Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR291C68467126510.0
KLLA0A04103g7855379371e-116
YOR322C8185598771e-106
CAGL0F00737g7956518691e-105
Scas_643.24d7845498225e-99
Kwal_26.7100178371284e-08
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR291C
         (671 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR291C [1338] [Homologous to ScYOR322C - SH] (888927..890981) [...  1025   0.0  
KLLA0A04103g 369258..371615 similar to sgd|S0005849 Saccharomyce...   365   e-116
YOR322C (YOR322C) [5104] chr15 complement(918601..921057) Protei...   342   e-106
CAGL0F00737g 82773..85160 similar to tr|Q12502 Saccharomyces cer...   339   e-105
Scas_643.24d                                                          321   5e-99
Kwal_26.7100                                                           54   4e-08

>ACR291C [1338] [Homologous to ScYOR322C - SH] (888927..890981)
           [2055 bp, 684 aa]
          Length = 684

 Score = 1025 bits (2651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/671 (78%), Positives = 526/671 (78%)

Query: 1   MVFPRLVATGRRGSAGGSDHVVELGLEIESPPCVLYGPPTESAGALLSGLVTVHXXXXXX 60
           MVFPRLVATGRRGSAGGSDHVVELGLEIESPPCVLYGPPTESAGALLSGLVTVH      
Sbjct: 1   MVFPRLVATGRRGSAGGSDHVVELGLEIESPPCVLYGPPTESAGALLSGLVTVHVQGAGA 60

Query: 61  XXXXXXXXRLTLVLEQQVTYGRPFVAGPLGSXXXXXXXXXXXXXWEVVAQAAELAGGRHA 120
                   RLTLVLEQQVTYGRPFVAGPLGS             WEVVAQAAELAGGRHA
Sbjct: 61  EAGGCVVARLTLVLEQQVTYGRPFVAGPLGSCAACRERRRELARWEVVAQAAELAGGRHA 120

Query: 121 YPFSHLLAGELPATSTLGSAGATQIRYELVADAXXXXXXXXXXXXXXXXXXXXXXSILRG 180
           YPFSHLLAGELPATSTLGSAGATQIRYELVADA                      SILRG
Sbjct: 121 YPFSHLLAGELPATSTLGSAGATQIRYELVADAVYRAGGGEERRRELRLPVLVTRSILRG 180

Query: 181 PDRNSLRVFPPTDVTATAVLPSVIYPRSTIPLELQLGGVCCADXXXXXXXXXXXIDEKXX 240
           PDRNSLRVFPPTDVTATAVLPSVIYPRSTIPLELQLGGVCCAD           IDEK  
Sbjct: 181 PDRNSLRVFPPTDVTATAVLPSVIYPRSTIPLELQLGGVCCADRRWRMRRLTWRIDEKVR 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXKTARNLKKPAKPIKRTPDMGPQVTVSVATVEDPLPFDA 300
                                 KTARNLKKPAKPIKRTPDMGPQVTVSVATVEDPLPFDA
Sbjct: 241 VRSHACAAHRARLRALEEEVRAKTARNLKKPAKPIKRTPDMGPQVTVSVATVEDPLPFDA 300

Query: 301 GSAAARQEADVGNMDDDADTQSAFIHPSDHAMXXXXXXXXXXXXXXXXXXXXXXXTSHYI 360
           GSAAARQEADVGNMDDDADTQSAFIHPSDHAM                       TSHYI
Sbjct: 301 GSAAARQEADVGNMDDDADTQSAFIHPSDHAMQQELQELQARIRQQQLEEERKQETSHYI 360

Query: 361 EEVRTIAGTDIRSGWKSDFSGSGKIELVMEIDCMKLNSGVTNPVNMVSTTSPYLARGQAP 420
           EEVRTIAGTDIRSGWKSDFSGSGKIELVMEIDCMKLNSGVTNPVNMVSTTSPYLARGQAP
Sbjct: 361 EEVRTIAGTDIRSGWKSDFSGSGKIELVMEIDCMKLNSGVTNPVNMVSTTSPYLARGQAP 420

Query: 421 VNVTCDVEDPTLGISVNHLLLVEIIVAEEMLHYTNGQLLSKXXXXXXXXXXXXXXXXXKP 480
           VNVTCDVEDPTLGISVNHLLLVEIIVAEEMLHYTNGQLLSK                 KP
Sbjct: 421 VNVTCDVEDPTLGISVNHLLLVEIIVAEEMLHYTNGQLLSKGEAQGEGEGQGEALAEAKP 480

Query: 481 AGLAGSHADQRLAELSPMFANRNNSMFRASAEEHSPGLEPDGSTAGADKRIVGTPTGAAR 540
           AGLAGSHADQRLAELSPMFANRNNSMFRASAEEHSPGLEPDGSTAGADKRIVGTPTGAAR
Sbjct: 481 AGLAGSHADQRLAELSPMFANRNNSMFRASAEEHSPGLEPDGSTAGADKRIVGTPTGAAR 540

Query: 541 VLRMQFKLTMTERSGLGISWDDEVPPKYQQVKFLYPPSYDEXXXXXXXXXXXXXXXXXXX 600
           VLRMQFKLTMTERSGLGISWDDEVPPKYQQVKFLYPPSYDE                   
Sbjct: 541 VLRMQFKLTMTERSGLGISWDDEVPPKYQQVKFLYPPSYDEAVSASVSEVSGSSRVVSGP 600

Query: 601 XXNPAVRAPVAASPTQPPAVREGPSSLGTSGSAARDMMFISESSTLCIGGESPSALPAVE 660
             NPAVRAPVAASPTQPPAVREGPSSLGTSGSAARDMMFISESSTLCIGGESPSALPAVE
Sbjct: 601 ESNPAVRAPVAASPTQPPAVREGPSSLGTSGSAARDMMFISESSTLCIGGESPSALPAVE 660

Query: 661 DASLGHRVCVR 671
           DASLGHRVCVR
Sbjct: 661 DASLGHRVCVR 671

>KLLA0A04103g 369258..371615 similar to sgd|S0005849 Saccharomyces
           cerevisiae YOR322c, hypothetical start
          Length = 785

 Score =  365 bits (937), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 218/537 (40%), Positives = 283/537 (52%), Gaps = 46/537 (8%)

Query: 72  LVLEQQVTYGRPF--VAGPLGSXXXXXXXXXXXXXWEVVAQAAELAGGRHAYPFSHLLAG 129
           L L Q+V Y +PF   A  L +             W ++ +  ELA G+H++PFSHL+ G
Sbjct: 144 LSLIQKVHYEKPFRPSAAVLNTCTNCKTKITEFHRWTIMNKPTELAVGQHSFPFSHLIPG 203

Query: 130 ELPATSTLGSAGATQIRYELVADAXXX-----XXXXXXXXXXXXXXXXXXXSILRGPDRN 184
            LP T+ LGS   + I+YEL+A A                           SILRG D+ 
Sbjct: 204 NLPPTTHLGSNSHSTIKYELIAVATYKHPFKGKGESAKRVLQLNLPISITRSILRGSDKT 263

Query: 185 SLRVFPPTDVTATAVLPSVIYPRSTIPLELQLGGVCCADXXXXXXXXXXXIDEKXXXXXX 244
           SLRVFPPT++TA AVLP+V+YP+ST  +EL+L G+C  D           I+EK      
Sbjct: 264 SLRVFPPTELTANAVLPNVVYPKSTFSMELKLDGICSDDRRWRMRKLNWRIEEKVKVRAH 323

Query: 245 --XXXXXXXXXXXXXXXXXXKTARNLKKPAKPIKRTPDMGPQVTVSVATVEDPLPFDAGS 302
                               +  R ++K +KPIKR+ DMGPQV ++V T  D L     S
Sbjct: 324 GCQAHKAKLKQLEEKVKQDEERDRQIRKSSKPIKRSVDMGPQVKMTVNTFHDVL-LQQLS 382

Query: 303 AAARQEADVGNMDDDA-----------------DTQSAFIHPSDHAMXXXXXXXXXXXXX 345
            A  +  DV N +D                   DT + FIHP+D AM             
Sbjct: 383 RANTEAEDVDNPEDTTTAPSDEALRDEDHDTIPDTPTDFIHPNDDAMRQEIMQQQQRVRQ 442

Query: 346 XXXXXXXXXXTSHYIEEVRTIAGTDIRSGWKSDFSGSGKIELVMEIDCMKLNSGVTNPVN 405
                     ++ Y EEVRTIA  +I+SGWKSDFS  G IELV +IDCM+LNSGVTNP++
Sbjct: 443 QQIEEELKQESALYTEEVRTIANGEIKSGWKSDFSDKGTIELVTDIDCMRLNSGVTNPIS 502

Query: 406 MVSTTSPYLARGQAPVNVTCDVEDPTLGISVNHLLLVEIIVAEEMLHYTNGQLLSKXXXX 465
             ST +P +   Q  VNV+CD+ED  LG+ V+HLL VE+IVAEE L   NG   S+    
Sbjct: 503 HASTRNPCVLPNQDNVNVSCDMEDTNLGVYVSHLLFVEVIVAEEQLQNVNGGNRSR---- 558

Query: 466 XXXXXXXXXXXXXKPAGLAGSHADQRLAELSPMFANRNNSMFRASAEEHSPGLEPD-GST 524
                        K A    ++ADQRLAELSP+FA+R N        +  P ++   G+ 
Sbjct: 559 ----TGSTVSDTSKTASKPKNNADQRLAELSPIFADREN--------KPQPVIDNQPGNN 606

Query: 525 AGADKRIVGTPTGAARVLRMQFKLTMTERSGLGISWDDEVPPKYQQVKFLYPPSYDE 581
            G   +IVG PTGAARVLRMQF++ MTERSGLGISWDDEVPP YQ ++ L PP Y +
Sbjct: 607 VGP--KIVGVPTGAARVLRMQFRVIMTERSGLGISWDDEVPPAYQDIRMLTPPRYQD 661

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (82%)

Query: 19 DHVVELGLEIESPPCVLYGPPTESAGALLSGLVTV 53
          DH +EL + IESPPCVLYG  TES+GALL GL+TV
Sbjct: 28 DHPIELSINIESPPCVLYGSATESSGALLGGLLTV 62

>YOR322C (YOR322C) [5104] chr15 complement(918601..921057) Protein
           of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.578p [2457 bp, 818 aa]
          Length = 818

 Score =  342 bits (877), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 209/559 (37%), Positives = 282/559 (50%), Gaps = 57/559 (10%)

Query: 70  LTLVLEQQVTYGRPFVAG--PLGSXXXXXXXXXXXXXWEVVAQAAELAGGRHAYPFSHLL 127
           +TL L Q++ + +PFV     + +             WE+ +   +L+ G H+YPFS+L+
Sbjct: 144 VTLSLVQKIHFHKPFVPNISSMQTCMNCKTKITNMKSWEIQSNTQDLSVGSHSYPFSYLI 203

Query: 128 AGELPATSTLGSAGATQIRYELVA-----------------DAXXXXXXXXXXXXXXXXX 170
            G +P +S+LG+   TQ++YEL+A                                    
Sbjct: 204 PGSVPCSSSLGATAETQVKYELIAVVTYIDPHRNSFSSGHSTPRKEGSSSKKRLLQLAMP 263

Query: 171 XXXXXSILRGPDRNSLRVFPPTDVTATAVLPSVIYPRSTIPLELQLGGVCCADXXXXXXX 230
                SI RGPD+NSLRVFPPT++TA AVLP+V+YP+ST PLE++L GV   D       
Sbjct: 264 IAVTRSIPRGPDKNSLRVFPPTELTAAAVLPNVVYPKSTFPLEMKLDGVSSGDRRWRMRK 323

Query: 231 XXXXIDEKXXXXXXXXXXXXXXXXXXXXXXXXKTARNLKKPAKPIKRTPDMGPQVTVSVA 290
               I+E                         K +   KKP   IKR  ++GPQ+ V+V 
Sbjct: 324 LSWRIEETTRVKAHACPVHKHELRQLEEQVKIKESEKSKKPRSHIKRYGELGPQIRVAVN 383

Query: 291 TVED----PLPFDAGSAAARQE---ADVGNM--------DDDADTQ--SAFIHPSDHAMX 333
           ++E+     LP + G   A      A  GN+        ++D + Q  S FIHPSD A+ 
Sbjct: 384 SLENMPSQRLPGEPGREQAPNSSGPASTGNVGLDDENPVNEDEEDQPGSEFIHPSDDALR 443

Query: 334 XXXXXXXXXXXXXXXXXXXXXXTSHYIEEVRTIAGTDIRSGWKSDFSGSGKIELVMEIDC 393
                                 +S + EEVR I+  +++SGWK+DF  +GKIELV EIDC
Sbjct: 444 QELLMQQQRARQQQLQQELKNNSSLFTEEVRIISKGEMKSGWKTDFDNNGKIELVTEIDC 503

Query: 394 MKLNSGVTNPVNMVST-TSPYLARGQAPVNVTCDVEDPTLGISVNHLLLVEIIVAEEMLH 452
           M LNSGV+NPV   ST  +P     +  +NV CD++DP LG+ V+H+L VEI+VAEE L 
Sbjct: 504 MGLNSGVSNPVMHASTLQTPSTGNKKPSINVACDIQDPNLGLYVSHILAVEIVVAEETLQ 563

Query: 453 YTNGQLLSKXXXXXXXXXXXXXXXXXKPAGLAGSHADQRLAELSPMFANRNNSMFR---- 508
           Y NGQ + K                  P        DQRLAELSP+FANRN    R    
Sbjct: 564 YANGQPIRKPNSKNKKETNNNTMNVHNP--------DQRLAELSPIFANRNTPKVRRMGP 615

Query: 509 -------ASAEEHSPGLEPDGSTAGADKRIVGTPTGAARVLRMQFKLTMTERSGLGISWD 561
                  ++   HS   E   S   ++  IV  PTGAARVLRMQF+LT+TERSGLGISWD
Sbjct: 616 EDITPVNSNKSNHSTNKE-KASNGASNSNIVSVPTGAARVLRMQFRLTVTERSGLGISWD 674

Query: 562 DEVPPKYQQVKFLYPPSYD 580
           +EVPP YQ V+ L PP Y+
Sbjct: 675 EEVPPIYQDVELLSPPCYE 693

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 36/60 (60%), Gaps = 7/60 (11%)

Query: 1  MVFPRLVATGRRGSAGGSDHV-------VELGLEIESPPCVLYGPPTESAGALLSGLVTV 53
          M F RL +T +    G S+         + L +++ESPPCVLYG   ES+GA+LSGL TV
Sbjct: 1  MAFSRLTSTHQSNHNGYSNSNKKGQSLPLTLSIDVESPPCVLYGSAMESSGAVLSGLFTV 60

>CAGL0F00737g 82773..85160 similar to tr|Q12502 Saccharomyces
           cerevisiae YOR322c, hypothetical start
          Length = 795

 Score =  339 bits (869), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 220/651 (33%), Positives = 307/651 (47%), Gaps = 100/651 (15%)

Query: 22  VELGLEIESPPCVLYGPPTESAGALLSGLVTV----------------------HXXXXX 59
           ++L L +ESPPCVLYG  T+SAGA+L G   +                      +     
Sbjct: 57  IDLELNLESPPCVLYGSATDSAGAVLCGQFVLRVKDPQSENFIYSVDNQEHGGRNATQHE 116

Query: 60  XXXXXXXXXRLTLVLEQQVTYGRPFV------------------AGPLGSXXXXXXXXXX 101
                     + L   Q+VTY +PF+                   G + +          
Sbjct: 117 TGYNNITITSVHLKFVQKVTYNKPFIPDSSISASSTALQLPANATGNIINCKNCKVKYTS 176

Query: 102 XXXWEVVAQAAELAGGRHAYPFSHLLAGELPATSTLGSAGATQIRYELVADAXXXXXXXX 161
              W + +    +  G+HAYPFS+L+ G +P+TS LG +  T+I+YELV +         
Sbjct: 177 LKSWNIQSTKKLITIGKHAYPFSYLVPGSVPSTSALGLSANTKIQYELVGNVSYYDPVHK 236

Query: 162 XXXXXXXXXXX--XXXSILRGPDRNSLRVFPPTDVTATAVLPSVIYPRSTIPLELQLGGV 219
                           SI RGPD+NSLRVFPPT +TA AVLP+V+YP+ST PLE++L G+
Sbjct: 237 DKEYMLNIKMPIPVTRSIHRGPDKNSLRVFPPTQLTAAAVLPNVVYPKSTFPLEMKLNGI 296

Query: 220 CC------ADXXXXXXXXXXXIDEKXXXXXXXXXXXXXXXXXXXXXXXXKTARNLKKPAK 273
                   +D           ++E                         K     KKP  
Sbjct: 297 SSPSTGKGSDKRWRMRKLAWRVEETTRVKTNVCTQHKPDLKKLEDQVKLKEEERSKKPPV 356

Query: 274 PIKRTPDMGPQVTVSVATVEDPLPFDAGSAA-----------------ARQEADVGNMD- 315
           PIKR  D+GPQ+ +++++  + +P   G +                  + +E + GN+D 
Sbjct: 357 PIKRYGDIGPQIRIALSSPSN-MPLSGGRSGPQPTLTSSEEAPNSATLSSREGEAGNIDT 415

Query: 316 DDADTQSAFIHPSDHAMXXXXXXXXXXXXXXXXXXXXXXXTSHYIEEVRTIAGTDIRSGW 375
           D+ +T   F+HPSD AM                       ++ + EEVR I+  +++SGW
Sbjct: 416 DENETTDQFVHPSDDAMRQELLQQQQRQREQQLKQELKNSSALFSEEVRIISKGEMKSGW 475

Query: 376 KSDF-SGSGKIELVMEIDCMKLNSGVTNPVNMVSTTSPYLARGQAP-VNVTCDVEDPTLG 433
           K+DF S +GK+ELV +ID +  NSGV+NP+   STT PY  +   P V + CD++DP LG
Sbjct: 476 KTDFDSDNGKVELVTDIDLLHSNSGVSNPIMHTSTTHPYKKKPDLPPVTIACDIQDPNLG 535

Query: 434 ISVNHLLLVEIIVAEEMLHYTNGQLLSKXXXXXXXXXXXXXXXXXKPAGLAGS------- 486
           I VNH L +EI+VAEE L Y NGQ +                   KP G   +       
Sbjct: 536 IYVNHTLAIEIVVAEEALQYANGQPIRNGGSRRSSVIPEGS----KPEGTTENMNDDDDD 591

Query: 487 --HADQRLAELSPMFANRNNSMFRASAEEHSPGLEP--------DGSTAG-------ADK 529
               DQRL ELSPMFANRN    RA   E++  L P         G+  G       +  
Sbjct: 592 SREMDQRLLELSPMFANRNAQ--RAKPVEYN-DLSPVNSRSSTRSGNNTGRITPHMSSTP 648

Query: 530 RIVGTPTGAARVLRMQFKLTMTERSGLGISWDDEVPPKYQQVKFLYPPSYD 580
           RIV  PTGAARVLRMQF++ +TERSGLGISWD+EVPP Y +++   PPSY+
Sbjct: 649 RIVSVPTGAARVLRMQFRINVTERSGLGISWDEEVPPMYHEIQTNAPPSYE 699

>Scas_643.24d
          Length = 784

 Score =  321 bits (822), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 204/549 (37%), Positives = 271/549 (49%), Gaps = 65/549 (11%)

Query: 70  LTLVLEQQVTYGRPFV--AGPLGSXXXXXXXXXXXXXWEVVAQAAELAGGRHAYPFSHLL 127
           ++L   Q++ + +PF      + S             W +     +   G H YPFS+L+
Sbjct: 246 VSLTFVQKIHFHKPFTPDTSSIQSCTNCRTKLTDMKSWPIQKAPQDKPVGAHTYPFSYLI 305

Query: 128 AGELPATSTLGSAGATQIRYELVADAXXXXXXXXXXXXXXXXX------XXXXXSILRGP 181
            G +P+TS LGS   TQI+YEL+A A                            SI RGP
Sbjct: 306 PGSVPSTSYLGSNAETQIKYELIAVATYKEPTRRHDVKSKEKMLRLVMPVAVTRSIPRGP 365

Query: 182 DRNSLRVFPPTDVTATAVLPSVIYPRSTIPLELQLGGVCCADXXXXXXXXXXXIDEKXXX 241
           D+NSLRVFPPT++TA AVLP+VIYP+ST PLE++L GV   D           ++E    
Sbjct: 366 DKNSLRVFPPTELTAAAVLPNVIYPKSTFPLEMKLDGVSLQDRRWRMRKLSWRVEETTRV 425

Query: 242 XXXXXXXXXXXXXXXXXXXXXKTARNLKKPAKPIKRTPDMGPQVTVSVATVED-PL---- 296
                                +     KKP + IKR  D+GPQV V+V++ E+ PL    
Sbjct: 426 RSYACKVHQHELRKLEKHVKEREIERNKKPMQQIKRYGDIGPQVRVAVSSPENLPLQRLR 485

Query: 297 ------------------PFDAGSAAARQEADVGNMDDDADTQ-----SAFIHPSDHAMX 333
                             P D  +++        ++ +D D Q       FIHPSD A+ 
Sbjct: 486 NHGDLNSNSSRNNPSMRTPQDGSASSGNGHNGSNDIPEDRDDQDDVSVDEFIHPSDDALR 545

Query: 334 XXXXXXXXXXXXXXXXXXXXXXTSH-YIEEVRTIAGTDIRSGWKSDFSGSGKIELVMEID 392
                                  S  + EEVR IA  D++SGWK+DF  +GKIELV EID
Sbjct: 546 QELLQQQQRLREQQLQQEIAKNDSTLFTEEVRIIAKGDMKSGWKTDFENNGKIELVTEID 605

Query: 393 CMKLNSGVTNPVNMVSTTSPYLARGQAPVNVTCDVEDPTLGISVNHLLLVEIIVAEEMLH 452
           CM LNSGV NPV MVST+ P++   +   N++CD++DP LGI VNH+L VEI+VAEE L 
Sbjct: 606 CMPLNSGVGNPVTMVSTSKPHINSHKQDANISCDIQDPNLGIYVNHILAVEIVVAEETLQ 665

Query: 453 YTNGQLLSKXXXXXXXXXXXXXXXXXKPAGLAGSHADQRLAELSPMFANR---------N 503
           Y+NGQ +                     +  +GS ADQRLAELSPMFANR         N
Sbjct: 666 YSNGQPIRSKSRSDKSKN----------SSNSGSSADQRLAELSPMFANRNAPRTRPVSN 715

Query: 504 NSMF----RASAEEHSPGLEPDGSTAGA-----DKRIVGTPTGAARVLRMQFKLTMTERS 554
           NS+     R +  E S G   + ++  A       ++V  PTGAARVLRMQF+L +TERS
Sbjct: 716 NSITPVNSRTTNGETSSGNNDENNSENAGLPINSSKVVSVPTGAARVLRMQFRLNVTERS 775

Query: 555 GLGISWDDE 563
           GLGISWD+E
Sbjct: 776 GLGISWDEE 784

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 30/38 (78%)

Query: 17  GSDHVVELGLEIESPPCVLYGPPTESAGALLSGLVTVH 54
            ++H +EL + +ESPPCVLYG   +S G+LLSG+VT++
Sbjct: 125 ATEHPIELSINVESPPCVLYGSAADSTGSLLSGVVTLN 162

>Kwal_26.7100
          Length = 178

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/37 (67%), Positives = 30/37 (81%)

Query: 18 SDHVVELGLEIESPPCVLYGPPTESAGALLSGLVTVH 54
          +D +VEL ++IESPPCVLYG  TES GALLSGL+ V 
Sbjct: 29 NDGLVELLIDIESPPCVLYGTATESTGALLSGLLKVR 65

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,943,421
Number of extensions: 514860
Number of successful extensions: 847
Number of sequences better than 10.0: 6
Number of HSP's gapped: 826
Number of HSP's successfully gapped: 11
Length of query: 671
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 563
Effective length of database: 12,857,365
Effective search space: 7238696495
Effective search space used: 7238696495
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)