSAFMEKTDSFAKQEASLNALENDLQAILITTGRRSSTFSKSG----T 879
                   PL+     F+E+  + A  +  ++ LE +  ++L+    R  T S+      +
Sbjct: 760  -------PLILGNEVFIERDKALAANQDIISELE-ETTSLLLNDNDRKFTVSRGSVCNDS 811

Query: 880  DS-TIATNVLLESIQTSPQKNTHLMTNISEDDSASNTDTKPMEFXXXXXXXXXXXXXXFA 938
            DS +I+TN+L  S Q SPQK      ++ ++ S       P+                  
Sbjct: 812  DSQSISTNLLFSSAQASPQKLVIKEVDVIQEKSEHPDVPTPVLCKQPISKLSETPSIKSI 871

Query: 939  DALC--EPANRSSPSHNPYSGQCTTIEDRYRRSRFASQP--DSLLGYINENGNKYIFSPG 994
             +    E  + +S +  P   Q TT+ ++Y   + A+    +  +  +N   NKY+FSP 
Sbjct: 872  GSRDSEESFDLTSIASKPNRAQSTTLREKYHLEKQATNDIFEEDVENLNPENNKYLFSPD 931

Query: 995  ETAED-ASPKKDMETLKTKFM--TTKEPPVCPSGNDADLALIISKLKETNPSAERIETEN 1051
              + D ASP+K+++ LK +F+  +T E     S ++ ++A   ++ K+     +++E   
Sbjct: 932  TDSIDFASPEKNLDDLKQQFIDQSTDEQT---SLDEEEIATQDNENKDHGIDKKKLE--- 985

Query: 1052 PNDDANNLTPPATSSSNNENSSDPVAVALMKLEGTFAKPAKE-DNTASKLNSPRSSVLAK 1110
              D  N +   A      + S DPV +ALMKLEGT+ K  KE D+ +  +NS     LA+
Sbjct: 986  --DIMNGIDDTA------DTSMDPVNLALMKLEGTYDKGEKEIDDKSPSINSE----LAR 1033

Query: 1111 EVEKLDF-QKWRFPSSKTMNKRQSMFIERRR-TMTDIFSSATEDTSSEEQSPKL--SDRE 1166
            EVE     Q    P S    KRQSMFI+RRR TM D FS        +    +L  +D +
Sbjct: 1034 EVENFQIVQTAALPESA--RKRQSMFIQRRRNTMID-FSVRDSLIDKDSSCTRLENTDEQ 1090

Query: 1167 IRELLETYKLQDPRLNIKNVEHHVPFILMYDSCSIAKQMTLIEREVMNEIDWKDLLDLNM 1226
            IR LL  Y L D RL I N+E H+PFILMYDS S+A Q+TLIE+E+++E+DWKDLLDL M
Sbjct: 1091 IRNLLNQYTLTDSRLKIDNLEQHIPFILMYDSKSVANQLTLIEKEILSEVDWKDLLDLTM 1150

Query: 1227 KKSLPRVTSWLQLLLHNEELSGIDLAIARFNLTVDWIISELVMTTDIKLRRNAIQRLIHV 1286
             + LP+ TSWLQLL+ NE LSGIDLAIARFNLTVDWIISE+VMT DI+LRRN IQR IH+
Sbjct: 1151 SEQLPQFTSWLQLLVQNENLSGIDLAIARFNLTVDWIISEIVMTQDIRLRRNTIQRFIHI 1210

Query: 1287 AEHCRMYQNYNTVMEIVLALNSVVVQKFTSSWRLIEPADMLTWEHLKSIPSLDRNYHNVR 1346
            AEHC+  QNYNT+MEI+LALNS+VVQKFT +WRL+EP D+LTWE LK+IPSL++NY N+R
Sbjct: 1211 AEHCKELQNYNTLMEIILALNSIVVQKFTETWRLVEPGDLLTWETLKAIPSLEKNYSNIR 1270

Query: 1347 NLLNSIDPIKGCIPFLVVYLSDLALNSEKRDWIVPNEIVNYNKFQTNVQIVKNFIQRVQW 1406
             L++ ++P+ GCIPF+VVYLSDL+LN EKR WIV +E++NYNKFQTNVQIVKNF+Q++QW
Sbjct: 1271 QLIDEVEPLSGCIPFIVVYLSDLSLNIEKRTWIVHDEVLNYNKFQTNVQIVKNFVQKMQW 1330

Query: 1407 ARFYDI 1412
            ++FY+I
Sbjct: 1331 SKFYNI 1336

>Scas_505.3
          Length = 1364

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/1465 (37%), Positives = 788/1465 (53%), Gaps = 193/1465 (13%)

Query: 8    MAESGRAVFSAADYYPAPSGRVITYAAGGRGR---QIMXXXXXXXXXXXXSPVDGVEYEL 64
            M E G  +FSA DYYP PS  VITY      +    +             SP+D V+Y +
Sbjct: 5    MPELG--IFSADDYYPVPSTSVITYNESRTNKIRKTVSKADIIALITYLSSPIDPVDYTI 62

Query: 65   FADFFLVYRNFXXXXXXXXXXXXXFDWSLGEIGAGR---AKARVVGEITLVRTFVLLRHW 121
            F+DFFL+YR+F             F W + EI   +    + + VGE+ L+RTFVLLRH 
Sbjct: 63   FSDFFLIYRDFLSPNELHELLILRFRWCILEILENKNVDVEKQKVGEVALIRTFVLLRHS 122

Query: 122  VINYFAQDFLPDVALRERFLAFVNGLGGAAGGTRPKIVANIVVSLKKTWAYTVRLIWDDL 181
            ++NYF QDFLPD  LR   L F+N        T P+IV+  +V+LK+ W ++ +  W+++
Sbjct: 123  ILNYFVQDFLPDSHLRYMLLNFLND---NVYQTSPRIVSGSIVNLKRAWIHSAKQTWENI 179

Query: 182  DLEREFELRSAD--AWLQFQIPDVTQLKTEAGLQRDSRLSFYARQSSTNPSFRNESVLSL 239
                  E  S D   WL F+I DV Q+  E  L+R SRLS YA Q S++P FRN SVLSL
Sbjct: 180  PFN---EPSSVDFNEWLLFEIKDVIQM--EEQLKRGSRLSEYAIQGSSSPDFRNRSVLSL 234

Query: 240  YRPKDNFQLPVRNNDYNIKQGTRIKKRTASMFLYPQDSLNAPS-----GNQKPQCSLEPP 294
            Y   DNF+LP  + D+N  +     K+TASM LYP D+ N P      G +  + +L   
Sbjct: 235  YNSTDNFKLP-ESLDFNSNRT----KQTASMMLYPNDNSNIPKIPIPKGKEPLKITLIND 289

Query: 295  FPAHSHVRKISHISKVTNVSNVIKEVAYPTSPAVESFFPPTPSKKLEFTVNSTYVPPAAA 354
                + +RKISH+SK+ ++S VIK+V YPTSPA+    PPTP+KK+EF +NS Y+P    
Sbjct: 290  --NKNDIRKISHLSKIAHMSTVIKDVDYPTSPAINRIIPPTPAKKVEFILNSLYIPEDND 347

Query: 355  ECSRE-PSAQKKP---RSPNGYRAVTGLLSKWRMNHLSRHKACDRTSTVE---------P 401
            E   + P  +  P   +S    R   GLL++W+ NH +R+   ++  T +         P
Sbjct: 348  ETIEDNPRVKSTPPPIQSSLLQRGAIGLLARWKRNH-TRNSRKEKIKTTQSGVNTPISKP 406

Query: 402  AMDNLIKYVFSISSLESPKGDIQEE-REISPSKFDILSARTIEEVEHLITVENEVLQKVT 460
             MDN +KYV SI+SLE+ K     E  ++  SKFDILSARTI+EVE+LI++ENE+ QKV 
Sbjct: 407  DMDNFVKYVISITSLENTKSHASGEINDMITSKFDILSARTIDEVEYLISLENELQQKV- 465

Query: 461  AHEGKVPITSSSAREARFPPLLNEAPLLDQAPLGNGQEYSVIDNLNLYRTVSTIATSVIK 520
               G+  + +++ +      L N  P     P  +   +S +DNL+LY+TVS++A SVI 
Sbjct: 466  --RGQANLNNNNLKSIG---LENTMPF---EPPKDTANFSAMDNLDLYKTVSSLAQSVIS 517

Query: 521  LTRTASQR-QTKVTXXXXXXXXXXXTSLSAFXXXXXXXXXXXXXXXXXYQNSKASLHLRP 579
            L+ T ++  + K+              +S+F                   N K S   + 
Sbjct: 518  LSNTLNKSTKLKIVNSPSLSALERRMVMSSFPAL----------------NGKVSSSSK- 560

Query: 580  LASADE---NAEGSSVQASNPPQVIFH----THALIKTPTDKVFDAKAVEDTSPKTSLV- 631
            +   DE   N      +   P +++FH    T +L +TPT K      +  +SP  +++ 
Sbjct: 561  IGIEDELVINITPPRAKNDGPQRLVFHDDGSTLSLPQTPT-KSNRKSNIRHSSPLKNVLP 619

Query: 632  ---STQVTDA---RPPSYESTITYDSDLQDITMRDYNTSNQTENHNDGTLDTNQPILNRK 685
                  ++D+      S+ STI+YDS L   + +  ++          T    +  L +K
Sbjct: 620  NLNEVDLSDSVCSDDESFVSTISYDSLLSSKSFKHKSSRRSNLYSRPLTFKNEEQTLKKK 679

Query: 686  TNHSNLREFLFEASTSGSPAAHTTQEPTDESTGRLGACPTVMRSISEPIPTVMRSNNGDT 745
            T   NLREF FE S                              +S P PT  + +   T
Sbjct: 680  TASKNLREFTFETS-----------------------------KLSLPSPTKSQGSPKAT 710

Query: 746  HTKAKPEFNIQSHDDTFSRKPMRPSLLSPPINIRGSFDTLHRKNVPAPISVPPNPVTKNA 805
            H +       Q H             L+PP+++  + D L +      +S P N +T   
Sbjct: 711  HIRQ------QHH-------------LTPPVSLSPT-DPL-KMEAEDHLS-PLNKLTPQT 748

Query: 806  SVSPASGRISIIKKSGNRTSPTTRSPLLDTTSAFMEKTDSFAKQEASLNALENDLQAILI 865
            ++ PASGRISI++KS + T    R+       A + +   F K+E SL   E+ LQ +  
Sbjct: 749  AIRPASGRISILRKSLSITQ-ARRNTYAGPPKADLLRDPDFIKKERSLIESEHQLQEL-- 805

Query: 866  TTGRRSSTFSKSGTDSTIATNVLLESIQTSPQKNTHLMTNISEDDSASNTDTKPMEFXXX 925
                +     ++   S++AT+ L  S + SP+K T         ++     T P  +   
Sbjct: 806  ----QDDLLERTSLQSSVATDNLFNSRKNSPKKVTA--------ENKVRLSTTPSIYSIL 853

Query: 926  XXXXXXXXXXXFADALCEPANRSSPSHNP---------YSGQCTTIEDRYRRSRFASQPD 976
                       + D    PA  S    N          ++G    +      +  +S   
Sbjct: 854  DDSSLSSGNTSYND----PARDSMQFTNDKRIDLREVFHNGSVQNV----ISNDLSSDAI 905

Query: 977  SLLGYINENG-----NKYIFSPGETAED-ASPKKDMETLKTKFMTTKEPPVCPSGNDADL 1030
            S L  + +NG     NKY+FSP E   D  SP KD+E LK KF+  +         + + 
Sbjct: 906  SGLSELKDNGINGVSNKYLFSPEEDNTDLISPGKDVEVLKNKFLKNE-------TFEEES 958

Query: 1031 ALIISKLKETNPSAERIETENPNDDANNLTPPATSSSNNENSSDPVAVALMKLEGTFAKP 1090
              II  ++E   +++     N + D   L   A    ++  S DP+++A+MKLEGT+   
Sbjct: 959  ESIIDGIQE---ASDEGAMPNVDLDKEKLKDIA-DIPDDTGSGDPISIAMMKLEGTYK-- 1012

Query: 1091 AKEDNTASKLNSPRSSVLAKEVEKLDFQKW-RFPSSKTMNKRQSMFIERRR-TMTDI-FS 1147
              +D+  +  +S     L KEVE L+ +K   FP S  + KR+S+ IERRR T+ +I F+
Sbjct: 1013 TNDDDNKTHEDSSSVQDLIKEVEMLNLKKLPTFPKS-PLEKRKSLMIERRRQTIMNIPFT 1071

Query: 1148 SATEDTSSEEQSPKLSDREIRELLETYKLQDPRLNIKNVEHHVPFILMYDSCSIAKQMTL 1207
                +     +   +S  +++ L+  Y++QD  L I N EHH+PFILMYDS SIA+QMTL
Sbjct: 1072 PQNSEEGLAIEDKCVSPLQVQTLVMNYEVQDSSLQISNNEHHIPFILMYDSKSIAEQMTL 1131

Query: 1208 IEREVMNEIDWKDLLDLNMKKSLPRVTSWLQLLLHNEELSGIDLAIARFNLTVDWIISEL 1267
            IE+E+++EIDWKDLL+L ++     VTSWLQLL+ NE LSG+DLAIARFNLTVDWI+SE+
Sbjct: 1132 IEKELLSEIDWKDLLNLKIQYKGKAVTSWLQLLIQNETLSGVDLAIARFNLTVDWIVSEI 1191

Query: 1268 VMTTDIKLRRNAIQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQKFTSSWRLIEPADML 1327
             +T D+K+RRN IQR IHVA++CR +QNYNT+MEI+LAL+S+VVQKFT +WRLIEP DML
Sbjct: 1192 TLTRDVKMRRNTIQRFIHVAQYCREFQNYNTLMEIILALSSIVVQKFTDAWRLIEPGDML 1251

Query: 1328 TWEHLKSIPSLDRNYHNVRNLLNSIDPIKGCIPFLVVYLSDLALNSEKRDWIVPNEIVNY 1387
             WE LK IPSLDRNY  +RNLLNS+DP KGCIPF+VVYLSDL+LNSEKR+WIV  ++VNY
Sbjct: 1252 LWEELKHIPSLDRNYSTIRNLLNSLDPKKGCIPFIVVYLSDLSLNSEKRNWIVDRKVVNY 1311

Query: 1388 NKFQTNVQIVKNFIQRVQWARFYDI 1412
            +KF+T+VQIVKNFIQRVQWA+FY+I
Sbjct: 1312 HKFETSVQIVKNFIQRVQWAKFYNI 1336

>CAGL0G06226g 592179..596135 similar to sp|P07866 Saccharomyces
            cerevisiae YAL024c LTE1, start by similarity
          Length = 1318

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/1444 (32%), Positives = 721/1444 (49%), Gaps = 204/1444 (14%)

Query: 15   VFSAADYYPAPSGRVITYAAGGRGR----QIMXXXXXXXXXXXXSPVDGVEYELFADFFL 70
            +FS  DYYP PS  VI Y      +    +++            SPVD V+Y+ F+DFFL
Sbjct: 3    IFSQRDYYPIPSDDVIKYKHMVHKKWNKNEVIQADIPSIIVHLSSPVDSVDYKGFSDFFL 62

Query: 71   VYRNFXXXXXXXXXXXXXFDWSLGEIGA------GRAKARVVGEITLVRTFVLLRHWVIN 124
             YRNF             F W + EI +      G  + R+ G++ L+RTFVLLRH ++N
Sbjct: 63   FYRNFLTPAELYDYLILRFKWCMREIESYQHQRSGDNQLRI-GKVALIRTFVLLRHGILN 121

Query: 125  YFAQDFLPDVALRERFLAFVNGLGGAAGGTRPKIVANIVVSLKKTWAYTVRLIWDDLDLE 184
            +FA DFL +  LR R ++F N        +  K++ + ++SLKK W + ++L WD++ L 
Sbjct: 122  HFADDFLLNENLRLRLISFFN----EDIKSDMKVIVSCLISLKKAWLHAMKLNWDNV-LF 176

Query: 185  REFELRSADAWLQFQIPDVTQLKTEAGLQRDSRLSFYARQSSTNPSFRNESVLSLYRPKD 244
             E    +   W+ ++I DV+QL  +   +R+SR S++  QS +NP  RN S+LS+Y+  D
Sbjct: 177  NEPAFSAYTDWIDYKIKDVSQL--DMAQKRNSRFSYHGIQSISNPDMRNRSILSIYKS-D 233

Query: 245  NFQLPVRNNDYNIKQGTRIKKRTASMFLYPQDSLNAP--------SGNQKPQCSLEPPFP 296
            NF   V++N   I      + RT S  L+ +DS N+          G QK   +L  P  
Sbjct: 234  NFDHMVQSNSNKIS-----RNRTPSTLLFQKDSSNSEMATVYSNRKGAQKKTIAL--PNI 286

Query: 297  AHSHVRKISHISKVTNVSNVIKEVAYPTSPAVESFFPPTPSKKLEFTVNSTYVPPA-AAE 355
              S + +   +S VT +S++I++     S  V    P TP+KK+E  +N+ Y P    +E
Sbjct: 287  LTSELDRKDVMSNVTRMSHIIQDAKTLRSSDVNKIIPSTPAKKVELILNTIYSPDCLESE 346

Query: 356  CSREPSAQKKPRSPNGY-RAVTGLLSKWRMNHL----SRHKACDRTSTVEPAMDNLIKYV 410
              +E   Q    +   + + +  LL++W+ NH        K    T+  E  +DN +KYV
Sbjct: 347  NIQESLNQDTSSTQKSFPKGIMSLLARWKKNHKIADPKIRKPVGFTNKREAELDNFVKYV 406

Query: 411  FSISSLESPKGDIQEEREISPSKFDILSARTIEEVEHLITVENEVLQKV-TAHEGKVPIT 469
             SISSL + + D++   E   SKFDILSARTI+EVE+L  +E+++L ++ T  +    ++
Sbjct: 407  ISISSLTNKEEDLKRLNENLDSKFDILSARTIDEVEYLFRLESKLLAQLSTMQKTTRTLS 466

Query: 470  SSSAREARFPPLLNEAPLLDQAPLGNGQEYSVIDNLNLYRTVSTIATSVIKLTRTASQRQ 529
            +    +   P  +            + ++ S +DNL+L+RTV+ +A SVI LT + + + 
Sbjct: 467  NDEFNDVNVPNNI------------DSKQISAMDNLDLFRTVNGVARSVISLTNSVN-KL 513

Query: 530  TKVTXXXXXXXXXXXTSLSAFXXXXXXXXXXXXXXXXXYQNSKASLHLRPLASADENAEG 589
              ++           +S+  F                 + ++ + +              
Sbjct: 514  NNLSDHSVLDRRRVKSSMPNFYNRERSLSGLSNYAGLQFYDASSEM-------------- 559

Query: 590  SSVQASNPPQVIFH--THALIKTPTDKVFDAKAVEDTSPKTSLVST-----QVTDARPPS 642
             S +   P +++FH     L    T       ++ ++SP   ++        V       
Sbjct: 560  -SAEDDKPQKLVFHDGVDELKNHLTQTFTKPGSISNSSPLKKVLPNLFEHPSVDSLASGD 618

Query: 643  YESTITYDSDLQDITMRDYNTSNQTENHNDGTLDTNQPILNRKTNHSNLREFLFEASTSG 702
              S +TYDS L  +     +  ++T  ++    +   P+L +K  + NLREF FE S   
Sbjct: 619  ACSYVTYDSQLSQMGTVKKSMKDETSRYS----NYEGPVLKKKVAYDNLREFTFEDSKE- 673

Query: 703  SPAAHTTQEPTDESTGRLGACPTVMRSISEPIPTVMRSNNGDTHTKAKPEFNIQSHDDTF 762
                                   ++++ +  +  ++ S                      
Sbjct: 674  -----------------------IIKNDTSSLIDILNS---------------------- 688

Query: 763  SRKPMRPSLLSPPINIRGSFDTLHRKNVPAPISVPPNPVTKNASVSPASGRISIIKKSGN 822
               P+ P L   P    G     H+K   +   + P           ASGRISI K    
Sbjct: 689  ---PVTPDLSILPQTPTGKGSVQHKKKEKSESIISP-----------ASGRISIAKSHHM 734

Query: 823  RTSPTTRSPLLDTTSAFMEKTDSFAKQEASLNALENDLQAILITTGRRSSTFSKSGTDST 882
              SP             +++ D + K + SL   E++L  I +    R S      T   
Sbjct: 735  SLSPNLTK---------LKEDDEYVKGDNSLGQAEDEL--IRLEKNLRDSKLENYNT--V 781

Query: 883  IATNVLLESIQTSPQKNTHLMTNISEDDSA-----SNTDTKPMEFXXXXXXXXXXXXXXF 937
            +A N+   S  ++P  ++   TN+ E  S+     S+ DT+  E               F
Sbjct: 782  VAGNLGAGSGSSTPLGDSP--TNVFELPSSINMVESDMDTESFESSFEQRQPTNLREQYF 839

Query: 938  ADALCEPAN---RSSPSHNPYSGQCTTIEDRYRRSRFASQPDSLLGYINENGNKYIFSP- 993
              ++  P     R   S+N Y             S+ +SQ    L       NKY+FSP 
Sbjct: 840  K-SIGSPETASPRKVNSNNAY-------------SQVSSQMSPSL------ANKYLFSPD 879

Query: 994  GETAEDASPKKDMETLKTKFMTTKEPPVCPSGNDADLALIISKLKETNPSAERIETENPN 1053
             E+ + ASP K++E LK++F+         S   A +   ++   + N      +    +
Sbjct: 880  NESLDIASPVKNVEDLKSRFLKGNNQSASSSQIGASINTSVTATPKNN------DMFGSD 933

Query: 1054 DDANNLTPPATSSSNNENSSDPVAVALMKLEGTFAKPAKEDNTASKLNSPRSSVLAKEVE 1113
             D N L    T+S   + S DPV +A+MKLEGTF K    +NT        SS L KEV+
Sbjct: 934  FDKNGLKNIMTASE-EKLSKDPVELAMMKLEGTFKKNKSGNNTG------YSSDLEKEVD 986

Query: 1114 KLDFQKWRFPSSKTMNKRQSMFIERRR-TMTD----IFSSATEDTSSEEQSPKLSDREIR 1168
             L+       ++   +KR+S+ ++RRR TM +    I+ S T D   +E+S  ++D +I 
Sbjct: 987  ILNIANLPEMNANPSDKRKSLMLDRRRQTMFNIGPSIYPSNTNDEGYDEES--ITDDKIW 1044

Query: 1169 ELLETYKLQDPRLNIKNVEHHVPFILMYDSCSIAKQMTLIEREVMNEIDWKDLLDLNMKK 1228
             L+  Y + D  L  KN  +HVPFILMY+S  +A+Q TLIERE+++EIDWKDLLD+ +  
Sbjct: 1045 SLIAQYHIDDENLLAKNHANHVPFILMYESKDVAQQFTLIEREILSEIDWKDLLDIKLLY 1104

Query: 1229 SLPRVTSWLQLLLHNEELSGIDLAIARFNLTVDWIISELVMTTDIKLRRNAIQRLIHVAE 1288
              P +TSWLQLL+ N+E +GIDLA+ARFNLTVDW ISE+V+TTD+K+RRN I+R IHVAE
Sbjct: 1105 KGPNLTSWLQLLIQNQEFTGIDLAVARFNLTVDWAISEIVLTTDLKMRRNTIERFIHVAE 1164

Query: 1289 HCRMYQNYNTVMEIVLALNSVVVQKFTSSWRLIEPADMLTWEHLKSIPSLDRNYHNVRNL 1348
            HCR  QN+NT+M+I+LALNSVVVQKFT +WRLIEP DML WE L+ IP+LD NYH +R +
Sbjct: 1165 HCRKLQNFNTMMQIILALNSVVVQKFTEAWRLIEPGDMLLWEDLRKIPALDWNYHALRTM 1224

Query: 1349 LNSIDPIKGCIPFLVVYLSDLALNSEKRDWIVPNEIVNYNKFQTNVQIVKNFIQRVQWAR 1408
            + ++DP+KGCIPF+VVYLSDL +NSEK  WIV   +VNY+KF T VQIVKNFIQ+VQW+ 
Sbjct: 1225 MKTVDPLKGCIPFIVVYLSDLTINSEKNTWIVEKRVVNYSKFSTCVQIVKNFIQKVQWSS 1284

Query: 1409 FYDI 1412
            FYDI
Sbjct: 1285 FYDI 1288

>Kwal_26.7083
          Length = 1400

 Score =  467 bits (1202), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 248/470 (52%), Positives = 325/470 (69%), Gaps = 47/470 (10%)

Query: 969  SRFASQPDSLLGYINEN--GNKYIFSPGETAED-ASPKKDMETLKTKFMTTKEPPV--CP 1023
            + F+   DSLLG   ++   NKY+FSP   + D ASP+K+ME LK KF++   P V   P
Sbjct: 917  AEFSGPKDSLLGPEGDDREANKYLFSPDSDSLDFASPEKNMEDLKNKFIS---PIVSEAP 973

Query: 1024 SGNDADLALIISKLKETNPS---------AERIETENPNDDANNLTPPATSSSNNENS-- 1072
            S N+   +      +E  P+          ER+  E+       +  P  ++ +  N   
Sbjct: 974  SLNEEQTSREFDDDQEGEPNDSQLSSTTQPERLPHEHHRRSITPIVSPYKANDSRLNKFA 1033

Query: 1073 --------SDPVAVALMKLEGTFAKPAKE--DNTASKLNSPRSSVLAKEVEKLDFQKWRF 1122
                     DPV VALMKLEGTF+K  KE  +N A             ++EKL   K R 
Sbjct: 1034 KLTDESLHGDPVNVALMKLEGTFSKENKEKGENDA-------------DIEKL---KERR 1077

Query: 1123 PSSKTMNKRQSMFIERRRTM-TDI-FSSATEDTSSEEQSPKLSDREIRELLETYKLQDPR 1180
             +     +R+S  IE+RR + ++I  +  +++   +E+  + +D EI ELLE YK+QD R
Sbjct: 1078 LTGLGSRERRSFLIEKRRQIKSEIPLTPRSKEKVKQEEEVRATDLEITELLENYKIQDKR 1137

Query: 1181 LNIKNVEHHVPFILMYDSCSIAKQMTLIEREVMNEIDWKDLLDLNMKKSLPRVTSWLQLL 1240
            LN+ N + HVPFILMYDS SIA+Q+TL+ERE++NEIDWKDLLDL +K+ +P VTSWLQLL
Sbjct: 1138 LNVSNAQQHVPFILMYDSRSIAEQLTLVEREILNEIDWKDLLDLKLKREVPSVTSWLQLL 1197

Query: 1241 LHNEELSGIDLAIARFNLTVDWIISELVMTTDIKLRRNAIQRLIHVAEHCRMYQNYNTVM 1300
            L NE LSGIDLAIARFNLTVDWIISE+VMT D KLRRN IQRLIHVAEHC+ +QNYNT+M
Sbjct: 1198 LQNERLSGIDLAIARFNLTVDWIISEIVMTCDNKLRRNTIQRLIHVAEHCKTFQNYNTLM 1257

Query: 1301 EIVLALNSVVVQKFTSSWRLIEPADMLTWEHLKSIPSLDRNYHNVRNLLNSIDPIKGCIP 1360
            +I+LAL+S+VVQ +  +WRLIEP D+LTWE LK++PSL++NY+N+R LLN I+PIKGCIP
Sbjct: 1258 QIILALSSLVVQSYRDAWRLIEPGDLLTWESLKNVPSLEKNYYNIRMLLNDINPIKGCIP 1317

Query: 1361 FLVVYLSDLALNSEKRDWIVPNEIVNYNKFQTNVQIVKNFIQRVQWARFY 1410
            F+VVYLSDL LN+EK +WIVPN+++NY+KFQTNVQIVKNFIQR QW++FY
Sbjct: 1318 FIVVYLSDLTLNAEKSNWIVPNQVLNYSKFQTNVQIVKNFIQRAQWSKFY 1367

 Score =  337 bits (863), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 204/508 (40%), Positives = 284/508 (55%), Gaps = 37/508 (7%)

Query: 12  GRAVFSAADYYPAPSGRVITYAAGGRGRQIMXXXXXXXXXXXXSPVDGVEYELFADFFLV 71
           G +VFS  +YYP PS   ++Y   G    I+            SP+D ++Y   ADFFL 
Sbjct: 13  GTSVFSEREYYPTPSAEKMSYLKRGANTLIIKTDLHALIIKLTSPLDPIDYPFLADFFLS 72

Query: 72  YRNFXXXXXXXXXXXXXFDWSLGEIGAGRAKARVVGEITLVRTFVLLRHWVINYFAQDFL 131
           YR F               W+  E      + + +G++T VRTFV++RHW++NYFAQDFL
Sbjct: 73  YRKFLAPNELLRLLESRLQWAFNESLQADKERQKIGQVTSVRTFVVIRHWILNYFAQDFL 132

Query: 132 PDVALRERFLAFVNGLGGAAGGTRPKIVANIVVSLKKTWAYTVRLIWDDLDLEREFELRS 191
            D  LR +F+  +N L   A    PK +  IVVS+KK+W   ++L+W+D+  E      +
Sbjct: 133 ADQELRRQFVDSINSLSWGATEMAPKSIRGIVVSIKKSWVLCLKLMWEDVTFEN--SPSN 190

Query: 192 ADAWLQFQIPDV-TQLKTEAGLQRDSRLSFYARQSSTNPSFRNESVLSLYRPKDNFQLPV 250
            D WL F+I D+ TQ  T+ G     RLSFYA QS  NP FRN SVLSLY   +NFQLP 
Sbjct: 191 VDEWLDFKIQDIDTQSSTKEG---GRRLSFYALQSRQNPDFRNRSVLSLYVGIENFQLPE 247

Query: 251 RNNDYNIKQGTRIKKRTASMFLYPQDSLNAPSGNQKPQCSLEPPFPAHSHVRKISHISKV 310
            +   N + G +IK+RTASMFL+PQD+L  PS   K   S E   PA+SH    S  SK 
Sbjct: 248 NSAQINRRLGAKIKQRTASMFLFPQDNL--PSARLK--ASSESSEPANSHS---SGHSKS 300

Query: 311 TNVSNVIKEVAYPTSPAVESFFPPTPSKKLEFTVNSTYVPPAAAECSREPSAQK--KPRS 368
            +  +V+K++ YPTSP+V+   PPTP+KK+EF + S+Y+P  +     +P+  K  K + 
Sbjct: 301 ESGPDVMKDLQYPTSPSVDKVIPPTPAKKVEFILRSSYLPSDSPTEEADPANAKTDKVKK 360

Query: 369 PNGY---RAVTGLLSKWRMNHLSR---HKACDRTSTVEPAMDNLIKYVFSISSLESPKGD 422
            N +   + + GLLSKW+ NH  R   HKA    S     ++NLIK VFSI+SLE  +  
Sbjct: 361 HNNHSYNKGMVGLLSKWKKNHNLRSENHKAHSE-SPKNQEIENLIKLVFSITSLEHKQDQ 419

Query: 423 IQEEREISPSKFDILSARTIEEVEHLITVENEVLQKVTAHEGKVPITSSSAREARFPPLL 482
            ++      SKFDILSARTI+EVE+ + +EN++L K+    G             F  + 
Sbjct: 420 SEDAANALSSKFDILSARTIDEVEYFLAIENDLLSKIRNRGGLF----------NFERIH 469

Query: 483 NEAPLLDQAPLGNGQEYSVIDNLNLYRT 510
           +E P   Q+P    +  S +DNLNLY+T
Sbjct: 470 HENPQT-QSP----EAVSAMDNLNLYKT 492

>YAL024C (LTE1) [44] chr1 complement(101568..105875) GDP/GTP exchange
            factor, required for termination of M phase [4308 bp,
            1435 aa]
          Length = 1435

 Score =  438 bits (1127), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 238/455 (52%), Positives = 308/455 (67%), Gaps = 40/455 (8%)

Query: 986  GNKYIFSPGETAED-ASPKKDMETLKTKFMTTK-EPPVCPSG----------NDADLALI 1033
             NKY FSP + + D ASP K++E LK+KF+  + E     SG          ND   A  
Sbjct: 963  NNKYFFSPDDGSIDVASPMKNVEELKSKFLKNESETNSNISGSVLTMDDIDINDTSSARN 1022

Query: 1034 ISKLKETNPSAERIETENPNDDANNLTPPATSSSNNENSSDPVAVALMKLEGTFAK-PAK 1092
              +    +     +  +N N+ AN L        ++  + DP+ VALMKLEGT+ K P K
Sbjct: 1023 TRRANSESAFTGSLNKKNLNEIANML--------DDSINDDPITVALMKLEGTYEKIPEK 1074

Query: 1093 EDNT-ASKLNSPRSSVLAKEVEKLDFQKWRFPSSKTMNKRQSMFIERRR-TMTDIFSSAT 1150
             +NT +S     ++S LA EVE L+        +    KR+S+ IERRR T+ +I    T
Sbjct: 1075 PENTKSSDAIGIKTSKLADEVEMLNLNNLPSFQNSPAEKRKSLLIERRRQTIMNI--PFT 1132

Query: 1151 EDTSSEE----QSPKLSD-----------REIRELLETYKLQDPRLNIKNVEHHVPFILM 1195
             D S +E     SP+  D            +I+EL+  Y++ D RL I N E HVPFILM
Sbjct: 1133 PDQSEKEGFTSSSPEKIDVSANVDVAVQAAQIQELIGQYRIHDSRLMISNNESHVPFILM 1192

Query: 1196 YDSCSIAKQMTLIEREVMNEIDWKDLLDLNMKKSLPRVTSWLQLLLHNEELSGIDLAIAR 1255
            YDS S+A+QMTLIE+E++ EIDWKDLLDL MK   P+V SWLQLL+ NE LSGIDLAI+R
Sbjct: 1193 YDSLSVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLVRNETLSGIDLAISR 1252

Query: 1256 FNLTVDWIISELVMTTDIKLRRNAIQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQKFT 1315
            FNLTVDWIISE+++T   K++RN IQR IHVA+HCR +QN+NT+MEI+LAL+S VVQKFT
Sbjct: 1253 FNLTVDWIISEILLTKSSKMKRNVIQRFIHVADHCRTFQNFNTLMEIILALSSSVVQKFT 1312

Query: 1316 SSWRLIEPADMLTWEHLKSIPSLDRNYHNVRNLLNSIDPIKGCIPFLVVYLSDLALNSEK 1375
             +WRLIEP D+LTWE LK IPSLDRNY  +RNLLNS++P+ GC+PF+VVYLSDL+ N+EK
Sbjct: 1313 DAWRLIEPGDLLTWEELKKIPSLDRNYSTIRNLLNSVNPLVGCVPFIVVYLSDLSANAEK 1372

Query: 1376 RDWIVPNEIVNYNKFQTNVQIVKNFIQRVQWARFY 1410
            +DWI+ +++VNYNKF TNVQIVKNFIQRVQW++FY
Sbjct: 1373 KDWILEDKVVNYNKFDTNVQIVKNFIQRVQWSKFY 1407

 Score =  339 bits (869), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 253/747 (33%), Positives = 371/747 (49%), Gaps = 98/747 (13%)

Query: 15  VFSAADYYPAPSGRVITYAAGGRGRQIMXXXXXXXXXXXXSPVDGVEYELFADFFLVYRN 74
           +FS  DYYP PS  VI+Y +    + +             SP++GV+Y   ADFFL+YRN
Sbjct: 3   IFSQKDYYPTPSSNVISYESDCVSKPVNSADLPALIVHLSSPLEGVDYNASADFFLIYRN 62

Query: 75  FXXXXXXXXXXXXXFDWSLGEI--GAGRAKARVVGEITLVRTFVLLRHWVINYFAQDFLP 132
           F             F W + EI   A +AK R +GE+ LVRTFVLLRH ++NYF QDFLP
Sbjct: 63  FITPQDLHDLLIYRFRWCIREITTNAAKAKRRRIGEVALVRTFVLLRHSILNYFVQDFLP 122

Query: 133 DVALRERFLAFVNGLGGAAGGTRPKIVANIVVSLKKTWAYTVRLIWDDLDLEREFELRSA 192
           ++ LR R + F+N          PKI+++ +++LKK W +  +L+W++++L    +L   
Sbjct: 123 NITLRLRLIEFLN---DKHIEQYPKIISSCIINLKKNWVHCSKLVWENIELNEPDKL-DF 178

Query: 193 DAWLQFQIPDVTQLKTEAGLQRDSRLSFYARQSSTNPSFRNESVLSLYRPKDNFQLPVRN 252
           DAWL + + D TQL  E+  +R SRLS YARQS  +P FRN+SVLSLY+  D F+LP + 
Sbjct: 179 DAWLHYSLKDFTQL--ESLHKRGSRLSIYARQSFASPDFRNQSVLSLYKTSDVFRLPEKL 236

Query: 253 NDYNIKQGTRIKKRTASMFLYPQDSLNAPSGNQKPQCSLEPPFPAHSH-----VRKISHI 307
              N  +     +R+ SM L+P ++ N  S   K + + EP     S       +KISH+
Sbjct: 237 QSSNSSKN----QRSPSMLLFPDNTSNVYS---KHRIAKEPSVDNESEDMSDSKQKISHL 289

Query: 308 SKVTNVSNVIKEVAYPTSPAVESFFPPTPSKKLEFTVNSTYVPPAAAECSREPSAQKKPR 367
           SKVT VS ++K V YP+S AV+   PPTP+KK+EF +NS Y+P    E S          
Sbjct: 290 SKVTLVSTLMKGVDYPSSYAVDKIMPPTPAKKVEFILNSLYIPEDLNEQSGTLQGTSTTS 349

Query: 368 SPNG----------------YRAVTGLLSKWRMNHLSRHKACDR---TSTVEPA-----M 403
           S +                 +R+  GLL+KW  NH +RH + +     S ++PA     M
Sbjct: 350 SLDNNSNSNSRSNTSSMSVLHRSAIGLLAKWMKNH-NRHDSSNDKKFMSAIKPANQKPEM 408

Query: 404 DNLIKYVFSISSLESPKGDIQEEREIS--PSKFDILSARTIEEVEHLITVENEVLQKVTA 461
           D  +KYV SISSL       +EE  ++   SKFDILSARTI+EVE L+ ++N++++KV  
Sbjct: 409 DAFVKYVVSISSLNRKSSKEEEEEFLNSDSSKFDILSARTIDEVESLLHLQNQLIEKVQT 468

Query: 462 H----EGKVPITSSSAREARFPPLLNEAPLLDQAPLG-NGQEYSVIDNLNLYRTVSTIAT 516
           H     G         RE      +++  +L Q     +   +S +DNL+LY+TVS+IA 
Sbjct: 469 HSNNNRGPTVNVDCERREH-----IHDIKILQQNSFKPSNDNFSAMDNLDLYQTVSSIAQ 523

Query: 517 SVIKLTRTASQRQTKVTXXXXXXXXXXXTSLSAFXXXXXXXXXXXXXXXXXYQNSKASLH 576
           SVI LT T +++                 S  A                  Y     S  
Sbjct: 524 SVISLTNTLNKQ-----LQNNESNMQPSPSYDAL-----QRRKVKSLTTAYYNKMHGSYS 573

Query: 577 LRPLASADENAEGSSVQASNPPQVIFHTHALIKTPTDKVFDAKAVEDTSPK--------T 628
              +   D++   S    + P +++FH        TDK  +++A+ + +P+         
Sbjct: 574 AESMRLFDKDNSSSRTDENGPQRLLFH-------ETDKT-NSEAITNMTPRRKNHSQSQK 625

Query: 629 SLVSTQVTDARPPSYESTITYDS--DLQDITM------------RDYNTSNQTENHNDGT 674
           S+ S+ + +  P   ES+   DS  D + IT             RD  T    +  N   
Sbjct: 626 SMTSSPLKNVLPDLKESSPLNDSREDTESITYSYDSELSSSSPPRDTVTKKSRKVRNIVN 685

Query: 675 LDTNQPILNRKTNHSNLREFLFEASTS 701
            +T+ P L  KT   NLREF FE + S
Sbjct: 686 -NTDSPTLKTKTGFLNLREFTFEDTKS 711

>CAGL0E03476g complement(318956..323650) similar to sp|P04821
            Saccharomyces cerevisiae YLR310c CDC25 GDP/GTP exchange
            factor for RAS1P and RAS2P, start by similarity
          Length = 1564

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 97/213 (45%), Gaps = 17/213 (7%)

Query: 1193 ILMYDSCSIAKQMTLIEREVMNEIDWKDLLDLNMKKSLPRVTSWLQLLLHNEELSGIDLA 1252
            +L  D    A Q+TLIE ++         L + M + L R  +W            I   
Sbjct: 1275 LLDIDPYLYAAQLTLIEHDLY--------LRITMFECLDR--AWGNKYCDMGGSPNITRF 1324

Query: 1253 IARFNLTVDWIISELVMTTDIKLRRNAIQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQ 1312
            IA  N   +++   +V   D++ R   IQ  I VA+HC+   N++++  IV AL S  + 
Sbjct: 1325 IANANSLTNYVSFTIVKHADVQKRAKLIQYFITVAQHCKELNNFSSMTAIVSALYSSPIY 1384

Query: 1313 KFTSSWRLIEPADMLTWEHLKSIPSLDRNYHNVRNLLNSIDPIKGCIPFLVVYLSDL--- 1369
            +   +W L+        ++L S+    RN+   R LL S+  +  C+PF  VYLSDL   
Sbjct: 1385 RLKQTWNLVPTETKEVLDNLNSLMDSKRNFIKYRELLRSVKDV-ACVPFFGVYLSDLTFT 1443

Query: 1370 -ALNSEKRDWIVPNEIVNYNKFQTNVQIVKNFI 1401
             A NS+  D     +I+N+ K      I++  +
Sbjct: 1444 FAGNSDYLDG--KTDIINFGKRSKIANIIEGIL 1474

>Kwal_14.2313
          Length = 1517

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 103/230 (44%), Gaps = 25/230 (10%)

Query: 1193 ILMYDSCSIAKQMTLIEREVMNEIDWKDLLDLNMKKSLPRVTSWLQLLLHNEELSGIDLA 1252
            +L  D  + A+Q+T  E  + ++I     LD        R+  W +   +      I   
Sbjct: 1234 LLDIDPQTFARQLTTKEHYLYSKITPFQCLD--------RI--WSKKYCYFGGSEDISKF 1283

Query: 1253 IARFNLTVDWIISELVMTTDIKLRRNAIQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQ 1312
            I+  N   +++   +V  T+ K R    Q  I VAEHC    N++++  IV AL S  + 
Sbjct: 1284 ISSANSLTNYVSFAIVKQTNTKKRARVTQHFISVAEHCYELNNFSSMTAIVSALYSSPIF 1343

Query: 1313 KFTSSWRLIEPADMLTWEHLKSIPSLDRNYHNVRNLLNSIDPIKGCIPFLVVYLSDLALN 1372
            +   SW L+        E+L ++    +N+   RN L +I     C+PF  VYLSDL   
Sbjct: 1344 RLKKSWALVPEESQKVLENLNTLMDPAKNFATYRNWLKTIQDT-ACVPFFGVYLSDLTFI 1402

Query: 1373 SEKRDWIVPN------EIVNYNKFQTNVQIVKNFIQ----RVQWARFYDI 1412
            +E      PN      EI+N++K    V+I+K        R ++ R+ D+
Sbjct: 1403 AEGN----PNYLHRSSEIINFSKRVRIVEILKEIASYQSIRYKFKRYDDV 1448

>YLR310C (CDC25) [3699] chr12 complement(752226..756995)
            Guanine-nucleotide exchange protein for Ras1p and Ras2p,
            has an SH3 domain [4770 bp, 1589 aa]
          Length = 1589

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 104/229 (45%), Gaps = 34/229 (14%)

Query: 1193 ILMYDSCSIAKQMTLIEREVMNEIDWKDLLD-------LNMKKSLPRVTSWLQLLLHNEE 1245
            +L  D  + A Q+T++E ++   I   + LD        NM  S P +T +         
Sbjct: 1301 LLDIDPYTYATQLTVLEHDLYLRITMFECLDRAWGTKYCNMGGS-PNITKF--------- 1350

Query: 1246 LSGIDLAIARFNLTVDWIISELVMTTDIKLRRNAIQRLIHVAEHCRMYQNYNTVMEIVLA 1305
                   IA  N   +++   +V   D+K R    Q  + VA+HC+   N++++  IV A
Sbjct: 1351 -------IANANTLTNFVSHTIVKQADVKTRSKLTQYFVTVAQHCKELNNFSSMTAIVSA 1403

Query: 1306 LNSVVVQKFTSSWRLI--EPADMLTWEHLKSIPSLDRNYHNVRNLLNSIDPIKGCIPFLV 1363
            L S  + +   +W L+  E  D+L  ++L ++    RN+   R LL S+  +  C+PF  
Sbjct: 1404 LYSSPIYRLKKTWDLVSTESKDLL--KNLNNLMDSKRNFVKYRELLRSVTDV-ACVPFFG 1460

Query: 1364 VYLSDLALNSEKRDWIVPN--EIVNYNKFQTNVQIVKNFIQRVQWARFY 1410
            VYLSDL          + N   I+N++K      IV+  I    + RF+
Sbjct: 1461 VYLSDLTFTFVGNPDFLHNSTNIINFSKRTKIANIVEEII---SFKRFH 1506

>Sklu_2189.4 YLR310C, Contig c2189 8340-12920
          Length = 1526

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 101/226 (44%), Gaps = 17/226 (7%)

Query: 1193 ILMYDSCSIAKQMTLIEREVMNEIDWKDLLDLNMKKSLPRVTSWLQLLLHNEELSGIDLA 1252
            +L  DS   AKQ+T+ E  +  +I   + LD           +W     +      I   
Sbjct: 1239 LLDIDSLDYAKQLTIKEHSLFYKISPFECLD----------RTWGNKYCNMGGSKNITEF 1288

Query: 1253 IARFNLTVDWIISELVMTTDIKLRRNAIQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQ 1312
            I+  N   +++   +V  TDIK R   IQ  I+VA HC    N++++  I+ AL S  + 
Sbjct: 1289 ISNSNHLTNYVSFMIVKQTDIKKRIQLIQFFINVAAHCHELNNFSSLTAIISALYSSPIY 1348

Query: 1313 KFTSSWRLIEPADMLTWEHLKSIPSLDRNYHNVRNLLNSIDPIKGCIPFLVVYLSDLALN 1372
            +   +W  +        E L ++    +N+   R LL SI     C+PF  VYLSDL   
Sbjct: 1349 RLKRTWAAVPEEYKKLLEELNTLMDSAKNFIRYRQLLKSIGDFP-CVPFFGVYLSDLTFT 1407

Query: 1373 SEKR-DWIVPNEI-VNYNKFQTNVQIVKNF--IQRVQW--ARFYDI 1412
            +    D++  N + VN+ K    ++I+K     QR  +   R+ DI
Sbjct: 1408 ANGNPDFLHRNTVLVNFGKRVRILEILKEISVYQRSHYKLKRYEDI 1453

>YLL016W (SDC25) [3403] chr12 (112846..115992) Protein of unknown
            function [3147 bp, 1048 aa]
          Length = 1048

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/220 (25%), Positives = 96/220 (43%), Gaps = 21/220 (9%)

Query: 1193 ILMYDSCSIAKQMTLIEREVMNEIDWKDLLDLNMKKSLPRVTSWLQLLLHNEELSGIDLA 1252
            IL  D    A Q+T++E E+  EI   D L    K    +               G++  
Sbjct: 744  ILAVDPVLFATQLTILEHEIYCEITIFDCLQKIWKNKYTKSYG---------ASPGLNEF 794

Query: 1253 IARFNLTVDWIISELVMTTDIKLRRNAIQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQ 1312
            I+  N   ++I   +V   D   R   +   I +AE+CR + N++++  I+ AL S  + 
Sbjct: 795  ISFANKLTNFISYSVVKEADKSKRAKLLSHFIFIAEYCRKFNNFSSMTAIISALYSSPIY 854

Query: 1313 KFTSSWRLIEPADMLTWEHLKSIPSLDRNYHNVRNLLNSIDPIKGCIPFLVVYLSDLAL- 1371
            +   +W+ + P      + L  +    +N+ N RN L S+     C+PF  VYLSDL   
Sbjct: 855  RLEKTWQAVIPQTRDLLQSLNKLMDPKKNFINYRNELKSLHS-APCVPFFGVYLSDLTFT 913

Query: 1372 NSEKRDWIV----------PNEIVNYNKFQTNVQIVKNFI 1401
            +S   D++V            + +N+NK    V I++  I
Sbjct: 914  DSGNPDYLVLEHGLKGVHDEKKYINFNKRSRLVDILQEII 953

>KLLA0D09306g 783852..788465 weakly similar to sp|P04821 Saccharomyces
            cerevisiae YLR310c CDC25 GDP/GTP exchange factor for
            RAS1P and RAS2P, hypothetical start
          Length = 1537

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 85/176 (48%), Gaps = 11/176 (6%)

Query: 1196 YDSCSIAKQMTLIEREVMNEIDWKDLLDLNMKKSLPRVTSWLQLLLHNEELSGIDLAIAR 1255
            +D  + A+Q+TL E  + + ID  + LD        R+  W + +      + I   I  
Sbjct: 1266 FDPITFAQQLTLEEHILYSAIDQFECLD--------RI--WGKKVCDFGGSANISNFITS 1315

Query: 1256 FNLTVDWIISELVMTTDIKLRRNAIQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQKFT 1315
             N   D++   +V  TD+K R   +Q  I V+E C   +N++++  IV AL S  + +  
Sbjct: 1316 SNHLTDFVSYTIVKETDLKKRAQILQFFIQVSEQCYNLKNFSSMTAIVSALYSSPIFRLK 1375

Query: 1316 SSWRLIEPADMLTWEHLKSIPSLDRNYHNVRNLLNSIDPIKGCIPFLVVYLSDLAL 1371
             ++  +    + + + L ++    RN+   R+LL ++  +  C+PF  VYLSDL  
Sbjct: 1376 KTFDRLPKHILNSLDKLNTLMDSTRNFFRYRDLLKTVHDVP-CVPFFGVYLSDLTF 1430

>ADL038W [1703] [Homologous to ScYLR310C (CDC25 ) - SH; ScYLL016W -
            SH] complement(623312..627841) [4530 bp, 1509 aa]
          Length = 1509

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 95/216 (43%), Gaps = 27/216 (12%)

Query: 1201 IAKQMTLIEREVMNEIDWKDLLDLNMKKSL------PRVTSWLQLLLHNEELSGIDLAIA 1254
             AKQ+T+ E  +  +I   + LD   K         P ++S++Q                
Sbjct: 1236 FAKQLTIKENLLYCKIHLFECLDRTWKTRYCDFGGSPNISSFIQ---------------- 1279

Query: 1255 RFNLTVDWIISELVMTTDIKLRRNAIQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQKF 1314
              N   +++   +V  TD+K R   +Q  I VAE CR   N++++  I  A+ S  + + 
Sbjct: 1280 NSNHLTNYVSYMIVKQTDLKRRVQIVQYFIDVAETCRALNNFSSMTAITSAMLSSSIYRL 1339

Query: 1315 TSSWRLIEPADMLTWEHLKSIPSLDRNYHNVRNLLNSIDPIKGCIPFLVVYLSDLALNSE 1374
              +W ++      + + + ++    +N+   R LL S+     C+PF  VYLSDL   + 
Sbjct: 1340 KRTWAMVHDNYKESLDRMNALMDSAKNFRKYRELLESLGDCP-CVPFFGVYLSDLTFTAG 1398

Query: 1375 KR-DWIVPNE-IVNYNKFQTNVQIVKNF--IQRVQW 1406
               D++     ++N+ K    V ++K     QR+ +
Sbjct: 1399 GNPDYLKGTTGVINFAKRARIVNVLKEIDSYQRISY 1434

>Scas_621.1*
          Length = 1323

 Score = 61.2 bits (147), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 104/214 (48%), Gaps = 15/214 (7%)

Query: 1200 SIAKQMTLIEREVMNEIDWKDLLDLNMKKSLPRVTSWLQLLLHNEELSGIDLAIARFNLT 1259
            ++A+Q++L+E E+  +I         + + L RV  W +          I + I   N  
Sbjct: 1086 TMAQQLSLLEHELYCQI--------TIFECLERV--WGKKYGGFGGSPNITIFINGANNL 1135

Query: 1260 VDWIISELVMTTDIKLRRNAIQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQKFTSSWR 1319
             +++   +V   +I  R   I   I VA++CR   N++++  I+ AL S  V +   +W 
Sbjct: 1136 TNFVSYTIVSNANISRRIQIITYFIAVAQYCRDINNFSSMTAIISALYSSPVYRLKKTWH 1195

Query: 1320 LIEPADMLTWEHLKSIPSLDRNYHNVRNLLNSIDPIKGCIPFLVVYLSDLAL-NSEKRDW 1378
            L+  +       L ++    +N+   R LL S+  +  C+PF  VYLSDL   ++   D+
Sbjct: 1196 LVPESSKALLRELNTLMDSTKNFIRYRQLLKSVRQVV-CVPFFGVYLSDLTFAHTGNPDF 1254

Query: 1379 IVPN-EIVNYNKFQTNVQIVKNFI--QRVQWARF 1409
            +  + E++N++K    V+I++  I  +++ +  F
Sbjct: 1255 LSGSTELINFSKRAKVVEIIEEVINFKKLHYTSF 1288

>Scas_604.15
          Length = 1676

 Score = 61.2 bits (147), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 95/220 (43%), Gaps = 16/220 (7%)

Query: 1193 ILMYDSCSIAKQMTLIEREVMNEIDWKDLLDLNMKKSLPRVTSWLQLLLHNEELSGIDLA 1252
            +L  D    A+Q+T+ E E+  EI   + LD           +W     +      I   
Sbjct: 1365 LLDIDPYVYAQQLTIREHELYLEITMFECLD----------RAWGSKYCNMGGSRNISKF 1414

Query: 1253 IARFNLTVDWIISELVMTTDIKLRRNAIQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQ 1312
            I   N   +++   +V   D+K R   IQ  I VAEHC+   N++++  IV AL S  + 
Sbjct: 1415 IMNANSLTNFVSYTIVRHMDVKKRSKLIQYFITVAEHCKDLNNFSSMTAIVSALYSSPIF 1474

Query: 1313 KFTSSWRLIEPADMLTWEHLKSIPSLDRNYHNVRNLLNSIDPIKGCIPFLVVYLSDLALN 1372
            +   +W  I      + + L S+    RN+   R  L  +  +   IPF  +YLSDL   
Sbjct: 1475 RLKKTWSKIPVEIKKSLKKLNSLMDSKRNFIKYRESLKLVKDVPR-IPFFGIYLSDLTFT 1533

Query: 1373 SEKRDWIV--PNEIVNYNKFQTNVQIVKNFIQRVQWARFY 1410
                   +    +I+N++K    V I+++ +    + RF+
Sbjct: 1534 FVGNPEFLHGTTDIINFSKRSRIVDIIEDIL---SFKRFH 1570

>Kwal_33.13598
          Length = 1412

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 97/216 (44%), Gaps = 29/216 (13%)

Query: 1201 IAKQMTLIEREVMNEIDWKDLLDLNMKKSLPRVTSWLQLLLHNEELSGIDLAIARFNLTV 1260
            +AKQ++LIE  +   +   +L++ N    +P+         H      ++  I   NL  
Sbjct: 1126 VAKQLSLIESTLYLAVGPGELMNQNF---IPKKK-------HLSASPDVERIIDFANLLS 1175

Query: 1261 DWIISELVMTT-DIKLRRNAIQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQKFTSSWR 1319
            +++I  +V +   +K+R + +   +++A     ++N+NTV  I+ AL S ++ +    W 
Sbjct: 1176 NYVIESIVASKLTLKVRASRLTAWLNIALSALYFRNFNTVATIMTALQSHILSRVELVWE 1235

Query: 1320 LIEPADMLTWEHLKSIPSLDRNYHNVRNLLNSID-----PIKG-------CIPFLVVYLS 1367
             I    +  +++L  I   D+NY   R  L  +      P  G        +PF  ++L 
Sbjct: 1236 NISEKYLELYKYLSKIIHPDKNYSIYRLKLRELATGFSIPESGGNRSPIPIVPFFALFLQ 1295

Query: 1368 DLALNSEK----RD--WIVPNEIVNYNKFQTNVQIV 1397
            DL    E     RD     PN+++N +KF    +I+
Sbjct: 1296 DLTFIHEGIHDFRDPSSFRPNKLINIDKFFRTTKII 1331

>CAGL0D06512g complement(617453..621379) some similarities with
            sp|P04821 Saccharomyces cerevisiae YLR310c CDC25 or
            sp|P14771 Saccharomyces cerevisiae YLL016w SDC25,
            hypothetical start
          Length = 1308

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 86/210 (40%), Gaps = 19/210 (9%)

Query: 1169 ELLETYKLQDPRLNIKNVEHHVPFIL-MYDSC------SIAKQMTLIEREVMNEIDWKDL 1221
            E+LE Y     R+   N+ H   F   +Y+S       ++A+Q+ LIE  +  +I   D 
Sbjct: 958  EILE-YNNDLKRIGFSNLVHDAKFTANVYESILDIPAENVAQQLALIEENLYEKITIFDC 1016

Query: 1222 LDLNMKKSLPRVTSWLQLLLHNEELSGIDLAIARFNLTVDWIISELVMTTDIKLRRNAIQ 1281
            LD        RV    Q      +   I   I+  N    ++  +++       R  AI 
Sbjct: 1017 LD--------RVWGCKQCDFGGSK--NISEFISFANSITKYVSYKILQYDTAAKRGQAIG 1066

Query: 1282 RLIHVAEHCRMYQNYNTVMEIVLALNSVVVQKFTSSWRLIEPADMLTWEHLKSIPSLDRN 1341
              I VA       N++++  I+  + +  V +   SW+L+      T   L  +    +N
Sbjct: 1067 YFIKVARISYEINNFSSMTAIISGIYASPVNRLHESWKLVSRELQNTLRELDDLMISTKN 1126

Query: 1342 YHNVRNLLNSIDPIKGCIPFLVVYLSDLAL 1371
            +   R  L ++   + CIPF  VYLSDL  
Sbjct: 1127 FLKYRLTLKNVGN-RPCIPFFGVYLSDLLF 1155

>KLLA0C03410g 303739..307821 weakly similar to ca|CA0382|IPF16030
            Candida albicans, hypothetical start
          Length = 1360

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/211 (20%), Positives = 92/211 (43%), Gaps = 32/211 (15%)

Query: 1201 IAKQMTLIEREVMNEIDWKDLLDLNMKKSLPRVTSWLQLLLHNEELSGIDLAIARFNLTV 1260
            ++KQ++LIE  +  +I   +LL        P ++          +   ++  I   NL  
Sbjct: 1076 VSKQISLIESTIFLKITPPELLKCKYSSKNPDLS----------KSPNVNSIITLTNLLS 1125

Query: 1261 DWIISELVMTTDIKLRRNA--IQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQKFTSSW 1318
            ++++  ++M   I L++ A  I+  + +A     ++N+N +  I+  L S V+ + +  W
Sbjct: 1126 NYVLESILMP-GIPLKKRALRIKSWLRIALSSLYFRNFNALASIMTTLQSYVISRLSMLW 1184

Query: 1319 RLIEPADMLTWEHLKSIPSLDRNYHNVRNLLNSI-------------DPIKGCIPFLVVY 1365
             ++   D+  +E+L  I   + NY   R  +  +               +   +PF  ++
Sbjct: 1185 GMLSNEDVELFEYLSKIIHPNNNYKVYRKKIEKLVTESSSSSGLLSSKSVLPVVPFFNLF 1244

Query: 1366 LSDLAL------NSEKRDWIVPNEIVNYNKF 1390
            L DL        N +  D   PN+++N +K+
Sbjct: 1245 LQDLTFIDEGNPNFKNPDSFRPNKLINIDKY 1275

>CAGL0B01287g 114832..118575 similar to KLLA0C03410g Kluyveromyces
            lactis, hypothetical start
          Length = 1247

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 63/140 (45%), Gaps = 18/140 (12%)

Query: 1276 RRNAIQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQKFTSSWRLIEPADMLTWEHLKSI 1335
            R   ++  + +A      +N+N+V  I+ A+ +  + + T  W+ +   D L +E+L  I
Sbjct: 1031 RTTILKAWLRIALSALYLRNFNSVASIMTAIQNHSITRLTGVWQQLSRKDTLLYEYLSRI 1090

Query: 1336 PSLDRNYHNVRNLL---------NSIDPIKG---CIPFLVVYLSDLAL----NSEKR--D 1377
               + N+   R  L          SI P+K     +PF  ++L D+      NS  R  D
Sbjct: 1091 IHPNHNFKVYRQKLKKIIDDSSQGSIIPVKSHVPVVPFFNLFLQDITFIHEGNSTFRNPD 1150

Query: 1378 WIVPNEIVNYNKFQTNVQIV 1397
               PN+ +N +KF    +IV
Sbjct: 1151 SFRPNKPINVDKFYRITKIV 1170

>Scas_476.2
          Length = 1330

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/275 (20%), Positives = 121/275 (44%), Gaps = 45/275 (16%)

Query: 1144 DIFSSATEDTSSEEQSPKLSDREIRELLETY------KLQDPRLNIKNVEHHVPFILMYD 1197
            D +   T  T +E  S +  + + +++++ +          PR +   +++ V F    +
Sbjct: 989  DFYKQITNKTKAETNSLRNINLQTKDIIDNWIRITIGTTLTPRFDKLQIKNLVSF----N 1044

Query: 1198 SCSIAKQMTLIEREVMNEIDWKDLLDLNM--KKSLPRVTSWLQLLLHNEELSGIDLAIAR 1255
            +   AKQ+TL+E  +  E+   +L++ N   KK L  ++              I+  +  
Sbjct: 1045 ALEAAKQLTLLESTLYMEVQPFELINENFLQKKKLLNLS------------PNINATLNF 1092

Query: 1256 FNLTVDWIISELVMTTDIKL--RRNAIQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQK 1313
             N   ++++ E ++T ++ +  R + ++  + +A     ++NYN++  I++AL S  + +
Sbjct: 1093 TNQFTNYVL-ESILTPNLSIPKRCSRLKGWLRIALSTLYFRNYNSLASIMIALQSHSLSR 1151

Query: 1314 FTSSWRLIEPADMLTWEHLKSIPSLDRNYHNVRNLL------NSIDPIKG------CIPF 1361
                W  +   D+  ++ L  I   + NY   R  L      N+  P+         +PF
Sbjct: 1152 LYFLWEDLTEKDIKLYDFLCQIIHPNNNYRVYREKLRILKSGNNQAPLSLSKSPLPIVPF 1211

Query: 1362 LVVYLSDLALNSEKR------DWIVPNEIVNYNKF 1390
              ++L DL   +E        D   PN+I+N +KF
Sbjct: 1212 FNLFLQDLTFINEGLPDYRNPDSFRPNKIINMDKF 1246

>Sklu_2300.3 YCR038C, Contig c2300 4973-6405 reverse complement
          Length = 478

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 77/170 (45%), Gaps = 11/170 (6%)

Query: 1184 KNVEHHVPFILMYDSCSIAKQMTLIEREVMNEIDWKDLLDLNMKKSLPRVTSWLQLLLHN 1243
            +N+ H+   +   +   ++KQ++LIE ++   I   +LL  N    +P+         H 
Sbjct: 288  RNLVHNDLNLAELNPLEVSKQLSLIESKLFLSITASELLHENF---MPKKA-------HL 337

Query: 1244 EELSGIDLAIARFNLTVDWIISELVM-TTDIKLRRNAIQRLIHVAEHCRMYQNYNTVMEI 1302
             + S +   ++  NL   +++  +V      K R   ++  + +A     ++N+N+V  I
Sbjct: 338  HQASNVGAILSFTNLLSRYVVESIVGPGFGPKKRTGRLRSWMKIALSALYFRNFNSVAAI 397

Query: 1303 VLALNSVVVQKFTSSWRLIEPADMLTWEHLKSIPSLDRNYHNVRNLLNSI 1352
            + AL S VV + +  W  +   D   +E+L  I   + NY   RN L  +
Sbjct: 398  MTALQSHVVSRLSPLWSSLSSKDTELFEYLSKIVHPNNNYKVYRNKLKKL 447

>Scas_433.1
          Length = 1167

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 59/143 (41%), Gaps = 18/143 (12%)

Query: 1027 DADLALIISKLKETNPSAERIETENPNDDANNLTPPATSSSNNENSSD-PVAVALMKLEG 1085
            D  L L +  L ETNP ++      P+  A  L P    S N EN     + ++  K+EG
Sbjct: 169  DDFLLLAVQPLTETNPISKSSIVNTPSRSA--LVPETLISLNLENGQYLQLIISYQKIEG 226

Query: 1086 TFAKPAKEDNTASKLNSPRSSVLAKEVEKLDFQKW--RFPSSKTMNKRQSMFIERRRTMT 1143
            T +K         ++ SP   +L K    L  QK       SK +N+       +R T+ 
Sbjct: 227  TRSK-------VIRIYSPYI-ILNKTDRDLYLQKGLSNVIQSKVLNQEG-----KRYTLP 273

Query: 1144 DIFSSATEDTSSEEQSPKLSDRE 1166
             +FS  T DT +     K  D E
Sbjct: 274  KMFSFETVDTKNNRACIKFKDTE 296

>Scas_675.32
          Length = 624

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 953  NPYSGQCTTIEDRYRRSRFASQPDSLLGYINENGN----KYIFSPGETAEDAS 1001
            NPYS   T+I  R  RS+     + +LG +N++ +     Y  +PG TA ++S
Sbjct: 290  NPYSNLTTSIVPRKERSKVKRLKNKILGSLNQSTSSTPTHYYQAPGATATNSS 342

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.129    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 44,826,421
Number of extensions: 1984783
Number of successful extensions: 7071
Number of sequences better than 10.0: 176
Number of HSP's gapped: 7261
Number of HSP's successfully gapped: 222
Length of query: 1412
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1298
Effective length of database: 12,649,657
Effective search space: 16419254786
Effective search space used: 16419254786
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)