Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR290W75574139990.0
Kwal_26.710574073027610.0
YAL023C (PMT2)75973827180.0
KLLA0F15829g74171427170.0
Scas_505.275273425680.0
CAGL0J08734g74273025580.0
Scas_643.2476974424220.0
YOR321W (PMT3)75371024000.0
CAGL0F00759g73472120000.0
Kwal_33.1547175571118080.0
KLLA0F21978g75771616730.0
YGR199W (PMT6)75974816650.0
CAGL0K00979g73072315150.0
Scas_408.1*3913268721e-110
Kwal_23.36238767029021e-109
CAGL0L07216g8587098971e-108
KLLA0E01342g8387228911e-107
YDL095W (PMT1)8176858601e-103
ADR279C8176758511e-102
YDL093W (PMT5)7436877967e-95
KLLA0B03762g7727007383e-86
ABL085W7576977261e-84
CAGL0M00220g7657087216e-84
Kwal_47.167347927067071e-81
YJR143C (PMT4)7627046911e-79
Scas_442.13092986491e-78
Scas_710.19196946753e-76
Scas_719.807627056561e-74
CAGL0L07172g7776705472e-59
Sklu_2215.66534793823e-38
Scas_329.12732023438e-36
Scas_30.11281033132e-33
AAL050W6573712918e-27
Scas_588.77266842614e-23
Kwal_33.143576574622338e-20
KLLA0C14828g6294862142e-17
Scas_710.0d2711401643e-12
YDR307W6623331534e-10
CAGL0J11044g7362181178e-06
Kwal_33.1386057877693.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR290W
         (741 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR290W [1337] [Homologous to ScYAL023C (PMT2) - SH; ScYOR321W (...  1545   0.0  
Kwal_26.7105                                                         1068   0.0  
YAL023C (PMT2) [45] chr1 complement(106275..108554) Mannosyltran...  1051   0.0  
KLLA0F15829g complement(1464112..1466337) similar to sp|P31382 S...  1051   0.0  
Scas_505.2                                                            993   0.0  
CAGL0J08734g 860389..862617 highly similar to sp|P31382 Saccharo...   989   0.0  
Scas_643.24                                                           937   0.0  
YOR321W (PMT3) [5103] chr15 (916025..918286) Mannosyltransferase...   929   0.0  
CAGL0F00759g complement(85452..87656) similar to sp|P31382 Sacch...   775   0.0  
Kwal_33.15471                                                         701   0.0  
KLLA0F21978g 2042656..2044929 similar to sp|P42934 Saccharomyces...   649   0.0  
YGR199W (PMT6) [2149] chr7 (897505..899784) Protein with similar...   645   0.0  
CAGL0K00979g complement(97306..99498) similar to sp|P42934 Sacch...   588   0.0  
Scas_408.1*                                                           340   e-110
Kwal_23.3623                                                          352   e-109
CAGL0L07216g complement(799529..802105) similar to sp|P33775 Sac...   350   e-108
KLLA0E01342g complement(134691..137207) similar to sp|P33775 Sac...   347   e-107
YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase (...   335   e-103
ADR279C [2020] [Homologous to ScYDL095W (PMT1) - SH; ScYDL093W (...   332   e-102
YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT O-m...   311   7e-95
KLLA0B03762g 339424..341742 similar to sp|P46971 Saccharomyces c...   288   3e-86
ABL085W [507] [Homologous to ScYJR143C (PMT4) - SH] complement(2...   284   1e-84
CAGL0M00220g 28137..30434 similar to sp|P46971 Saccharomyces cer...   282   6e-84
Kwal_47.16734                                                         276   1e-81
YJR143C (PMT4) [3035] chr10 complement(698241..700529) Mannosylt...   270   1e-79
Scas_442.1                                                            254   1e-78
Scas_710.1                                                            264   3e-76
Scas_719.80                                                           257   1e-74
CAGL0L07172g complement(796354..798687) similar to sp|P33775 Sac...   215   2e-59
Sklu_2215.6 YDR307W, Contig c2215 9395-11356 reverse complement       151   3e-38
Scas_329.1                                                            136   8e-36
Scas_30.1                                                             125   2e-33
AAL050W [137] [Homologous to ScYDR307W - SH] complement(256490.....   116   8e-27
Scas_588.7                                                            105   4e-23
Kwal_33.14357                                                          94   8e-20
KLLA0C14828g complement(1292713..1294602) weakly similar to sp|Q...    87   2e-17
Scas_710.0d                                                            68   3e-12
YDR307W (YDR307W) [1135] chr4 (1075857..1077845) Protein contain...    64   4e-10
CAGL0J11044g complement(1073988..1076198) weakly similar to sp|Q...    50   8e-06
Kwal_33.13860                                                          31   3.3  

>ACR290W [1337] [Homologous to ScYAL023C (PMT2) - SH; ScYOR321W
           (PMT3) - SH] complement(886525..888792) [2268 bp, 755
           aa]
          Length = 755

 Score = 1545 bits (3999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 741/741 (100%), Positives = 741/741 (100%)

Query: 1   MQVNTAMHDRDEMSTTGYQRHEAGPANKRGKASAEDGAGVQEEDVSKLREVQQERNPLYK 60
           MQVNTAMHDRDEMSTTGYQRHEAGPANKRGKASAEDGAGVQEEDVSKLREVQQERNPLYK
Sbjct: 1   MQVNTAMHDRDEMSTTGYQRHEAGPANKRGKASAEDGAGVQEEDVSKLREVQQERNPLYK 60

Query: 61  LEAFVMPVLFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLV 120
           LEAFVMPVLFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLV
Sbjct: 61  LEAFVMPVLFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLV 120

Query: 121 GLSGYIAGYNGSWDFPSGEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVW 180
           GLSGYIAGYNGSWDFPSGEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVW
Sbjct: 121 GLSGYIAGYNGSWDFPSGEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVW 180

Query: 181 LFSILVVFENSYATLGRFILLDSMLLFFTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGV 240
           LFSILVVFENSYATLGRFILLDSMLLFFTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGV
Sbjct: 181 LFSILVVFENSYATLGRFILLDSMLLFFTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGV 240

Query: 241 SLGCTISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVSRFAGHFSARALCLIVVPFMVF 300
           SLGCTISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVSRFAGHFSARALCLIVVPFMVF
Sbjct: 241 SLGCTISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVSRFAGHFSARALCLIVVPFMVF 300

Query: 301 LFCFKLHFEFLSVSGTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLL 360
           LFCFKLHFEFLSVSGTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLL
Sbjct: 301 LFCFKLHFEFLSVSGTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLL 360

Query: 361 HSHVQTYPSGSSQQQVTTYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQDGRPYRLVHA 420
           HSHVQTYPSGSSQQQVTTYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQDGRPYRLVHA
Sbjct: 361 HSHVQTYPSGSSQQQVTTYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQDGRPYRLVHA 420

Query: 421 NTGRNLHTHPIPAPVSKTHWEVSGYGDAQVGDPKDNWIIEFVSQPSDEDKSVLHTISTSF 480
           NTGRNLHTHPIPAPVSKTHWEVSGYGDAQVGDPKDNWIIEFVSQPSDEDKSVLHTISTSF
Sbjct: 421 NTGRNLHTHPIPAPVSKTHWEVSGYGDAQVGDPKDNWIIEFVSQPSDEDKSVLHTISTSF 480

Query: 481 RIKNVEMGCYLAQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVNERLPPMPEDF 540
           RIKNVEMGCYLAQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVNERLPPMPEDF
Sbjct: 481 RIKNVEMGCYLAQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVNERLPPMPEDF 540

Query: 541 KYPKTSFFKDFVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTLNVGIRLCSWADDVRK 600
           KYPKTSFFKDFVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTLNVGIRLCSWADDVRK
Sbjct: 541 KYPKTSFFKDFVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTLNVGIRLCSWADDVRK 600

Query: 601 YFLIGSPASTWPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGIYPLLGWGL 660
           YFLIGSPASTWPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGIYPLLGWGL
Sbjct: 601 YFLIGSPASTWPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGIYPLLGWGL 660

Query: 661 HYLPFAVMGRVTYVHHYLPALYFALLILAYVFEASLRAARQSQKSYWKILVYVVYAVYYC 720
           HYLPFAVMGRVTYVHHYLPALYFALLILAYVFEASLRAARQSQKSYWKILVYVVYAVYYC
Sbjct: 661 HYLPFAVMGRVTYVHHYLPALYFALLILAYVFEASLRAARQSQKSYWKILVYVVYAVYYC 720

Query: 721 TIICGFYYFYPITVGMEGPSS 741
           TIICGFYYFYPITVGMEGPSS
Sbjct: 721 TIICGFYYFYPITVGMEGPSS 741

>Kwal_26.7105
          Length = 740

 Score = 1068 bits (2761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/730 (68%), Positives = 591/730 (80%), Gaps = 5/730 (0%)

Query: 13  MSTTGYQ-RHEAGPANKRGKASAEDGAGVQEEDVSKLREVQQERNPLYKLEAFVMPVLFT 71
           MS TG+  R   G   +R   + ++   ++ +D  ++ E   E NPL +LE+  MP++FT
Sbjct: 1   MSATGFDSRISDGTLKQRKVTTVDEIPDIEVDD--RIEEKSVEVNPLLRLESIAMPMIFT 58

Query: 72  LLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIAGYNG 131
            +  +TRM+KIG NN VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG++AGYNG
Sbjct: 59  AVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYNG 118

Query: 132 SWDFPSGEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSILVVFENS 191
           SWDFPSGEEYP+Y+DYVKMR+FNA FSA+C P+AYFT KAIGFSLPTVWLF+ILV+FENS
Sbjct: 119 SWDFPSGEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFENS 178

Query: 192 YATLGRFILLDSMLLFFTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGVSLGCTISVKMV 251
           YATLGRFILLDSMLLFFTV S + FV FHN+R +PF RKWWKWL   GVSLGCTISVKMV
Sbjct: 179 YATLGRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTISVKMV 238

Query: 252 GLFIISVVGIYTVVDLWNKLSEPNMSVSRFAGHFSARALCLIVVPFMVFLFCFKLHFEFL 311
           GLFII++VGIYTV++LW  L +  +S   +AGH+ AR LCLI+VPF++FL CFK+HF+ L
Sbjct: 239 GLFIITLVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLL 298

Query: 312 SVSGTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLLHSHVQTYPSGS 371
           S SGTGDA MPSLFQAGL+GS VG GPRDIAVGSS+VSIKNQALGG+LLHSHVQ YP GS
Sbjct: 299 SHSGTGDANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEGS 358

Query: 372 SQQQVTTYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQDGRPYRLVHANTGRNLHTHPI 431
           +QQQVT YGH DSNNNW+FDRIR L  WS  ETE EFV+ G  YRLVH NTG+NLHTHPI
Sbjct: 359 NQQQVTCYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRLVHPNTGKNLHTHPI 418

Query: 432 PAPVSKTHWEVSGYGDAQVGDPKDNWIIEFVSQPSDEDKSVLHTISTSFRIKNVEMGCYL 491
            AP++K+ WEVSGYG A+VGDPKD+W++E V+Q   ED+S LH +++SFRIKN E+GCYL
Sbjct: 419 AAPITKSEWEVSGYGTAEVGDPKDHWVVEVVAQHGSEDESRLHPLTSSFRIKNAELGCYL 478

Query: 492 AQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVNERLPPMPEDFKYPKTSFFKDF 551
           AQTG  LPEWGFRQ EVAC+ NPFKRDKRTWWN+ET+ NE+LP  P DFKYPK +F K+F
Sbjct: 479 AQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYPKINFIKNF 538

Query: 552 VHLNLAMMATNNALVPDPDKLDQLASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPASTW 611
           +HLNLAMMATNNALVPDPDKLD LASSAWQWPTLNVGIRLC W DD  KYFL+GSPASTW
Sbjct: 539 IHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSPASTW 598

Query: 612 PSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGIYPLLGWGLHYLPFAVMGRV 671
            ST AV  F  + V  LL+WQRQ      + D N+F+MGG YPLLGWGLHY+PF +M RV
Sbjct: 599 LSTIAVVGFMGLVVLLLLRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVIMSRV 658

Query: 672 TYVHHYLPALYFALLILAYVFEASLRAARQSQKSYWKILVYVVYAVYYCTIICGFYYFYP 731
           TYVHHYLPALYFALLIL+Y+FEA L+   +++    ++   ++Y  Y   +I GFYYF P
Sbjct: 659 TYVHHYLPALYFALLILSYLFEAGLKGLNKTKGG--QLARTLIYVTYGAIVIYGFYYFSP 716

Query: 732 ITVGMEGPSS 741
           I+ G+ GPSS
Sbjct: 717 ISFGLSGPSS 726

>YAL023C (PMT2) [45] chr1 complement(106275..108554)
           Mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase),
           responsible for initiation of O-glycosylation [2280 bp,
           759 aa]
          Length = 759

 Score = 1051 bits (2718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/738 (68%), Positives = 593/738 (80%), Gaps = 9/738 (1%)

Query: 4   NTAMHDRDEMSTTGYQRHEAGPANKRGKASAEDGAGVQEEDVSKLREVQQERNPLYKLEA 63
           N A H + E   T  QR  +  +     +SA++      ED SK +   Q  + L +LE+
Sbjct: 12  NNAAHIKQE--NTLRQRESSSISVSEELSSADER---DAEDFSKEKPAAQ--SSLLRLES 64

Query: 64  FVMPVLFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLS 123
            VMPV+FT LAL+TRM+KIG NN VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLS
Sbjct: 65  VVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLS 124

Query: 124 GYIAGYNGSWDFPSGEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFS 183
           GY+AGYNGSWDFPSGE YP+Y+DYVKMR+FNA FSA+C P+AYFT KAIGFSLPTVWL +
Sbjct: 125 GYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSALCVPLAYFTAKAIGFSLPTVWLMT 184

Query: 184 ILVVFENSYATLGRFILLDSMLLFFTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGVSLG 243
           +LV+FENSY+TLGRFILLDSMLLFFTV SF++FV+FHN+R +PF RKWWKWL   G+SLG
Sbjct: 185 VLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQRSKPFSRKWWKWLLITGISLG 244

Query: 244 CTISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVSRFAGHFSARALCLIVVPFMVFLFC 303
           CTISVKMVGLFII++VGIYTV+DLW  L++ +MS   +  H+ AR   LI+VPF +FL C
Sbjct: 245 CTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYINHWLARIFGLIIVPFCIFLLC 304

Query: 304 FKLHFEFLSVSGTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLLHSH 363
           FK+HF+ LS SGTGDA MPSLFQA L GS VG GPRDIA+GSS+VSIKNQALGG+LLHSH
Sbjct: 305 FKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIALGSSVVSIKNQALGGSLLHSH 364

Query: 364 VQTYPSGSSQQQVTTYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQDGRPYRLVHANTG 423
           +QTYP GS+QQQVT YG+ D+NN W F+R RGLP+WS NET+ E+++ G  YRLVH +TG
Sbjct: 365 IQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETDIEYLKPGTSYRLVHKSTG 424

Query: 424 RNLHTHPIPAPVSKTHWEVSGYGDAQVGDPKDNWIIEFVSQPSDEDKSVLHTISTSFRIK 483
           RNLHTHP+ APVSKT WEVSGYGD  VGD KDNW+IE + Q  DED   LHT++TSFRIK
Sbjct: 425 RNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMDQRGDEDPEKLHTLTTSFRIK 484

Query: 484 NVEMGCYLAQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVNERLPPMPEDFKYP 543
           N+EMGCYLAQTG SLPEWGFRQ EV C+ NPFKRDKRTWWNIET+ NERLPP PEDF+YP
Sbjct: 485 NLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNIETHENERLPPRPEDFQYP 544

Query: 544 KTSFFKDFVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTLNVGIRLCSWADDVRKYFL 603
           KT+F KDF+HLNLAMMATNNALVPDPDK D LASSAWQWPTLNVG+RLC W DD  KYFL
Sbjct: 545 KTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTLNVGLRLCGWGDDNPKYFL 604

Query: 604 IGSPASTWPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGIYPLLGWGLHYL 663
           +G+PASTW S+ AV  F    V  L++WQRQ V  +   + N+FLMGG YPLL WGLHY+
Sbjct: 605 LGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWNVFLMGGFYPLLAWGLHYM 664

Query: 664 PFAVMGRVTYVHHYLPALYFALLILAYVFEASLRAARQSQKSYWKILVYVVYAVYYCTII 723
           PF +M RVTYVHHYLPALYFAL+ILAY F+A L+   +S+    +I+ +V+YA +   +I
Sbjct: 665 PFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKCG--RIMRFVLYAGFMALVI 722

Query: 724 CGFYYFYPITVGMEGPSS 741
             F+YF PI+ GMEGPSS
Sbjct: 723 GCFWYFSPISFGMEGPSS 740

>KLLA0F15829g complement(1464112..1466337) similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2
           mannosyltransferase, start by similarity
          Length = 741

 Score = 1051 bits (2717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/714 (69%), Positives = 581/714 (81%), Gaps = 5/714 (0%)

Query: 29  RGKASAEDGAGVQE-EDVSKLREVQQERNPLYKLEAFVMPVLFTLLALYTRMHKIGANNR 87
           RGK   E+   + E ED+SK + V +  +PL KLE+ +MP++FT LA + RM+KIGAN+ 
Sbjct: 17  RGKDVVEEVEVLPEAEDLSKQKHVNE--SPLLKLESILMPIIFTGLAFFIRMYKIGANDH 74

Query: 88  VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIAGYNGSWDFPSGEEYPEYIDY 147
           VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVG SGY+AGYNGSWDFPSGE+YPEYID+
Sbjct: 75  VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGEQYPEYIDF 134

Query: 148 VKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSILVVFENSYATLGRFILLDSMLLF 207
           VKMR+FNA+FSA+C PVAYFT K+IGFSLPTVWLF+ LV+FENSY TLGRFILLDSMLLF
Sbjct: 135 VKMRLFNALFSALCVPVAYFTAKSIGFSLPTVWLFTTLVLFENSYTTLGRFILLDSMLLF 194

Query: 208 FTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGVSLGCTISVKMVGLFIISVVGIYTVVDL 267
           FTV S + FV FHN R +PF +KWWKWLF+ G SLGCTISVKMVGL II++VGIYTVVDL
Sbjct: 195 FTVLSMFCFVKFHNVRSKPFTKKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDL 254

Query: 268 WNKLSEPNMSVSRFAGHFSARALCLIVVPFMVFLFCFKLHFEFLSVSGTGDAMMPSLFQA 327
           WN L++  MS   +A H+++R + LI+VPF VFL CFK+HF+ LS SGTGDA MPSLFQA
Sbjct: 255 WNMLADTKMSKKVYAAHWASRFVFLILVPFAVFLACFKIHFDLLSHSGTGDANMPSLFQA 314

Query: 328 GLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLLHSHVQTYPSGSSQQQVTTYGHNDSNNN 387
            L GS VG GPRD+A+GSS ++IKNQALGG LLHSH+QTYP GS QQQVTTYGH DSNN 
Sbjct: 315 NLIGSDVGEGPRDVALGSSEITIKNQALGGGLLHSHIQTYPEGSQQQQVTTYGHKDSNNV 374

Query: 388 WVFDRIRGLPAWSINETEHEFVQDGRPYRLVHANTGRNLHTHPIPAPVSKTHWEVSGYGD 447
           W FDR R    +  NETE EFV DG  YRLVH NTGRNLHTHP  APV    WEVSGYGD
Sbjct: 375 WTFDRQRFSAPYDKNETETEFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAWEVSGYGD 434

Query: 448 AQVGDPKDNWIIEFVSQPSDEDKSVLHTISTSFRIKNVEMGCYLAQTGPSLPEWGFRQGE 507
           A+VGDPKD+WIIE V Q   ED++ LH +++SFR+KN EMGCYL+QTG +LP+WGFRQ E
Sbjct: 435 AKVGDPKDDWIIEIVDQKGPEDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNE 494

Query: 508 VACISNPFKRDKRTWWNIETNVNERLPPMPEDFKYPKTSFFKDFVHLNLAMMATNNALVP 567
           VAC+ NPFKRDKRTWWNIETNVNE+LPP PE+FKYPKTSF KDF+HLNLAMMATNNALVP
Sbjct: 495 VACVKNPFKRDKRTWWNIETNVNEKLPPRPENFKYPKTSFIKDFIHLNLAMMATNNALVP 554

Query: 568 DPDKLDQLASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPASTWPSTAAVGVFCLITVYY 627
           + +KLD+LASSAWQWPTLNVGIRLC W +   KYFLIGSPASTWPST AV  F ++   Y
Sbjct: 555 NAEKLDKLASSAWQWPTLNVGIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVY 614

Query: 628 LLKWQRQLVLFQASDDANIFLMGGIYPLLGWGLHYLPFAVMGRVTYVHHYLPALYFALLI 687
           L++WQRQ       +D N+FLMGGIYPLL WGLH++PF +M RVTYVHHYLPALYFALL+
Sbjct: 615 LIRWQRQYSDLTNPEDINLFLMGGIYPLLAWGLHFVPFIIMSRVTYVHHYLPALYFALLV 674

Query: 688 LAYVFEASLRAARQSQKSYWKILVYVVYAVYYCTIICGFYYFYPITVGMEGPSS 741
           LAY+FE S++   +S+    K++ Y +Y  Y   +I GFYYF PI+ GM GPS+
Sbjct: 675 LAYLFEISMKKWNKSKCG--KVMRYTIYGSYMAIVIYGFYYFAPISFGMSGPST 726

>Scas_505.2
          Length = 752

 Score =  993 bits (2568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/734 (63%), Positives = 566/734 (77%), Gaps = 12/734 (1%)

Query: 14  STTGYQRHEAGPANKRGKASAEDGAGVQEEDVSKLREVQQE--------RNPLYKLEAFV 65
           S TG++  E     +  KA  +      EE + +  ++++E         N L ++E+ +
Sbjct: 3   SATGFKAREKD--TEEVKARQDINIDTHEEIIDEKEDLKKEIVSTEKKESNTLLRVESII 60

Query: 66  MPVLFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGY 125
           MP++FT LA++ RM+KIG N+ VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGY
Sbjct: 61  MPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGY 120

Query: 126 IAGYNGSWDFPSGEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSIL 185
           +AGYNGS+DF SG EYP+Y+DYVKMR+FNA FSAMC PVAYFT KAIGFS+PTVWLF+I 
Sbjct: 121 LAGYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTVWLFTIT 180

Query: 186 VVFENSYATLGRFILLDSMLLFFTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGVSLGCT 245
           V+FENSY TLG+FILLDSMLLFFTV S+  FV+FHN+R +PF RKWWKW+   G+S+GC 
Sbjct: 181 VLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKWWKWMLLTGLSMGCA 240

Query: 246 ISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVSRFAGHFSARALCLIVVPFMVFLFCFK 305
           ISVKMVGLFII+VVGIYT++DLWN L +  MS   + GH+ AR +CLI+VPF+VFL CFK
Sbjct: 241 ISVKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIICLIIVPFLVFLACFK 300

Query: 306 LHFEFLSVSGTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLLHSHVQ 365
           +HF+ L+ SGTGDA M SLFQA L GS VG GPRD+AVGSS++SIKNQALGG LLHSH  
Sbjct: 301 IHFDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKNQALGGALLHSHYN 360

Query: 366 TYPSGSSQQQVTTYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQDGRPYRLVHANTGRN 425
            YP GS+QQQVT Y + D+NN W FDR RG P +  NET+ E+V     YRLVH  TG+N
Sbjct: 361 AYPEGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETDIEYVLGDSQYRLVHHKTGKN 420

Query: 426 LHTHPIPAPVSKTHWEVSGYGDAQVGDPKDNWIIEFVSQPSDEDKSVLHTISTSFRIKNV 485
           LHTHP+ AP+S T WEVSGYGDA+ GD +DNW+IE V Q  DEDK+ LH ++TSFRI N 
Sbjct: 421 LHTHPVRAPISSTQWEVSGYGDAEQGDSRDNWLIEIVDQRGDEDKTKLHPLTTSFRIYNP 480

Query: 486 EMGCYLAQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVNERLPPMPEDFKYPKT 545
           +M CYL+QTG  LPEWGF+Q EVAC+ NPF+RDKRTWWNIETN N+ LPP P DFK+PKT
Sbjct: 481 DMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIETNENDVLPPRPADFKFPKT 540

Query: 546 SFFKDFVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTLNVGIRLCSWADDVRKYFLIG 605
           +FFKDF+ LNLAMMATNNALVPDP+K D LASSAWQWPTL  G+R+CSW +DV KYFL+G
Sbjct: 541 NFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYWGLRICSWGEDVVKYFLLG 600

Query: 606 SPASTWPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGIYPLLGWGLHYLPF 665
           +PASTW S+ AV    +  V  L++WQRQ    Q   D N F+MG  YPLL WGLHY PF
Sbjct: 601 TPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDLNTFMMGAFYPLLAWGLHYAPF 660

Query: 666 AVMGRVTYVHHYLPALYFALLILAYVFEASLRAARQSQKSYWKILVYVVYAVYYCTIICG 725
            +M RVTYVHHYLPALYFAL+ILAYVF+A L+   +++ +  +IL  V+Y   Y T+I  
Sbjct: 661 VIMSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKST--QILRIVIYLAAYVTVIGC 718

Query: 726 FYYFYPITVGMEGP 739
           F+YF PI+ GM GP
Sbjct: 719 FWYFSPISFGMVGP 732

>CAGL0J08734g 860389..862617 highly similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2 or sp|P47190
           Saccharomyces cerevisiae YOR321w PMT3, hypothetical
           start
          Length = 742

 Score =  989 bits (2558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/730 (63%), Positives = 574/730 (78%), Gaps = 6/730 (0%)

Query: 13  MSTTGYQRHEAGPA--NKRGKASAEDGAGVQEEDVSKLREVQQERNPLYKLEAFVMPVLF 70
           MS+TG+Q  E   A    R + S +D    ++ED SKL++ +  ++PL +LEA++MP++F
Sbjct: 1   MSSTGFQGSEKSDAELKARKQTSVDDVLIEEKEDTSKLKDAKVSQSPLLQLEAYLMPLVF 60

Query: 71  TLLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIAGYN 130
           T LAL+ RM++IG N  VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGY+AGYN
Sbjct: 61  TGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYN 120

Query: 131 GSWDFPSGEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSILVVFEN 190
           GS+DF SG EYPEY+D+VKMR+FNA FSAMC P+AYFT KAIGFSLP VWLF+ +V+FEN
Sbjct: 121 GSFDFESGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLFEN 180

Query: 191 SYATLGRFILLDSMLLFFTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGVSLGCTISVKM 250
           SY+TLGRFILLDSMLLFFTV S ++FV+FHN+R RPF RKWWKWL   G++LGCTISVKM
Sbjct: 181 SYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTISVKM 240

Query: 251 VGLFIISVVGIYTVVDLWNKLSEPNMSVSRFAGHFSARALCLIVVPFMVFLFCFKLHFEF 310
           VGLF+I++VGIYTV+DL   L+E  MS   + GH+ AR + LI VP  VF+ CFKLHF+ 
Sbjct: 241 VGLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDL 300

Query: 311 LSVSGTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLLHSHVQTYPSG 370
           L  SGTGDA MPSLFQAGL GS VG GPRD+A+GSS VSIKNQAL G LLHSHVQTYP G
Sbjct: 301 LWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSS-VSIKNQALSGALLHSHVQTYPEG 359

Query: 371 SSQQQVTTYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQDGRPYRLVHANTGRNLHTHP 430
           S+QQQVT Y + D+NNNWVF R+R    W INET+ E+V DG  YRLVHANT +NLHTH 
Sbjct: 360 SNQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHANTQKNLHTHS 419

Query: 431 IPAPVSKTHWEVSGYGDAQVGDPKDNWIIEFVSQPSDEDKSVLHTISTSFRIKNVEMGCY 490
           I APV K +WEVSGYG+  +GD KD W++E V Q   E+ + +H ++TSFR++N E+ CY
Sbjct: 420 IAAPVDKKNWEVSGYGNHTIGDAKDYWVLEIVDQKGSENTTQVHPLTTSFRLRNKELDCY 479

Query: 491 LAQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVNERLPPMPEDFKYPKTSFFKD 550
           LAQTG  LPEWGFRQ E++C+ +PF+RDKRTWWN+E++ NE+LP  PE+FKYP + F KD
Sbjct: 480 LAQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLPT-PEEFKYPGSGFLKD 538

Query: 551 FVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPAST 610
           F+HLNLAMMATNNALVP+ DK D LASSAW+WPTL+VG+RLC W D+  KYFL+G+P +T
Sbjct: 539 FIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTPVTT 598

Query: 611 WPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGIYPLLGWGLHYLPFAVMGR 670
           W S+ AV  F ++ V  LL+WQRQ   F   DD N+FLMGG YP+LGWGLH++PF +M R
Sbjct: 599 WASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFVIMSR 658

Query: 671 VTYVHHYLPALYFALLILAYVFEASLRAARQSQKSYWKILVYVVYAVYYCTIICGFYYFY 730
           VTYVHHYLPALYFAL+IL Y+ +A+ +   +S+     I+  VV+A+   +++  F+YF 
Sbjct: 659 VTYVHHYLPALYFALIILTYIIDATTKRWMKSKCG--SIMRLVVFAISIASVVGCFWYFS 716

Query: 731 PITVGMEGPS 740
           PI+ GM GP+
Sbjct: 717 PISFGMTGPA 726

>Scas_643.24
          Length = 769

 Score =  937 bits (2422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/744 (61%), Positives = 550/744 (73%), Gaps = 20/744 (2%)

Query: 10  RDEMSTTGYQRHEAGPANKRGKASAEDGAGVQEEDVS-KLREVQQERNPLYKLEAFVMPV 68
           + E S    ++H +  A  +   +A+D A + E+D + K ++   E +PL K+EA+VMP+
Sbjct: 14  KKEASDLKVRQHNSSAATSK---AAKDSASIDEKDENVKKQQPPSEESPLCKVEAWVMPI 70

Query: 69  LFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIAG 128
           +FT L+ +TRM+KIG NN VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGY+AG
Sbjct: 71  VFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAG 130

Query: 129 YNGSWDFPSGEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSILVVF 188
           YNGSWDFPSGEEYP+Y+DYVKMR+F A FS++C P+AY T KAIGFS+P VWLF+ LV+F
Sbjct: 131 YNGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAVWLFTCLVLF 190

Query: 189 ENSYATLGRFILLDSMLLFFTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGVSLGCTISV 248
           ENSYATLGRFILLDSML FFTV SF  F+LFH +R  PF  KWW  L  LG +LGC ISV
Sbjct: 191 ENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNPFSIKWWTTLALLGFNLGCAISV 250

Query: 249 KMVGLFIISVVGIYTVVDLWNKLSEPNMSVSR-------FAGHFSARALCLIVVPFMVFL 301
           KMVGLFII++VGIYTV DLW  L +     ++       +  H+ AR +CLI++PF+VFL
Sbjct: 251 KMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVCLIIIPFLVFL 310

Query: 302 FCFKLHFEFLSVSGTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLLH 361
            CF++HF  LS SGTGDA MPSLFQA L GS VG GPRD+A+GSS VSIKNQALGG LLH
Sbjct: 311 TCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALGSSFVSIKNQALGGALLH 370

Query: 362 SHVQTYPSGSSQQQVTTYGHNDSNNNWVFDRIR--GLPAWSINETEH--EFVQDGRPYRL 417
           SHVQT+P GS+QQQVT Y +ND NN W FDRIR  G   WS NETE   E+V+ G  YRL
Sbjct: 371 SHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWS-NETETDIEYVRVGNEYRL 429

Query: 418 VHANTGRNLHTHPIPAPVSKTHWEVSGYGDA-QVGDPKDNWIIEFVSQPSDEDKSVLHTI 476
           VH +T +NLH   I APVSK  WEV+G+G   +VGD  DNWIIE + Q  DEDKS++H +
Sbjct: 430 VHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWIIEVIEQAGDEDKSMIHPL 489

Query: 477 STSFRIKNVEMGCYLAQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVNERLPPM 536
           +T+F IK+  +GCYL QT   LPEWGFRQ E+ C     K DKRTWWN+E++ NE+LP  
Sbjct: 490 TTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWNVESHENEKLPDP 549

Query: 537 PEDFKYPKTSFFKDFVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTLNVGIRLCSWAD 596
              F YPKT+FFKDF+ LN  MMATNNALVPD DK D LAS+AWQWPTLNVG+RLC W D
Sbjct: 550 DASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWPTLNVGLRLCGWND 609

Query: 597 DVRKYFLIGSPASTWPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGIYPLL 656
           D  KYFL+GSPASTWPST +V V  +  V    +WQRQL  F      N F+MG  YPLL
Sbjct: 610 DTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDKALNTFMMGAFYPLL 669

Query: 657 GWGLHYLPFAVMGRVTYVHHYLPALYFALLILAYVFEASLRAARQSQKSYWKILVYVVYA 716
            WGLH++PF +M RVTYVHHYLPALYFALL+LAY FEA +R  + +   Y   + Y+   
Sbjct: 670 AWGLHFMPFVIMARVTYVHHYLPALYFALLVLAYFFEAIIRRPKGTLAKY---ITYITLV 726

Query: 717 VYYCTIICGFYYFYPITVGMEGPS 740
           +Y+  +I GF+YF PI+ GM+GPS
Sbjct: 727 LYFAVVIGGFFYFSPISFGMDGPS 750

>YOR321W (PMT3) [5103] chr15 (916025..918286) Mannosyltransferase
           (dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase), involved in initiation of
           O-glycosylation [2262 bp, 753 aa]
          Length = 753

 Score =  929 bits (2400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/710 (61%), Positives = 541/710 (76%), Gaps = 5/710 (0%)

Query: 31  KASAEDGAGVQEEDVSKLREVQQERNPLYKLEAFVMPVLFTLLALYTRMHKIGANNRVVW 90
           K   ED     ++D     +V+ E + +  L+  VMP++FT+L ++TRM+KIG NN VVW
Sbjct: 26  KEELEDADNFLKDDAELYDKVKNE-SAVSHLDTIVMPIIFTVLGMFTRMYKIGRNNHVVW 84

Query: 91  DEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIAGYNGSWDFPSGEEYPEYIDYVKM 150
           DEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGY+AGYNGSWDFPSGE YP+YIDYVKM
Sbjct: 85  DEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEVYPDYIDYVKM 144

Query: 151 RMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSILVVFENSYATLGRFILLDSMLLFFTV 210
           R+F A+FS++C P+AYFTG+AIGFS  +VWLF+ILV+FENSYATLG+FILLDSMLLFFTV
Sbjct: 145 RLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILVIFENSYATLGKFILLDSMLLFFTV 204

Query: 211 CSFYTFVLFHNERHRPFGRKWWKWLFFLGVSLGCTISVKMVGLFIISVVGIYTVVDLWNK 270
            S++    FH  R  PF  +WW WL   G++LGC ISVKMVGLFIISVVGIYT+ +LWN 
Sbjct: 205 SSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLGCAISVKMVGLFIISVVGIYTISELWNL 264

Query: 271 LSEPNMSVSRFAGHFSARALCLIVVPFMVFLFCFKLHFEFLSVSGTGDAMMPSLFQAGLS 330
           LS+ ++S   +  H+ AR   LI++P  VFL CFK+HF+ LS SG GD+ MPSLFQA L+
Sbjct: 265 LSDRSVSWKVYVNHWLARIFGLIIIPVCVFLLCFKIHFDLLSNSGPGDSTMPSLFQASLN 324

Query: 331 GSSVGIGPRDIAVGSSLVSIKNQALGGTLLHSHVQTYPSGSSQQQVTTYGHNDSNNNWVF 390
           G+ VG GPRD+A+GSS++SIKNQALGG LLHSHVQ +P GS QQQVT YG++D+NN W F
Sbjct: 325 GTKVGKGPRDVALGSSIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFF 384

Query: 391 DRIRGLPAWSINETEH-EFVQDGRPYRLVHANTGRNLHTHPIPAPVSKTHWEVSGYGDAQ 449
            RIRG+  W+  E +  EFV+ G  YRL+H  TG+NLHTH +PAP+SK+ +EVS YGD  
Sbjct: 385 QRIRGVEPWTDAENKTIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVD 444

Query: 450 VGDPKDNWIIEFVSQPSDEDKSVLHTISTSFRIKNVEMGCYLAQTGPSLPEWGFRQGEVA 509
           +GD KDNWIIE V Q  +ED ++LH +STSFRIKN  +GCYLAQ+G  LPEWGFRQGEV 
Sbjct: 445 LGDYKDNWIIEIVEQVGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVV 504

Query: 510 CISNPFKRDKRTWWNIETNVNERLPPMPEDFKYPKTSFFKDFVHLNLAMMATNNALVPDP 569
           C+ +  KRDKRTWWNIET+ NERL P  EDF YPKTSFF++F+ LN AMMATNNALVP+P
Sbjct: 505 CLKHASKRDKRTWWNIETHENERL-PQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNP 563

Query: 570 DKLDQLASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPASTWPSTAAVGVFCLITVYYLL 629
           +K D +ASSAWQWPTLNVG+RLC W++   KYFL+GSPAS WPS+ AV    +  ++  L
Sbjct: 564 EKFDGIASSAWQWPTLNVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTL 623

Query: 630 KWQRQLVLFQASDDANIFLMGGIYPLLGWGLHYLPFAVMGRVTYVHHYLPALYFALLILA 689
           KWQRQ V+     + ++F+M   YPLL W LHY+PF VM RV Y HHYLP LYFAL+IL+
Sbjct: 624 KWQRQCVILSDPVERDVFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILS 683

Query: 690 YVFEASLRAARQSQKSYWKILVYVVYAVYYCTIICGFYYFYPITVGMEGP 739
           Y F+  +   R + ++  K L    Y VY   +I GF+YF P + GM+GP
Sbjct: 684 YYFD--MITKRWATRNTGKFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGP 731

>CAGL0F00759g complement(85452..87656) similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2 or sp|P47190
           Saccharomyces cerevisiae YOR321w PMT3, hypothetical
           start
          Length = 734

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/721 (51%), Positives = 496/721 (68%), Gaps = 11/721 (1%)

Query: 20  RHEAGPANKRGKASAEDGAGVQEEDVSKLREVQQERNPLY--KLEAFVMPVLFTLLALYT 77
           R    P+    K   + G      D++   + Q+  N  +  +LE   MP++FTLLAL  
Sbjct: 6   RARKAPSVSEVKVEHDHG-----HDLANDNKEQKASNKQFWLRLERVAMPIVFTLLALLV 60

Query: 78  RMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIAGYNGSWDFPS 137
           R++++    +V WDEAHFGKFGSYYLRH FYHDVHPPLGKMLVG SGY+AGYNGSWDFPS
Sbjct: 61  RLYRLDVVKKVTWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS 120

Query: 138 GEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSILVVFENSYATLGR 197
           G+ YP+Y+ +VKMR+F    SA+C P+ YF  KAIGFSLPTVWL +ILV+ ENSY TLG+
Sbjct: 121 GQPYPDYVPFVKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTLGK 180

Query: 198 FILLDSMLLFFTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGVSLGCTISVKMVGLFIIS 257
            ILLDS+LLFFTV +F  F  FH+   +PF  +W  WLF  G S+GC ISVKMVGLF+I+
Sbjct: 181 LILLDSLLLFFTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVIT 240

Query: 258 VVGIYTVVDLWNKLSEPNMSVSRFAGHFSARALCLIVVPFMVFLFCFKLHFEFLSVSGTG 317
           +VGI+T+V+LW  L + N++  R+A H+ AR +CLIV PF++F  CFK+HF  L  SG G
Sbjct: 241 LVGIHTIVELWTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPG 300

Query: 318 DAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLLHSHVQTYPSGSSQQQVT 377
           D  MP  FQA L+G+++G GPRD+++GS+ ++++N    G  LHSH QTYP GS Q+QVT
Sbjct: 301 DHEMPPRFQAALNGTNIGQGPRDVSIGST-ITLQNMKPRGAYLHSHHQTYPEGSKQRQVT 359

Query: 378 TYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQDGRPYRLVHANTGRNLHTHPIPAPVSK 437
            Y + D NN+W+  R  G P W +N+TEHE +++G   RLVH  TG NLH+H + AP++K
Sbjct: 360 CYNYVDGNNDWIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNK 419

Query: 438 THWEVSGYGDAQVGDPKDNWIIEFVSQPSDEDKSVLHTISTSFRIKNVEMGCYLAQTGPS 497
             +EVSGYG+  +GD KD+W++E +    +EDK+++H I+T  R ++  + CYLAQ+   
Sbjct: 420 LDYEVSGYGNLTIGDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEH 479

Query: 498 LPEWGFRQGEVACISNPFKRDKRTWWNIETNVNERLPPMPEDFKYPKTSFFKDFVHLNLA 557
           LPEWGF Q EV CI  P K D +T W ++T+ +  L   PE+F YP+ SF+ DF  LN  
Sbjct: 480 LPEWGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNLEA-PENFIYPRRSFWSDFFELNKR 538

Query: 558 MMATNNALVPDPDKLDQLASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPASTWPSTAAV 617
           MMATNNAL    DK D L S +W+WPTL   +R+ SW ++  +Y L+GSPASTWPST AV
Sbjct: 539 MMATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTVAV 598

Query: 618 GVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGIYPLLGWGLHYLPFAVMGRVTYVHHY 677
                  +Y +LKW RQ+ +FQ   D  +F+ GG+YPLLGW LH+ PF +MGRV YVHHY
Sbjct: 599 LFLVFALLYKVLKWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHY 658

Query: 678 LPALYFALLILAYVFEASLRAARQSQKSYWKILVYVVYAVYYCTIICGFYYFYPITVGME 737
           LPALYFAL +LAY+F+A LR   +++    +I+ + +YA Y   +I GF  F P + GM 
Sbjct: 659 LPALYFALFVLAYIFDAGLRYYNKTKTQ--RIIKFCIYAGYMSVVIGGFILFAPFSYGMT 716

Query: 738 G 738
           G
Sbjct: 717 G 717

>Kwal_33.15471
          Length = 755

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/711 (50%), Positives = 466/711 (65%), Gaps = 25/711 (3%)

Query: 41  QEEDVSKLREVQQERNPLYKLEAFVMPVLFTLLALYTRMHKIGANNRVVWDEAHFGKFGS 100
             ++ +K       RN L ++   +   L T+L+ Y R +KI AN+ VVWDEAHFGKFGS
Sbjct: 43  NSKNKTKFASSSISRNVLLQVTGVI---LLTILSFYVRFNKIDANDEVVWDEAHFGKFGS 99

Query: 101 YYLRHEFYHDVHPPLGKMLVGLSGYIAGYNGSWDFPSGEEYPEYIDYVKMRMFNAVFSAM 160
           YY+++EFYHDVHPPLGKML+ LS Y+AG+NG + F SG  YP  ++Y  MR FNA F A+
Sbjct: 100 YYIKNEFYHDVHPPLGKMLIALSQYLAGFNGDFAFDSGAPYPSGMNYKFMRQFNATFGAL 159

Query: 161 CAPVAYFTGKAIGFSLPTVWLFSILVVFENSYATLGRFILLDSMLLFFTVCSFYTFVLFH 220
           CAP+   T K +GFS    +   ++V  E S+  L +FILLDSMLLFFT  +F+     H
Sbjct: 160 CAPIMLLTAKNLGFSNLGSYFLGMMVALELSFVALSKFILLDSMLLFFTATTFHCITELH 219

Query: 221 NERHRPFGRKWWKWLFFLGVSLGCTISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVSR 280
             R+RPF R+W  W+  LG+S+GC  SVK VGLFI  + GIYTVVDL++   +  +S   
Sbjct: 220 KVRNRPFTRRWSLWMLLLGLSVGCVCSVKWVGLFITVIAGIYTVVDLFSYHYDKELSRLS 279

Query: 281 FAGHFSARALCLIVVPFMVFLFCFKLHFEFLSVSGTGDAMMPSLFQAGLSGSSVGIGPRD 340
           +  H+  R + LIV+PF+V+LFCFK+HF  L  SGTGDA   +LFQ  L G+ + IGPR+
Sbjct: 280 YYKHWLVRIIDLIVIPFLVYLFCFKIHFAILHKSGTGDAATNTLFQVNLDGNKIEIGPRN 339

Query: 341 IAVGSSLVSIKNQALGGTLLHSHVQTYPSGSSQQQVTTYGHNDSNNNWV--FDRIRGLPA 398
           +A GS  V+I++  L   LLHSHVQ YP GS Q QVT YGH+D NNNWV  + R  GL A
Sbjct: 340 VAFGSE-VTIRSHGLSPNLLHSHVQLYPFGSGQHQVTGYGHSDDNNNWVIKYPREGGLKA 398

Query: 399 WS--INETEHEFVQDGRPYRLVHANTGRNLHTHPIPAPVSKTHWEVSGYGDAQVGDPKDN 456
               + + + + + +G   RLVH NTG NLH+H IPA VSK  +EVSGYGD ++GD KD+
Sbjct: 399 AENGLQDVQSDLLTEGSEIRLVHKNTGANLHSHEIPAHVSKGSFEVSGYGDEEIGDIKDD 458

Query: 457 WIIEFVSQ-PSD------EDKSVLHTISTSFRIKNVEMGCYLAQTGPSLPEWGFRQGEVA 509
           W++E V Q  SD      ED S+LH ISTSFR+++  +GCYLA TG + P WGF+Q E+ 
Sbjct: 459 WVVEIVQQLDSDNSSFPKEDPSLLHPISTSFRLRHKYLGCYLATTGLAYPAWGFKQAEIV 518

Query: 510 CISNPFKRDKRTWWNIETNVNERLPPMPEDFKYPKTSFFKDFVHLNLAMMATNNALVPDP 569
           C     KRDK TWWNIE + N  L    E +  PK+ F+ DF+ +N AM ++NNALVPD 
Sbjct: 519 CKHTWMKRDKSTWWNIEDHWNPNLEK-SEGYVPPKSKFWPDFILINFAMASSNNALVPDE 577

Query: 570 DKLDQLASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPASTWPSTAAVGVFCLITVYYLL 629
           DK D LAS AWQWPTL+VG+R+CSW++D  KYFL+GSP  TW ST ++ +F LI +    
Sbjct: 578 DKYDSLASEAWQWPTLHVGLRMCSWSNDTVKYFLLGSPFQTWLSTLSLFIFVLILLRLAF 637

Query: 630 KWQRQLVLFQASDDANIFLMGGIYPLLGWGLHYLPFAVMGRVTYVHHYLPALYFALLILA 689
           KWQRQ V    ++ + I  M G+ P L W LHYLPF +MGRVTYVHHY+PALYFA+L+  
Sbjct: 638 KWQRQTVNLTGNELSEI-SMQGVLPFLAWLLHYLPFVLMGRVTYVHHYVPALYFAILVFG 696

Query: 690 YVFEASLRAARQSQKSYWKILVYVVYAVYYCTIICGFYYFYPITVGMEGPS 740
           +V E  L       K Y+  L Y+VY   Y   I  +  F PI  G++GP+
Sbjct: 697 FVLETCL------PKRYF--LNYIVYTALYAGCIYIYVLFSPIAQGIDGPA 739

>KLLA0F21978g 2042656..2044929 similar to sp|P42934 Saccharomyces
           cerevisiae YGR199w PMT6 putative mannosyltransferase,
           start by similarity
          Length = 757

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/716 (45%), Positives = 462/716 (64%), Gaps = 23/716 (3%)

Query: 35  EDGAGVQEEDVSKLRE-VQQERNPLYKLEAFVMPVLFTLLALYTRMHKIGANNRVVWDEA 93
            D   V+++ V  L+  +   RN  ++   +V  +L TL++   R +KI  +N VVWDEA
Sbjct: 35  RDNEPVEDKLVKPLKSSIFSNRN--HRFHTYVC-LLLTLVSFVLRFYKIDRSNIVVWDEA 91

Query: 94  HFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIAGYNGSWDFPSGEEYPEYIDYVKMRMF 153
           HFGKFGSYYL+HEFYHDVHPPLGKML+GL  Y+AG++G++DF S   YP+ +++  MR F
Sbjct: 92  HFGKFGSYYLKHEFYHDVHPPLGKMLIGLGEYLAGFDGNFDFSSNSSYPDEVNFKIMRQF 151

Query: 154 NAVFSAMCAPVAYFTGKAIGFSLPTVWLFSILVVFENSYATLGRFILLDSMLLFFTVCSF 213
           NA+FS++C P+A++  + + FS+PTV+L +++V FE+SY  LG+F+LLDSMLLFFTV +F
Sbjct: 152 NAIFSSLCTPLAFYAARNLNFSMPTVYLVALMVCFEHSYIVLGKFVLLDSMLLFFTVLTF 211

Query: 214 YTFVLFHNERHRPFGRKWWKWLFFLGVSLGCTISVKMVGLFIISVVGIYTVVDLWNKLSE 273
           Y     +  R      KW  W+   G S+GC  SVK VGL I ++VGIYTV +L+    +
Sbjct: 212 YCLSQLYRLRECQLTVKWLAWILATGFSIGCVCSVKWVGLLITALVGIYTVSELYCLHCD 271

Query: 274 PNMSVSRFAGHFSARALCLIVVPFMVFLFCFKLHFEFLSVSGTGDAMMPSLFQAGLSGSS 333
            ++S +++ GH+  R   LIV P ++++  FK+HF  L  +GTGD+   SLFQA L G+ 
Sbjct: 272 RSLSKTKYLGHWIVRISALIVFPLILYMVFFKIHFTLLYKTGTGDSSTHSLFQANLEGAQ 331

Query: 334 VGIGPRDIAVGSSLVSIKNQALGGTLLHSHVQTYPSGSSQQQVTTYGHNDSNNNWVFDRI 393
           +   PRDIA GS  +S+++  L   LLHSH QTYP GS+Q+QVT Y + D NNNW+    
Sbjct: 332 IKPSPRDIAFGSC-ISLRSHGLSPGLLHSHPQTYPDGSNQRQVTGYSYRDGNNNWIVKYS 390

Query: 394 RGLPAWSINETEHE----FVQDGRPYRLVHANTGRNLHTHPIPAPVSKTHWEVSGYGDAQ 449
           R     S  E  +     F++DG   RLVH  T  NLHTH IP+ VSK H+EVSGYG+  
Sbjct: 391 RSSGKASAEERVYSDNILFLKDGDLLRLVHEKTKNNLHTHQIPSHVSKGHYEVSGYGNDA 450

Query: 450 VGDPKDNWIIEFVSQ-----PSDEDKSVLHTISTSFRIKNVEMGCYLAQTGPSLPEWGFR 504
           VGD KD+WIIE V Q      + E+K+++H ++TSFR++N E+GCYLA TG S P WG+ 
Sbjct: 451 VGDLKDDWIIEVVEQLPTGNNTMENKALIHPLTTSFRLRNKELGCYLAATGLSYPGWGYN 510

Query: 505 QGEVACISNPFKRDKRTWWNIETNVNERLPPMPEDFKYPKTSFFKDFVHLNLAMMATNNA 564
           Q E+ C     +RDK TWWN+E ++N  L  + + F  P T F+ DFV +N AM A+NNA
Sbjct: 511 QAEIVCKYPWNQRDKSTWWNVEDHINSNL-HIDQTFTPPPTKFWTDFVVINFAMAASNNA 569

Query: 565 LVPDPDKLDQLASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPASTWPSTAAVGVFCLIT 624
           L+PD DK D++AS  W+WP L  G+R+C+W D   KY+L+GSP +TW STAA+ +  ++ 
Sbjct: 570 LIPDLDKYDRIASEPWEWPILYKGLRMCNWNDKTVKYYLLGSPFNTWLSTAALPILLILV 629

Query: 625 VYYLLKWQRQLVLFQASDDANIFLMGGIYPLLGWGLHYLPFAVMGRVTYVHHYLPALYFA 684
              L ++QRQ +        N+F   G+   +GW LHY PF +MGRVTY+HHY+PAL+FA
Sbjct: 630 SMELFRYQRQSLQLNEKKAWNLFACAGL-SFIGWLLHYAPFFIMGRVTYIHHYVPALFFA 688

Query: 685 LLILAYVFEASLRAARQSQKSYWKILVYVVYAVYYCTIICGFYYFYPITVGMEGPS 740
           ++  AYV + +L  + +    Y K+   V Y+  Y      ++YF P   GM  P+
Sbjct: 689 IMTFAYVVDFALANSNR----YLKV---VAYSSLYAGCTFTYWYFAPFCQGMPEPN 737

>YGR199W (PMT6) [2149] chr7 (897505..899784) Protein with similarity
           to O-mannosyltransferases Pmt1p, Pmt2p, Pmt3p, Pmt4p and
           Pmt5p [2280 bp, 759 aa]
          Length = 759

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/748 (44%), Positives = 470/748 (62%), Gaps = 32/748 (4%)

Query: 16  TGYQRHEAGPANKRG------KASAEDGAGVQEEDVSKLREVQ-----QERNPLYKLEAF 64
           TG+   +    N R       KA+A D    Q +   +L E       +E   L  L   
Sbjct: 7   TGFSSIDTEDENLRERYVNQPKANASDIQDEQLDCFEQLEEKHRTKKNEEYTALKILRDV 66

Query: 65  VMPVLFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG 124
           + P+L T+ + Y R   I  NN VVWDEAHFGKFGSYY++HE+YHDVHPPLGKML+ LS 
Sbjct: 67  IGPLLLTITSFYLRFQHIDQNNYVVWDEAHFGKFGSYYIKHEYYHDVHPPLGKMLIALSE 126

Query: 125 YIAGYNGSWDFPSGEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSI 184
           ++AG++G +DF S   YPE +++  MR FNA F A+C PVA+FT K +GF+  TV+L + 
Sbjct: 127 WMAGFDGQFDFSSNNAYPENVNFKLMRQFNATFGALCTPVAFFTAKWMGFNYFTVYLIAT 186

Query: 185 LVVFENSYATLGRFILLDSMLLFFTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGVSLGC 244
           +V  E+SY  L +FILLDSMLLFF++ +F   +  +  R +   +KW  W+   G+S+GC
Sbjct: 187 MVTLEHSYIVLSKFILLDSMLLFFSMTTFACMIKLYTLRKQQMTKKWSLWMLLTGLSIGC 246

Query: 245 TISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVSRFAGHFSARALCLIVVPFMVFLFCF 304
             SVK VGLFI  VVG+YT ++L+    +  +   ++  H+  R + LIV+PF+++L+CF
Sbjct: 247 VCSVKWVGLFITVVVGLYTCIELFLLYCDKELPRIKYYKHWLIRIINLIVIPFLIYLYCF 306

Query: 305 KLHFEFLSVSGTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLLHSHV 364
           K+HF  L  SGTGD+   +LFQ  L G+ +  GPRD+A GS L +I++  L   LLHSH+
Sbjct: 307 KIHFVLLYKSGTGDSTTNTLFQINLEGTQIEAGPRDVAFGSEL-TIRSHGLSPNLLHSHI 365

Query: 365 QTYPSGSSQQQVTTYGHNDSNNNWVFD--RIRGLPAWSINETEHEF--VQDGRPYRLVHA 420
           Q YP GS Q+Q+T YG  DSNN W F+  R  GL          +   + DG   RL H 
Sbjct: 366 QVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNGTLNGKIIPITDGVEVRLSHK 425

Query: 421 NTGRNLHTHPIPAPVSKTHWEVSGYGDAQVGDPKDNWIIEFVSQP-------SDEDKSVL 473
           NTG NLH+H +P+ VS+ ++EVSGYG   VGD KD+WI+E V Q        S+E+ ++L
Sbjct: 426 NTGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDWIVEIVKQMDSPNPVYSNENSTIL 485

Query: 474 HTISTSFRIKNVEMGCYLAQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVNERL 533
           H +ST FR+++  +GCYLA TG + P WGF+Q E+ C  +  +RDK TWWN+E + N  L
Sbjct: 486 HPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDSWSRRDKSTWWNVEDHWNHNL 545

Query: 534 PPMPEDFKYPKTSFFKDFVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTLNVGIRLCS 593
               ED+  PK++F+ DF+  N AM ++NNALVPD DK D L+S AW+WPTL+ G+R+CS
Sbjct: 546 -ETAEDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYDSLSSDAWEWPTLHKGLRMCS 604

Query: 594 WADDVRKYFLIGSPASTWPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGIY 653
           WA  + +Y+L+GSP +TW ST ++ +F  I ++ L +W+RQ  L+ + D      + GI+
Sbjct: 605 WAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRRQ-TLYLSDDQIWQITIQGIF 663

Query: 654 PLLGWGLHYLPFAVMGRVTYVHHYLPALYFALLILAYVFEASLRAARQSQKSYWKILVYV 713
           P + W  HYLPFA+MGRVTYVHHY+PALYFA+L+  +V + +L       + +W ++ Y 
Sbjct: 664 PFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDFTL------TRVHW-MVKYP 716

Query: 714 VYAVYYCTIICGFYYFYPITVGMEGPSS 741
           +Y   +   I  +  F PI  GM G  +
Sbjct: 717 IYLSLFGGCIYIYNLFAPICQGMHGDKA 744

>CAGL0K00979g complement(97306..99498) similar to sp|P42934
           Saccharomyces cerevisiae YGR199w
           Dolichyl-phosphate-mannose--protein mannosyltransferase
           6, hypothetical start
          Length = 730

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/723 (45%), Positives = 445/723 (61%), Gaps = 24/723 (3%)

Query: 31  KASAEDGAGVQEEDVSKLREVQQERNPLYKLEAFVMPVLFTLLALYTRMHKIGANNRVVW 90
           K + E     +E    + + V +  N   K    +  + FT+L+   R   I  NN VVW
Sbjct: 5   KLADEKTTETKENTPDQTKVVPRACN-FAKYRDLIACLGFTVLSFVLRFQGIDKNNSVVW 63

Query: 91  DEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIAGYNGSWDFPSGEEYPEYIDYVKM 150
           DEAHFGKFGSYY+RHEFYHDVHPPLGKML+ LS ++AG++G +DF SG +YP+ +++  M
Sbjct: 64  DEAHFGKFGSYYIRHEFYHDVHPPLGKMLIALSEWLAGFDGEFDFESGHQYPDGVNFKFM 123

Query: 151 RMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSILVVFENSYATLGRFILLDSMLLFFTV 210
           R FNA F A+C PV +FT K +  S P V+L +++V  E+S+  L +FILLDSMLLFFT 
Sbjct: 124 RQFNATFGALCTPVVFFTAKTMNLSWPIVYLVTLMVTLEHSFIALSKFILLDSMLLFFTA 183

Query: 211 CSFYTFVLFHNERHRPFGRKWWKWLFFLGVSLGCTISVKMVGLFIISVVGIYTVVDLWNK 270
            +F   V     R     R+W  WL   G+S+GC  SVK VGLFI  VVG++T++DL   
Sbjct: 184 TTFACMVKLIQLRGCQLTRQWLWWLLLTGLSIGCVCSVKWVGLFITLVVGLFTIIDLLEH 243

Query: 271 LSEPNMSVSRFAGHFSARALCLIVVPFMVFLFCFKLHFEFLSVSGTGDAMMPSLFQAGLS 330
                 S   +  H+  R + LI++PF+V+LFCFK+HF  L  SGTGDA   SLFQ  L 
Sbjct: 244 YWNKKESRKIYYKHWILRIINLIIIPFLVYLFCFKIHFLLLYKSGTGDASTNSLFQVNLE 303

Query: 331 GSSVGIGPRDIAVGSSLVSIKNQALGGTLLHSHVQTYPSGSSQQQVTTYGHNDSNNNWV- 389
           G+ +   PR +  GS  V+I++  L   LLHSHVQ YP GS Q+QVT YGH+D NNNW+ 
Sbjct: 304 GTQIQNSPRTVMYGSE-VTIRSHGLSPNLLHSHVQLYPDGSRQRQVTGYGHSDGNNNWMI 362

Query: 390 -FDRIRGLPAWSINET---EHEFVQDGRPYRLVHANTGRNLHTHPIPAPVSKTHWEVSGY 445
            F R  G      N+    E   V+DG   RL H   G NLH+H I + VSK ++EVSGY
Sbjct: 363 KFGRTTGRYLDEDNKRLNGELVPVRDGDTIRLFHVRMGCNLHSHTISSHVSKGNYEVSGY 422

Query: 446 GDAQVGDPKDNWIIEFVSQPSD-------EDKSVLHTISTSFRIKNVEMGCYLAQTGPSL 498
           G  +VGD KD+WIIE + Q          ED  VLH IST FR+++ ++GCYLA TG S 
Sbjct: 423 GSEEVGDEKDDWIIEIMEQLDSANTNFGKEDNEVLHPISTMFRLRHKDLGCYLASTGLSY 482

Query: 499 PEWGFRQGEVACISNPFKRDKRTWWNIETNVNERLPPMPEDFKYPKTSFFKDFVHLNLAM 558
           P WGF Q E+ C  +  KRDK TWWN+E + N++L  + E++  PK+ F+ DF+ +N AM
Sbjct: 483 PTWGFHQAEIVCKYSWGKRDKSTWWNVEDHWNDQL-VVDEEYVPPKSKFWTDFILINFAM 541

Query: 559 MATNNALVPDPDKLDQLASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPASTWPSTAAVG 618
            ++NNALVPD DK D LAS AW+WP L+ G+RLC W+    +Y+L+GSP +TW S+ A+ 
Sbjct: 542 ASSNNALVPDEDKYDYLASKAWEWPILHKGLRLCGWSSAGVRYYLLGSPFNTWLSSIALL 601

Query: 619 VFCLITVYYLLKWQRQLVLFQASDDANIFLMGGIYPLLGWGLHYLPFAVMGRVTYVHHYL 678
           V  L+ +   +KW+RQ ++    +         ++P L W  +++P+ +MGRVTYVHHY+
Sbjct: 602 VNILLGMVVAIKWRRQSIVIN-EESCWKLFTLLLFPFLAWLANFMPYVMMGRVTYVHHYM 660

Query: 679 PALYFALLILAYVFEASLRAARQSQKSYWKILVYVVYAVYYCTIICGFYYFYPITVGMEG 738
           PALYFA++    + E  L A   + K++   L  V      CT I  ++YF PI  G+ G
Sbjct: 661 PALYFAIIAFGSITEY-LLADYCTVKAFLAFLSMVG-----CTYI--YWYFAPICQGLHG 712

Query: 739 PSS 741
             S
Sbjct: 713 IGS 715

>Scas_408.1*
          Length = 391

 Score =  340 bits (872), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 230/326 (70%), Gaps = 1/326 (0%)

Query: 61  LEAFVMPVLFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLV 120
           + +++ P+L T+L+   R H IG NN VVWDEAHFGKFGSYY+ HEFYHDVHPPLGKML+
Sbjct: 61  MRSYIGPLLLTILSFQLRFHDIGKNNHVVWDEAHFGKFGSYYITHEFYHDVHPPLGKMLI 120

Query: 121 GLSGYIAGYNGSWDFPSGEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVW 180
            LS Y+AG++G ++F S E YPE ++Y+ MR FNA+F A+C PV  FT +++GF+  T +
Sbjct: 121 ALSEYLAGFDGHFNFDSNEAYPEEVNYIFMRQFNAMFGALCVPVTLFTTRSMGFNWLTSY 180

Query: 181 LFSILVVFENSYATLGRFILLDSMLLFFTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGV 240
           L +++V  E+SY  L +FILLDS+LLFFT+ +F   V  +  + R   ++W  W+   G+
Sbjct: 181 LVTLMVTLEHSYIVLSKFILLDSILLFFTLTTFACMVKLYTLKKRQLTKQWSLWMLLTGL 240

Query: 241 SLGCTISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVSRFAGHFSARALCLIVVPFMVF 300
           S+GC  SVK VGLFI  +VG++T+++L+    +  +   ++  H+  R + LI++PF+++
Sbjct: 241 SVGCVCSVKWVGLFITIIVGLFTIMELFTHHYDKTLPRVKYYKHWMIRIIDLIIIPFLIY 300

Query: 301 LFCFKLHFEFLSVSGTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLL 360
           +FCFK+HF  L  SGTGD+   +LFQ  L G+++  GPRD+  GS  V+I++  L   LL
Sbjct: 301 MFCFKIHFTLLYKSGTGDSATNTLFQVNLEGTTIENGPRDVMYGSE-VTIRSHGLSPNLL 359

Query: 361 HSHVQTYPSGSSQQQVTTYGHNDSNN 386
           HSHVQ YP GS Q+Q+T YGH+DS++
Sbjct: 360 HSHVQLYPDGSRQRQITGYGHSDSSS 385

>Kwal_23.3623
          Length = 876

 Score =  352 bits (902), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 232/702 (33%), Positives = 363/702 (51%), Gaps = 42/702 (5%)

Query: 49  REVQQERNPLYKLEAFVMPVLFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFY 108
           + +++ R P    E   +  L  +  +  R++ +   N VV+DE HFG F + Y++  F+
Sbjct: 81  QTLKESRTPTSVKEKVTIAALAVITGV-IRLYGLSNPNSVVFDEVHFGGFAAKYIKGIFF 139

Query: 109 HDVHPPLGKMLVGLSGYIAGYNGSWDFPS-GEEYPEYIDYVKMRMFNAVFSAMCAPVAYF 167
            DVHPPL KML    G IAG+ G +DF   G+ +PE   Y  MR+F A+   +   + Y 
Sbjct: 140 MDVHPPLAKMLFAAIGSIAGFTGDFDFEKIGQHFPESTPYYFMRLFPALLGTLTVLLMYL 199

Query: 168 TGKAIGFSLPTVWLFSILVVFENSYATLGRFILLDSMLLFFTVCSFYTFVLFHNERHRPF 227
           T +  G  +P  ++ S+    ENS+ T+ R+ILLD+ LLFF   + Y+F     +++  +
Sbjct: 200 TLRCSGVRIPIAFIASLCFAIENSFVTISRYILLDAPLLFFIASAVYSF-----KKYEIY 254

Query: 228 GRKWW---KWLFFLGVSLGCTISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVSRFAGH 284
            +  W   K L   G++LG  +S K VGLF I+ VG+  +  LW  + + +  +S     
Sbjct: 255 PQGSWGSLKALLSGGLALGMALSSKWVGLFTIAWVGVLCIWRLWFMVGDLSKPLSSTLKE 314

Query: 285 FSARALCLIVVPFMVFLFCFKLHFEFLSVSGTGDAMMPSLFQAGLSGSSVGIGPRDI--- 341
            S + +  + +P  ++   F +HFE L+++  G     S F+  L G+++   P+DI   
Sbjct: 315 ASRKLMFFLALPLALYAVFFYVHFETLTINSDGAGFFSSAFRTTLHGNTI---PKDILAD 371

Query: 342 -AVGSSLVSIKNQALGGTLLHSHVQTYPSGSSQQQVTTYGHNDSNNNWVFDRIRGLPAWS 400
             +GS+ +S+++ A  G  LHSH   Y  GS QQQVT Y H D NN+WV + +   P  +
Sbjct: 372 VGIGST-ISMRHVATMGGYLHSHNHMYEKGSQQQQVTLYPHLDGNNDWVIE-LPDQPNKA 429

Query: 401 INETEHEFVQDGRPYRLVHANTGRNLHTHPIPAPVSKT---HWEVSGYG-DAQVGDPKDN 456
           +  T  E ++DG   RL HA T R LH+H   APVS++     EVS YG +   GD  D+
Sbjct: 430 V--TSFEGLKDGTVIRLKHAITQRRLHSHDHKAPVSESADWQKEVSCYGFEDFEGDGNDD 487

Query: 457 WIIEF---VSQPSDEDKSVLHTISTSFRIKNVEMGCYLAQTGPSLPEWGFRQGEVACISN 513
           W IE     S+P +  K V   + T FR+K+  M C+L      LP+WGF Q EV C S 
Sbjct: 488 WTIEIDQDASEPGEAQKRV-KALDTKFRLKHNIMNCHLFSHEVKLPKWGFEQQEVTCASQ 546

Query: 514 PFKRDKRTWWNIETNVNERLPPMPEDFKYPKTSFFKDFVHLNLAMMATNNALVPDPDKLD 573
              +   T W IE N +  L    E   Y K +FF+  +  +  M   N  LV +P   +
Sbjct: 547 --GKPYLTLWYIEGNSHPLLTGDQERVSYKKPNFFEKLIESHQRMWHINKNLV-EPHIYE 603

Query: 574 QLASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPASTWPSTAAVGVFCLITVYYLLKWQR 633
              S    WP L  GI    W ++ ++ +L+G+    W  TA + +F  I V+ L  WQ 
Sbjct: 604 ---SKPHSWPFLLRGINY--WGENHKQVYLLGNAIVWWSVTAFIALFATIVVFELFAWQL 658

Query: 634 QLVLFQASDDANIFLMGGIYPLLGWGLHYLPFAVMGRVTYVHHYLPALYFALLILAYVFE 693
              + Q S   N F +  I+ LLG+GLHY+P  +MGR  ++HHYLPA YF +L  A+  +
Sbjct: 659 GKPILQDSKVVN-FHVQVIHYLLGYGLHYIPSFLMGRQLFLHHYLPAYYFGILAFAHALD 717

Query: 694 ASLRAARQSQKSYWKILVYVVYAVYYCTIICGFYYFYPITVG 735
            ++    + +    +++ Y V  V++  ++  F  +  +  G
Sbjct: 718 ITVTYVFRKR----EVIGYAVIGVFFSAVVYFFVSYRALIYG 755

>CAGL0L07216g complement(799529..802105) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase or sp|P52867 Saccharomyces
           cerevisiae YDL093w, hypothetical start
          Length = 858

 Score =  350 bits (897), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 232/709 (32%), Positives = 367/709 (51%), Gaps = 49/709 (6%)

Query: 44  DVSKLREVQQERNPLYKLEAFVMPVLFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYYL 103
           D +KLR V+  +  L       M  +  ++  + R++K+   + VV+DE HFG F S Y+
Sbjct: 48  DTAKLRTVKTLKEKL-------MVAILLIITAFVRLYKLSWPSSVVFDEVHFGGFASKYI 100

Query: 104 RHEFYHDVHPPLGKMLVGLSGYIAGYNGSWDF-PSGEEYPEYIDYVKMRMFNAVFSAMCA 162
           + +F+ DVHPPL KML    G +AGY G + F P GEEYP+ + +  MR+F+A       
Sbjct: 101 KGDFFMDVHPPLAKMLFAGVGALAGYTGDFSFKPIGEEYPDTVPFYTMRLFSASLGVFTV 160

Query: 163 PVAYFTGKAIGFSLPTVWLFSILVVFENSYATLGRFILLDSMLLFFTVCSFYTFVLFHNE 222
            + Y T +A G  L   +LF+++  FENS+ T+ R+ILLD+ L+ F   + Y++    +E
Sbjct: 161 LMLYLTLRASGVRLGVAYLFALVFAFENSFVTISRYILLDAPLICFIAAAVYSYK--KSE 218

Query: 223 RHRPFGRKWWKWLFFLGVSLGCTISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVSRFA 282
            +     +  K L   G++LG   S K VGLF ++ VG+  V  LW  + + N S     
Sbjct: 219 LYPTNSFRALKSLLATGIALGLASSSKWVGLFTVAWVGLLCVWKLWFMIGDLNKSPCTIV 278

Query: 283 GHFSARALCLIVVPFMVFLFCFKLHFEFLSVSGTGDAMMPSLFQAGLSGSSVGIGPRDIA 342
                + + L+ VP ++++  F +HF+ L   G+G +  PS F+A L G+ +   P D+ 
Sbjct: 279 KAAIGKLVLLLGVPILLYVAFFYVHFQALIHDGSGSSFFPSEFRATLEGNQI---PSDVV 335

Query: 343 --VG-SSLVSIKNQALGGTLLHSHVQTYPSGSSQQQVTTYGHNDSNNNWVFDRIRGLPAW 399
             VG  S+V++K+ +  G  LHSH   YP+GS QQQ+T Y   D NN WV +R   LP  
Sbjct: 336 YDVGVGSIVTLKHLSTEGGYLHSHSHAYPTGSEQQQITLYPFLDDNNKWVIERSH-LPGA 394

Query: 400 SINETEHEFV--QDGRPYRLVHANTGRNLHTHPIPAPVSKT-HW--EVSGYGDAQ-VGDP 453
           S+     +F+  ++G    L+H  TG  LH+H    PVS++  W  EVSGYG     GD 
Sbjct: 395 SLK----DFIGLKNGESISLLHLATGVRLHSHDHKPPVSESADWQKEVSGYGYLGFTGDI 450

Query: 454 KDNWIIEFVSQPSDEDKSVLH---TISTSFRIKNVEMGCYLAQTGPSLPEWGFRQGEVAC 510
            D+W IE + Q S +     H    I T F++++   GCYL      LP+WGF Q EV C
Sbjct: 451 NDHWTIE-IDQSSSKPGIAQHEVRAIDTKFKLRHA-TGCYLFSHEVKLPKWGFDQQEVTC 508

Query: 511 ISNPFKRDKRTWWNIETNVNERLPPMPEDFKYPKTSFFKDFVHLNLAMMATNNALVPDPD 570
            +    + +   W IE + N +LP       Y   +F + F+  +  M   N  L     
Sbjct: 509 ATQ--GKPELLLWYIEGSENPQLPENTPRISYKPMNFIEKFIENHKKMWKINKGLT---- 562

Query: 571 KLDQLASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPASTWPSTAAVGVFCLITVYYLLK 630
                 S A++WP +  GI    W +  RK +L+G+  + W  +A + V+  I  +    
Sbjct: 563 GTHYYESLAYEWPLMRRGIGY--WGEHHRKIYLLGNAVTWWAVSAFILVYAAILAFEAGS 620

Query: 631 WQRQLVLFQASDDANIFLMGGIYPLLGWGLHYLPFAVMGRVTYVHHYLPALYFALLILAY 690
           +     + Q  +  N F +  ++ LLG+ +HY+PF +MGR  ++HHYLPA YF +L LA+
Sbjct: 621 FLVGKPILQDKNVIN-FHVQVLHYLLGFAIHYVPFFLMGRQLFLHHYLPAYYFGILALAH 679

Query: 691 VFE--ASLRAARQSQKSYWKILVYVVYAVYYCTIICGFYYFYPITVGME 737
            F+   +     + Q +Y  ++++   ++Y+      F+   PI  G +
Sbjct: 680 AFDIIITFVCKNRKQAAYALLILFTAASIYF------FHAHSPIAYGTD 722

>KLLA0E01342g complement(134691..137207) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase, start by similarity
          Length = 838

 Score =  347 bits (891), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 241/722 (33%), Positives = 353/722 (48%), Gaps = 51/722 (7%)

Query: 44  DVSKLREVQQERNPLYKLEAFVMP------------------VLFTLLALYTRMHKIGAN 85
           DV  + ++Q E+ PL        P                  +   ++A   R+  +   
Sbjct: 16  DVDSVGDIQVEKGPLRPFLVTEPPKNLKSIRTMTSSKERLVVIALAVIASVVRLWNLSDP 75

Query: 86  NRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIAGYNGSWDFPS-GEEYPEY 144
           N VV+DE HFGKF + Y++  F+ DVHPPL KML    G +AG+ G ++F   G  +P  
Sbjct: 76  NSVVFDEVHFGKFAAKYIKGIFFTDVHPPLAKMLFAGIGSLAGFTGDFEFKDIGLAFPAS 135

Query: 145 IDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSILVVFENSYATLGRFILLDSM 204
             Y  MR F+A        + YFT +A G  +   ++ S++   ENS+ T+ R+ILLD+ 
Sbjct: 136 TPYFAMRFFSAFLGLATVLLMYFTLRASGIRIWIAFVASLMFALENSFVTISRYILLDAP 195

Query: 205 LLFFTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGVSLGCTISVKMVGLFIISVVGIYTV 264
           L+FF   + Y++  +       F    +K L   G+SLG  +S K VGLF I+ VG  ++
Sbjct: 196 LIFFIAAAAYSYKKYEIHPSESFNS--YKALLATGLSLGLAVSSKWVGLFTIAWVGALSL 253

Query: 265 VDLWNKLSEPNMSVSRFAGHFSARALCLIVVPFMVFLFCFKLHFEFLSVSGTGDAMMPSL 324
             LW  + +    V     H   +A  L+  P  ++LF F +HF+ L  +  G     S 
Sbjct: 254 FKLWFDIGDLKKPVQSTLRHTVVKATLLLAAPAALYLFFFYIHFQTLIYNSDGAGFFSSA 313

Query: 325 FQAGLSGSSVGIG-PRDIAVGSSLVSIKNQALGGTLLHSHVQTYPSGSSQQQVTTYGHND 383
           F++ L G+++    P D+ VGSS VSI++    G  LHSH   Y +GS QQQVT Y H D
Sbjct: 314 FRSTLIGNNIPSNIPYDVGVGSS-VSIRHTGTMGGYLHSHKHIYETGSKQQQVTLYSHLD 372

Query: 384 SNNNWV---FDRIRGLPAWSINETEHEFVQDGRPYRLVHANTGRNLHTHPIPAPVSK-TH 439
           +NN+WV   +D+   +P     ET  E ++DG   RL H  T R LH+H    PVS+ + 
Sbjct: 373 ANNDWVIELYDQPEVIP-----ET-FEGLKDGTKIRLRHRLTDRRLHSHDHKPPVSESSD 426

Query: 440 W--EVSGYG-DAQVGDPKDNWIIEFVSQPS--DEDKSVLHTISTSFRIKNVEMGCYLAQT 494
           W  EVS YG D   GD  D+W+IE   + S   E +  +  + T FR+++   GC L   
Sbjct: 427 WQKEVSAYGADNFTGDANDDWVIEIDHEASAPGEAQEYVKALDTKFRLRHAMTGCRLFSH 486

Query: 495 GPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVNERLPPMPEDFKYPKTSFFKDFVHL 554
              LP+WGF Q EV C S+       T W +E N N  LP       Y   +F + F+  
Sbjct: 487 EVKLPKWGFEQQEVTCASSGVP--SLTLWYVEHNSNPLLPEDAAKISYQTPTFLEKFIES 544

Query: 555 NLAMMATNNALVPDPDKLDQLASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPASTWPST 614
           +  M   N  L     +     S    WP L  GI    W+ D ++ +L+G+    W  T
Sbjct: 545 HQRMWHINKNL----KEHHVYQSDPATWPLLLRGI--SYWSQDHKQIYLLGNAVVWWSVT 598

Query: 615 AAVGVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGIYPLLGWGLHYLPFAVMGRVTYV 674
           A +GVF L+ V  LL WQ    + Q     N  +    Y LLGWGLHY P  +MGR  ++
Sbjct: 599 AFIGVFVLVIVAELLAWQLGKSILQDKHVLNFHIQTFQY-LLGWGLHYAPSFLMGRQLFL 657

Query: 675 HHYLPALYFALLILAYVFEASLRAARQSQKSYWKILVYVVYAVYYCTIICGFYYFYPITV 734
           HHYLPA YF +L  A+  E  +    +++K+    + Y V   +       FY + P+  
Sbjct: 658 HHYLPAYYFGILAFAHALEIIVSYVFKNKKT----VGYGVVITFLAAATAFFYVYKPLIY 713

Query: 735 GM 736
           G+
Sbjct: 714 GL 715

>YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase
           (dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase), first step in O-glycosylation
           [2454 bp, 817 aa]
          Length = 817

 Score =  335 bits (860), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 227/685 (33%), Positives = 349/685 (50%), Gaps = 42/685 (6%)

Query: 68  VLFTLLALYT---RMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG 124
           +L   LA++T   R+H +   + VV+DE HFG F S Y+R  ++ DVHPPL KML     
Sbjct: 51  LLVACLAVFTAVIRLHGLAWPDSVVFDEVHFGGFASQYIRGTYFMDVHPPLAKMLYAGVA 110

Query: 125 YIAGYNGSWDFPS-GEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFS 183
            + G+ G +DF + G+ +P    YV MR F+A   A+   + Y T +  G  +    + +
Sbjct: 111 SLGGFQGDFDFENIGDSFPSTTPYVLMRFFSASLGALTVILMYMTLRYSGVRMWVALMSA 170

Query: 184 ILVVFENSYATLGRFILLDSMLLFFTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGVSLG 243
           I    ENSY T+ R+ILLD+ L+FF   + Y+F  +  E +       +K L   G++LG
Sbjct: 171 ICFAVENSYVTISRYILLDAPLMFFIAAAVYSFKKY--EMYPANSLNAYKSLLATGIALG 228

Query: 244 CTISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVSRFAGHFSARALCLIVVPFMVFLFC 303
              S K VGLF ++ VG+  +  LW  + +   S         A+   L+ VPF ++L  
Sbjct: 229 MASSSKWVGLFTVTWVGLLCIWRLWFMIGDLTKSSKSIFKVAFAKLAFLLGVPFALYLVF 288

Query: 304 FKLHFEFLSVSGTGDAMMPSLFQAGLSGSSVGIGPR----DIAVGSSLVSIKNQALGGTL 359
           F +HF+ L++ G G +     F++ L  + +   P+    D+ +G S++S+++ +  G  
Sbjct: 289 FYIHFQSLTLDGDGASFFSPEFRSTLKNNKI---PQNVVADVGIG-SIISLRHLSTMGGY 344

Query: 360 LHSHVQTYPSGSSQQQVTTYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQDGRPYRLVH 419
           LHSH   YP+GS QQQ T Y H D+NN+W+ + +   P  S+  T  + + DG   RL H
Sbjct: 345 LHSHSHNYPAGSEQQQSTLYPHMDANNDWLLE-LYNAPGESL--TTFQNLTDGTKVRLFH 401

Query: 420 ANTGRNLHTHPIPAPVSK-THW--EVSGYGDAQV-GDPKDNWIIEF---VSQPSDEDKSV 472
             T   LH+H    PVS+ + W  EVS YG +   GD  D+W++E     S P    + V
Sbjct: 402 TVTRCRLHSHDHKPPVSESSDWQKEVSCYGYSGFDGDANDDWVVEIDKKNSAPGVAQERV 461

Query: 473 LHTISTSFRIKNVEMGCYLAQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVNER 532
           +  + T FR+++   GCYL      LP WGF Q EV C S+   R   T W +E N N  
Sbjct: 462 I-ALDTKFRLRHAMTGCYLFSHEVKLPAWGFEQQEVTCASS--GRHDLTLWYVENNSNPL 518

Query: 533 LPPMPEDFKYPKTSFFKDFVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTLNVGIRLC 592
           LP   +   Y   SF   F+  +  M   N  LV +P   +   +S   WP L  GI   
Sbjct: 519 LPEDTKRISYKPASFISKFIESHKKMWHINKNLV-EPHVYESQPTS---WPFLLRGISY- 573

Query: 593 SWADDVRKYFLIGSPASTWPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGI 652
            W ++ R  +L+G+    W  TA +G+F LI +  L  WQ    + + S   N F +  I
Sbjct: 574 -WGENNRNVYLLGNAIVWWAVTAFIGIFGLIVITELFSWQLGKPILKDSKVVN-FHVQVI 631

Query: 653 YPLLGWGLHYLPFAVMGRVTYVHHYLPALYFALLILAYVFEASLRAARQSQKS--YWKIL 710
           + LLG+ +HY P  +M R  ++HHYLPA YF +L L +  +  +    +S++   Y  ++
Sbjct: 632 HYLLGFAVHYAPSFLMQRQMFLHHYLPAYYFGILALGHALDIIVSYVFRSKRQMGYAVVI 691

Query: 711 VYVVYAVYYCTIICGFYYFYPITVG 735
            ++  +VY+      F  F PI  G
Sbjct: 692 TFLAASVYF------FKSFSPIIYG 710

>ADR279C [2020] [Homologous to ScYDL095W (PMT1) - SH; ScYDL093W
           (PMT5) - SH] (1177907..1180360) [2454 bp, 817 aa]
          Length = 817

 Score =  332 bits (851), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 222/675 (32%), Positives = 334/675 (49%), Gaps = 32/675 (4%)

Query: 73  LALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIAGYNGS 132
           +A   R++ +   + VV+DE HFG + S Y++  F+ DVHPPL KML+  +G +AGY G 
Sbjct: 58  VAAAVRLYNLAYPDSVVFDEVHFGGYASKYIQGAFFLDVHPPLAKMLLAGAGKLAGYGGE 117

Query: 133 WDFPS-GEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSILVVFENS 191
           + F   G +YP  + Y  MR   A    +   + + T +A G      +  S++   ENS
Sbjct: 118 FGFEDIGIDYPATVPYQVMRFLPAALGVLTVLLMFLTLRASGVRKWVAFAVSLVFTVENS 177

Query: 192 YATLGRFILLDSMLLFFTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGVSLGCTISVKMV 251
           + T+ R+ILLDS LLFF   + Y+F     E H+    +++K L   G++LG  +S K V
Sbjct: 178 FVTISRYILLDSPLLFFIAAAVYSFKRL--ELHQTGSLQYYKCLAATGMALGLAMSSKWV 235

Query: 252 GLFIISVVGIYTVVDLWNKLSEPNMSVSRFAGHFSARALCLIVVPFMVFLFCFKLHFEFL 311
           G F  + VG+ +V+ LW ++ + N  V       + +A  L V+P  +++  F++HF+ L
Sbjct: 236 GFFTFAWVGVVSVMQLWFQVGDLNKPVPSILKQSAIKASILCVLPMCLYVLFFRIHFQSL 295

Query: 312 SVSGTGDAMMPSLFQAGLSGSSVGIGPRDIAVG---SSLVSIKNQALGGTLLHSHVQTYP 368
                      S F+  L G ++   P +I  G    S V+I++    G  LHSH   Y 
Sbjct: 296 PNVTDAAGNFSSAFRTTLHGHTI---PANIYAGVGIGSTVTIRHIGTMGGYLHSHNHMYQ 352

Query: 369 SGSSQQQVTTYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQDGRPYRLVHANTGRNLHT 428
            GS QQQVT Y H D NN+W  +      A +   T  E ++ G   RL H  TG  LH+
Sbjct: 353 GGSEQQQVTLYPHLDQNNHWYIEHYN---ASNTVPTTFEGLEHGTKIRLKHVLTGHRLHS 409

Query: 429 HPIPAPVS-KTHW--EVSGYGDAQV-GDPKDNWIIEFVSQPSD--EDKSVLHTISTSFRI 482
           H    PVS  + W  EVSGYG  +  GD  D+WI+E   + S   E +  +  I T FR+
Sbjct: 410 HDHKPPVSVSSDWQKEVSGYGFPEFEGDANDDWIVEIDQEKSTPGEARERVRAIETKFRL 469

Query: 483 KNVEMGCYLAQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVNERLPPMPEDFKY 542
           ++   GC L      LP+WGF Q EV C +    R   T W IE N N  L    E   Y
Sbjct: 470 RHAMTGCMLFSHQVKLPKWGFEQQEVTCATQ--GRPDLTLWYIEENTNPLLSEDSEKISY 527

Query: 543 PKTSFFKDFVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTLNVGIRLCSWADDVRKYF 602
              +F++  V ++  M   N +L           S   QWP L  GI    W+ D R+ +
Sbjct: 528 KTPNFWEKLVEIHRKMWHINKSLT----DAHMYQSDPIQWPFLLRGISY--WSKDSRQVY 581

Query: 603 LIGSPASTWPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGIYPLLGWGLHY 662
           L+G+    +  T  V +F LI V  L  WQ    +   +   N F +  I+ LLG+ +HY
Sbjct: 582 LLGNAVVWYSVTLFVVIFGLICVGELFVWQLGKPILSDTKILN-FHIQTIHYLLGYFIHY 640

Query: 663 LPFAVMGRVTYVHHYLPALYFALLILAYVFEASLRAARQSQKSYWKILVYVVYAVYYCTI 722
           LP  +MGR  ++HHYLPA YF +L LA+  +  +    + +      + Y + A++    
Sbjct: 641 LPSFLMGRQMFLHHYLPAYYFGILALAHGLDGLVTFLNRKRP-----IAYGLVAMFVLGS 695

Query: 723 ICGFYYFYPITVGME 737
           I  F  + P+  G++
Sbjct: 696 IAFFVTYSPLVYGLQ 710

>YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT
           O-mannosyltransferases family [2232 bp, 743 aa]
          Length = 743

 Score =  311 bits (796), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 213/687 (31%), Positives = 335/687 (48%), Gaps = 32/687 (4%)

Query: 43  EDVSKLREVQQERNPLYKLEAFVMPVLFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYY 102
           +++S LR V   +      E  ++  L    A+  R+H I   N VV+ E   G F S Y
Sbjct: 32  DNLSSLRTVTSSK------EKLLVGCLLIFTAI-VRLHNISLPNSVVFGENEVGTFVSQY 84

Query: 103 LRHEFYHDVHPPLGKMLVGLSGYIAGYNGSWDFPS-GEEYPEYIDYVKMRMFNAVFSAMC 161
           + + F+ DVHPPL  ML      + GY G +++ + G EY   + YV MR F+A    + 
Sbjct: 85  VNNIFFTDVHPPLVAMLYATVSSVFGYKGLFNYGNIGTEYTANVPYVAMRFFSATLGIVS 144

Query: 162 APVAYFTGKAIGFSLPTVWLFSILVVFENSYATLGRFILLDSMLLFFTVCSFYTFVLFHN 221
             V Y T +  G  +    + ++    ENS+ TL RF L++   +FF  C+ Y F    +
Sbjct: 145 VLVLYLTLRVSGVKIAVAAICAVCFAIENSFVTLSRFTLIEGPFVFFMACAVYFFR--RS 202

Query: 222 ERHRPFGRKWWKWLFFLGVSLGCTISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVSRF 281
           E + P   K  K L    ++LG  +S K  GLF I+  GI  +  +W  + + +  +   
Sbjct: 203 ELYLPNSCKANKSLLAASIALGFAVSSKWAGLFTIAWAGIIVLWRVWFMIGDLSRPIGSS 262

Query: 282 AGHFSARALCLIVVPFMVFLFCFKLHFEFLSVSGTGDAMMPSLFQAGLSGSSV-GIGPRD 340
             + + +  CL+ +P  ++   F +H + L+V+G   +  P+ F+  L  ++V      +
Sbjct: 263 IKYMAFQFTCLLAIPAFIYFLIFSVHIKTLNVNGISSSFFPAEFRKTLKYNNVIKETVAE 322

Query: 341 IAVGSSLVSIKNQALGGTLLHSHVQTYPSGSSQQQVTTYGHNDSNNNWVFDRIRGLPAWS 400
           +AVGS+ VS+ +    G  LHSH+  YP+GS QQQVT Y H D NN W+ + +   P  +
Sbjct: 323 VAVGSA-VSLNHVGTAGGYLHSHLHNYPAGSMQQQVTLYPHIDQNNKWIIE-LAEHP--N 378

Query: 401 INETEHEFVQDGRPYRLVHANTGRNLHTHPIPAPVSKT-HW--EVSGYG-DAQVGDPKDN 456
            N T  + + DG   +L     G  LH+H    PVS+   W  EVS YG +   GD  D+
Sbjct: 379 ENVTSFQNLTDGTIIKLRQLKNGCRLHSHDHKPPVSQNADWQKEVSCYGYEGFEGDINDD 438

Query: 457 WIIEFVSQPSDEDKSVLH--TISTSFRIKNVEMGCYLAQTGPSLPEWGFRQGEVACISNP 514
           WIIE   + S+   +  H   I T FR+K+   GCYL      LPEWGF Q EV C    
Sbjct: 439 WIIEIDKKRSEPGPAQEHIRAIETKFRLKHYLTGCYLFSHPEKLPEWGFGQQEVTCAY-- 496

Query: 515 FKRDKRTWWNIETNVNERLPPMPEDFKYPKTSFFKDFVHLNLAMMATNNALVPDPDKLDQ 574
           F R+  T W IE N NE   P PE   Y K SF++ FV ++  M   NN +    D    
Sbjct: 497 FAREDLTSWYIEENENEISLPNPEKVSYKKMSFWQKFVAIHKFMFYLNNYM----DTSHA 552

Query: 575 LASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPASTWPSTAAVGVFCLITVYYLLKWQRQ 634
            +S    WP +  GI    W ++ R+ + +G+    W  TA +  F +     LL W+  
Sbjct: 553 YSSEPKTWPLMLRGIDF--WNENGREVYFLGNAVLWWSVTAFICTFIIGVAVELLAWKLG 610

Query: 635 LVLFQASDDANIFLMGGIYPLLGWGLHYLPFAVMGRVTYVHHYLPALYFALLILAYVFE- 693
           + + +     N       Y LLG+  HY P+  +G+  +++ YLPA YF +L   +  + 
Sbjct: 611 VNILRDKHIINFHYQVFQY-LLGFAAHYFPYFFVGQKLFLYDYLPAYYFGILAFGHALDL 669

Query: 694 -ASLRAARQSQKSYWKILVYVVYAVYY 719
            ++  + +++   Y  + +++V   Y+
Sbjct: 670 ISTYISNKRNNTGYIVVAIFMVVCFYF 696

>KLLA0B03762g 339424..341742 similar to sp|P46971 Saccharomyces
           cerevisiae YJR143c PMT4
           dolichyl-phosphate-mannose--protein O-mannosyl
           transferase, start by similarity
          Length = 772

 Score =  288 bits (738), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 224/700 (32%), Positives = 328/700 (46%), Gaps = 51/700 (7%)

Query: 19  QRHEAGPANKRGKASAEDGAGVQEEDVSKLREVQQERNPLYKLEAFVMPVLFTLLALYTR 78
           ++ E     K GK +   G G++      L     +   LYK    VM  L T LAL  R
Sbjct: 21  EKDEIDKYVKSGKFNEGKGTGIEYIAEKWLLRSAPDSATLYK----VMNYLVTGLALVLR 76

Query: 79  MHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIAGYNGSWDFPS- 137
           + +I     VV+DE HFGKF SYYL   ++ DVHPP+ KML+   G++ GYNGS+ F   
Sbjct: 77  LWRISEPREVVFDEVHFGKFASYYLERTYFFDVHPPMAKMLIAAIGWLTGYNGSFKFDDI 136

Query: 138 GEEYPE-YIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSILVVFENSYATLG 196
           G  Y   Y  +V  R  +AV   +   V + T K + F   T ++ + L+  +N++ T  
Sbjct: 137 GYSYDTYYAPFVAYRSLSAVLGVLTVSVVFQTMKELNFKAVTCFIAAFLIAVDNAHVTDT 196

Query: 197 RFILLDSMLLFFTVCSFYTFVLFHN-ERHRPFGRKWWKWLFFLGVSLGCTISVKMVGLFI 255
           R ILLD+ML+F    S Y +V F+  +   PF  +W+ WL+  G SL   +S K VGL  
Sbjct: 197 RLILLDAMLIFSIALSIYCYVRFYKLQLTSPFSSEWYLWLYLTGFSLSMVMSTKYVGLLT 256

Query: 256 ISVVGIYTVVDLWNKLS-EPNMSVSRFAGHFSARALCLIVVPFMVFLFCFKLHFEFLSVS 314
              +G+  VV+LW  L     +S+ +   H   R   LI+ PF+V+LF F  HF  L+ S
Sbjct: 257 YCTIGLAVVVNLWQLLDIRSGLSMRKVVKHTLVRINGLIIFPFVVYLFWFWCHFAILNQS 316

Query: 315 GTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLLHSHVQTYPS----- 369
           G GDA M S FQ  L  +   +  + I     +++IK++A     LHSH+  YP      
Sbjct: 317 GPGDAFMSSDFQDTLLDAPGAVEIKSINY-HDIITIKHKATDA-FLHSHLAKYPVRYEDG 374

Query: 370 --GSSQQQVTTYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQDGRPYRLVHANTGRNLH 427
              S+ QQVT Y H D NN W       LP       +   V+     RL H  T   L 
Sbjct: 375 RISSNGQQVTCYSHEDINNQW-----EILPPSGSKFKKGAPVKLDADIRLRHVGTNTYLL 429

Query: 428 THPIPAPVSKTHWEVSGYGDAQV-GDPKDNWIIEFVSQPSDEDKSVLHTISTSFRIKNVE 486
            H + +P   T+ EV+   + +  G+  D  +  F          V  T +++FRI +V+
Sbjct: 430 AHDVASPYYPTNEEVTTVSEEEANGESYDFTLFRFQPILPKNSGRVAKTKNSAFRIFHVQ 489

Query: 487 MGCYL-AQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVNERLPPMPED----FK 541
               L       LPEWGF Q EV    N   +D    W +++ VN     MPE+      
Sbjct: 490 TAVALWTHNDKLLPEWGFSQQEVN--GNKKVQDPENNWFVDSIVN-----MPENDSRRIY 542

Query: 542 YPKT----SFFKDFVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTLNVGIRLCSWADD 597
            PK      FF+ +  L   M   NN L  +       AS+   WP    G+   +  + 
Sbjct: 543 TPKVPTSMPFFQKWYELQFLMFEHNNKLSSE----HPFASNPQSWPLSLSGVSFWTKEEG 598

Query: 598 VRKYFLIGSPASTWPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGI-YPLL 656
            ++ F  G+    W    +V ++  + V  L+   RQ  ++  +  A   L G + + + 
Sbjct: 599 RKQIFFTGNIVGWWFEIVSVALYLGLVVADLI--TRQRAVYALNKMARQKLYGPMAFLIF 656

Query: 657 GWGLHYLPFAVMGRVTYVHHYLPALYFALLILAYVFEASL 696
           GW +HY PF +M R  ++HHYLP    A LILA +F A+L
Sbjct: 657 GWCIHYFPFFLMARQKFLHHYLP----AHLILA-MFSAAL 691

>ABL085W [507] [Homologous to ScYJR143C (PMT4) - SH]
           complement(237967..240240) [2274 bp, 757 aa]
          Length = 757

 Score =  284 bits (726), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 204/697 (29%), Positives = 328/697 (47%), Gaps = 45/697 (6%)

Query: 19  QRHEAGPANKRGKASAEDGAGVQEEDVSKLREVQQ---ERNPLYKLEAFVMPVLFTLLAL 75
           ++ +   + +R  ++A+ G      +    R +Q+   + N  YK   +++    T +A 
Sbjct: 4   KKSQKAASVERDDSAAKRGKAEGRYEYMGERWLQRPAPDSNLKYKYYGYMV----TAIAF 59

Query: 76  YTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIAGYNGSWDF 135
             R HK+   + VV+DE HFGK  SYYL   ++ DVHPP  KML+   G++ GY+G++ F
Sbjct: 60  AVRFHKLYHPSEVVFDEVHFGKCASYYLERTYFFDVHPPFSKMLIAFVGWLVGYDGAFKF 119

Query: 136 PS-GEEYPEY-IDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSILVVFENSYA 193
              G  Y  + + Y+  R  +A+   +  P+ +   + + F   T    ++LV  +N++ 
Sbjct: 120 DDIGYSYETHQVPYIAYRSLSAILGTLTVPLVFSILRELNFKAITCAFGALLVAVDNAHV 179

Query: 194 TLGRFILLDSMLLFFTVCSFYTFVLFHNERHR-PFGRKWWKWLFFLGVSLGCTISVKMVG 252
              R ILLD+ L+     S YT++ F+  + R P   +W+ WL+  G+SL   IS K VG
Sbjct: 180 IDSRLILLDATLVISVALSIYTYIRFYKAQLRAPLSSEWYFWLYATGLSLSFVISTKYVG 239

Query: 253 LFIISVVGIYTVVDLWNKLS-EPNMSVSRFAGHFSARALCLIVVPFMVFLFCFKLHFEFL 311
           +F  +++G   +V+LW  L     +S+  F  HF  R   L+  PF V+LF F +HF  L
Sbjct: 240 VFTFAMIGTAVIVNLWQLLDVRAGLSLRMFFRHFVQRFNGLVCFPFAVYLFWFYVHFAIL 299

Query: 312 SVSGTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLLHSHVQTYP--- 368
           + SG GD  M S FQ  L+ S +    +D+     +V+ +++  G  LLHSH   YP   
Sbjct: 300 TKSGPGDDFMSSAFQETLADSPLAKDSKDVHY-YDIVTFQHRDTGA-LLHSHNAYYPLRY 357

Query: 369 ----SGSSQQQVTTYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQDGRPYRLVHANTGR 424
                 S  QQVT Y H D NN W       LP   ++    + V      RL H  TG 
Sbjct: 358 EDGRVSSQGQQVTGYSHEDINNQWEI-----LPTKELSSRTGQPVLLDDVLRLRHIATGT 412

Query: 425 NLHTHPIPAPVSKTHWEVSGYGDAQVGDPKDNWIIEFVSQPSDEDKSVLHTISTS---FR 481
            L TH + +P   T+ EV+   +      +    +  +  P+ +D    HT+ +    FR
Sbjct: 413 YLLTHDVASPYYPTNEEVTTISEELANGERYKQTLFKLQPPNKKDGG--HTVKSKTSMFR 470

Query: 482 IKNVEMGCYL-AQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVN---ERLPPMP 537
           + +V+    L       LPEWGF+Q EV    N    D    W + + +N   ER   +P
Sbjct: 471 MFHVDTAVALWTHNDVFLPEWGFKQQEVN--GNKKVTDPANIWTVNSILNLSEERKVYIP 528

Query: 538 EDFKYPKTSFFKDFVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTLNVGIRLCSWADD 597
           +  K  K  FF  ++ L  +M   NN L  +       AS    WP    G+   +   +
Sbjct: 529 K--KVTKMPFFSKWLELQRSMFEHNNKLSSE----HPFASQPESWPGSLSGVSFWTNDTE 582

Query: 598 VRKYFLIGSPASTWPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGI-YPLL 656
            R+ +  G+    W    ++ +F  I +   +  QR   +        I+  G + +  +
Sbjct: 583 RRQIYFTGNIIGWWIELISLALFVGILLADAITRQRSFFVLGKLAREKIY--GPLCFLYI 640

Query: 657 GWGLHYLPFAVMGRVTYVHHYLPALYFALLILAYVFE 693
           GW +HY PF +MGR  ++HHYLPA   A +  A ++E
Sbjct: 641 GWAIHYFPFFLMGRQKFLHHYLPAHLIAAMFTAGLWE 677

>CAGL0M00220g 28137..30434 similar to sp|P46971 Saccharomyces
           cerevisiae YJR143c PMT4
           dolichyl-phosphate-mannose--protein O-mannosyl
           transferase, hypothetical start
          Length = 765

 Score =  282 bits (721), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 213/708 (30%), Positives = 330/708 (46%), Gaps = 64/708 (9%)

Query: 24  GPANKRGKASAEDGAGVQEEDVSK----------------LREVQQERNPLYKLEAFVMP 67
            P  K+  +SA   + V  +DVS                 L   + + +  Y+L  +   
Sbjct: 7   SPGTKKFGSSASKESSVDVDDVSLKYNKGVAATEQLAQNWLLNPKPDSDNSYRLGFY--- 63

Query: 68  VLFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIA 127
            L T +A   R +KI     VV+DE HFGKF SYYL   F+ DVHPPL KM++   G++ 
Sbjct: 64  -LVTAIAFAVRFYKIYYPREVVFDEVHFGKFASYYLERTFFFDVHPPLAKMMIAFIGWLC 122

Query: 128 GYNGSWDFPS-GEEYPEY-IDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSIL 185
            Y+GS+ F   G  Y ++   ++  R FNA+   +   + + + K + F   T +L S+L
Sbjct: 123 NYDGSFKFEEIGLSYDKHPAPFLAYRSFNALLGTLTVSIMFESMKELNFKAITCFLASML 182

Query: 186 VVFENSYATLGRFILLDSMLLFFTVCSFYTFVLFHN-ERHRPFGRKWWKWLFFLGVSLGC 244
           V  +N++ T  R ILLD++LL     + Y+++ F+  +   PF   W+ WL+  G SL C
Sbjct: 183 VAIDNAHVTETRLILLDAILLISVAATVYSYIRFYKLQLKEPFSWNWYIWLYLTGFSLSC 242

Query: 245 TISVKMVGLFIISVVGIYTVVDLWNKLS-EPNMSVSRFAGHFSARALCLIVVPFMVFLFC 303
            IS K +G+   + +GI  VV+LW  L     +S+     H   R   LI++PF+++LF 
Sbjct: 243 VISTKYIGVMTYAAIGIPVVVNLWQLLDINAKLSIRMLIKHIGRRLNGLILIPFIIYLFW 302

Query: 304 FKLHFEFLSVSGTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLLHSH 363
           F +HF  L+VSG GD  M S FQ  L  S      +++     +V+ +NQ  G   LHSH
Sbjct: 303 FYVHFAILNVSGPGDVFMSSEFQDTLHDSEATKLSKEVQF-FDIVTFENQDTGA-FLHSH 360

Query: 364 VQTYP-------SGSSQQQVTTYGHNDSNNNW----VFDRIRGLPAWSINETEHEFVQDG 412
           +  YP         S  QQVT Y H D NN W    V D+ +G           + ++ G
Sbjct: 361 LARYPLRYEDDRVSSQGQQVTCYTHEDVNNQWEILPVADKAKG-----------DNIRFG 409

Query: 413 RPYRLVHANTGRNLHTHPIPAPVSKTHWEVSG-YGDAQVGDPKDNWIIEFVSQPSDEDKS 471
             +RL H  T   L  H + +P+  T+ E++  + D  +G   ++ I  F      ++  
Sbjct: 410 DEFRLRHVGTDSYLLAHDVASPLYPTNEEITTVHKDDALGARANSTIFRFQPINKKDEGH 469

Query: 472 VLHTISTSFRIKNVEMGCYL-AQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVN 530
           ++ + +   RI + E    L +     LP+WGF Q EV    N    D    W I++ +N
Sbjct: 470 IIKSKNAVLRIIHKETVVALWSHNDELLPDWGFGQQEVN--GNKKMTDSGNAWTIDSIMN 527

Query: 531 ---ERLPPMPEDFKYPKTSFFKDFVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTLNV 587
              +R    P++ K     FF  ++ L   M   NN L  +       AS    WP    
Sbjct: 528 LDEKRSAYAPKEIK--SMPFFNKWLELQKLMFEQNNKLTSE----HPFASQPESWPGSMS 581

Query: 588 GIRLCSWADDVRKYFLIGSPASTWPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIF 647
           G+   +  ++ R+ + IG+    W    +  V+  I +   +  QR    F  +      
Sbjct: 582 GVSFWTKNEERRQIYFIGNIIGFWFQVISFAVYVGIIIADQITRQRG--YFALNKVTREK 639

Query: 648 LMGGI-YPLLGWGLHYLPFAVMGRVTYVHHYLPALYFALLILAYVFEA 694
           L G + Y   GW  HY PF +MGR  ++HHYLPA   A L  A ++E 
Sbjct: 640 LYGPLAYLFCGWACHYFPFFLMGRQKFLHHYLPAHLIAALFAAGLWET 687

>Kwal_47.16734
          Length = 792

 Score =  276 bits (707), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 214/706 (30%), Positives = 327/706 (46%), Gaps = 57/706 (8%)

Query: 71  TLLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIAGYN 130
           TLLA   R  K+     VV+DE HFGKF SYYL   ++ DVHPP  KML+   G++ GYN
Sbjct: 90  TLLAAVVRFRKLSYPREVVFDEVHFGKFASYYLERTYFFDVHPPFAKMLIAFVGWLVGYN 149

Query: 131 GSWDFPS-GEEYPEY-IDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSILVVF 188
           G++ F   G  Y      +V  R  +A+   +  P+ + T K + F   T  L ++LV  
Sbjct: 150 GTFKFDDIGLSYDSNPAPFVAYRSLSAILGTLTVPIIFNTVKELNFRAVTCALAALLVAI 209

Query: 189 ENSYATLGRFILLDSMLLFFTVCSFYTFVLFHN-ERHRPFGRKWWKWLFFLGVSLGCTIS 247
           + ++    R ILLD+ LL    CS Y +V F+  +   PF   W+ WL+  G SL   +S
Sbjct: 210 DCAHVIDSRLILLDATLLIAVACSLYCYVRFYKIQLKAPFSSSWYLWLYLTGTSLSFVMS 269

Query: 248 VKMVGLFIISVVGIYTVVDLWNKLS-EPNMSVSRFAGHFSARALCLIVVPFMVFLFCFKL 306
            K +G+   + +G    V+LW  L     +++ +F  H   R   LI  PF+++LF F +
Sbjct: 270 TKYIGVMTYATIGSAVAVNLWQLLDVRAGLTIRQFVKHVLQRLNGLIFAPFVLYLFWFWV 329

Query: 307 HFEFLSVSGTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLLHSHVQT 366
           HF  L  SG GD  M S FQ  LS S +    R +     ++++K++ +    LHSH++ 
Sbjct: 330 HFAILIRSGPGDDFMSSQFQETLSDSPLAREARQVNYF-DIITLKHK-VTDAYLHSHLER 387

Query: 367 YP-------SGSSQQQVTTYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQDGRPYRLVH 419
           YP         S+ QQVT Y   D NN W     + LPA      E + V      R  H
Sbjct: 388 YPIRYEDGRVSSNGQQVTGYTLEDVNNQWEVLPTKQLPA-----REGQPVHLDDVVRFRH 442

Query: 420 ANTGRNLHTHPIPAPVSKTHWEVSGYGDAQVGD---PKDNWIIEFVSQPSDEDKSVLHTI 476
             T   L  H + +P+  T+ E++   +        P+  + ++ V++   ED  VL + 
Sbjct: 443 VVTNTFLLAHDVASPLYPTNEEITTVEEEMANGANYPETLFRLQSVNKGDSED--VLKSK 500

Query: 477 STSFRIKNVEMGCYL-AQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVN---ER 532
           ++ FRI +++    L       LPEWGF+Q EV    N    D    W  ET VN    R
Sbjct: 501 ASVFRIVHIDTTVALWTHNDVLLPEWGFKQQEVN--GNKKIIDPENSWFAETIVNIDEAR 558

Query: 533 LPPMPEDFKYPKTSFFKDFVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTLNVGIRLC 592
              +P+  K  K  FF  ++ L   M   NN L          ASS   WP    G+   
Sbjct: 559 SVYVPKTRK--KLPFFTKWMELQRLMFEHNNKLSSS----HPFASSPESWPGSLSGVSFW 612

Query: 593 SWADDVRKYFLIGSPASTWPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGI 652
           +   +  + + IG+    W    ++ +FC +T   LL  +R   +F  +  A   L   +
Sbjct: 613 TKDSERIQIYFIGNIIGWWFQVVSIALFCGVTAADLLVRRRG--IFPLNKMAKQKLNAPL 670

Query: 653 -YPLLGWGLHYLPFAVMGRVTYVHHYLPALYFALLILAYVFEA------SLRAARQSQK- 704
            +  +GW  H++PF +MGR  ++HHYLPA   A +  A ++E       SL   +  +  
Sbjct: 671 SFLFVGWLCHFVPFFLMGRQKFLHHYLPAHLIASMFSAAMWETIFTDNKSLNLEKDEEDP 730

Query: 705 ----------SYWKILVYVVYAVYYCTIICGFYYFYPITVGMEGPS 740
                     +Y  ++++V+  V    +I  F YF PI  G +  S
Sbjct: 731 ANAHEANPHLNYIPLILFVL--VMSGALIWFFVYFSPIVYGDQSLS 774

>YJR143C (PMT4) [3035] chr10 complement(698241..700529)
           Mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase),
           involved in initiation of O-glycosylation [2289 bp, 762
           aa]
          Length = 762

 Score =  270 bits (691), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 216/704 (30%), Positives = 328/704 (46%), Gaps = 57/704 (8%)

Query: 68  VLFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIA 127
            + TLLA   R +KI     VV+DE HFGKF SYYL   ++ DVHPP  KM++   G++ 
Sbjct: 57  TIVTLLAFAARFYKIWYPKEVVFDEVHFGKFASYYLERSYFFDVHPPFAKMMIAFIGWLC 116

Query: 128 GYNGSWDFP----SGEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFS 183
           GY+GS+ F     S E +P    Y+  R FNA+   +  P+ + T K + F   T    S
Sbjct: 117 GYDGSFKFDEIGYSYETHPA--PYIAYRSFNAILGTLTVPIMFNTLKELNFRAITCAFAS 174

Query: 184 ILVVFENSYATLGRFILLDSMLLFFTVCSFYTFVLFHN-ERHRPFGRKWWKWLFFLGVSL 242
           +LV  + ++ T  R ILLD++L+     + Y +V F+  +  +PF   W+ WL   G+SL
Sbjct: 175 LLVAIDTAHVTETRLILLDAILIISIAATMYCYVRFYKCQLRQPFTWSWYIWLHATGLSL 234

Query: 243 GCTISVKMVGLFIISVVGIYTVVDLWNKLS-EPNMSVSRFAGHFSARALCLIVVPFMVFL 301
              IS K VG+   S +G   VV+LW  L  +  +S+ +F  HFS R   L+++PF+++L
Sbjct: 235 SFVISTKYVGVMTYSAIGFAAVVNLWQLLDIKAGLSLRQFMRHFSKRLNGLVLIPFVIYL 294

Query: 302 FCFKLHFEFLSVSGTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLLH 361
           F F +HF  L+ SG GDA M + FQ  L  S + +  + +     +++IK+Q      LH
Sbjct: 295 FWFWVHFTVLNTSGPGDAFMSAEFQETLKDSPLSVDSKTVNY-FDIITIKHQDTDA-FLH 352

Query: 362 SHVQTYPS-------GSSQQQVTTYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQDGRP 414
           SH+  YP         S+ QQVT Y H D NN W       LP    +  + + V   + 
Sbjct: 353 SHLARYPQRYEDGRISSAGQQVTGYTHPDFNNQW-----EVLPPHGSDVGKGQAVLLNQH 407

Query: 415 YRLVHANTGRNLHTHPIPAPVSKTHWEVSGYGDAQVGDPKDNWIIEFVSQP--SDEDKSV 472
            RL H  T   L  H + +P   T+ E++     + GD +      F  QP    ++  V
Sbjct: 408 IRLRHVATDTYLLAHDVASPFYPTNEEITTVT-LEEGDGELYPETLFAFQPLKKSDEGHV 466

Query: 473 LHTISTSFRIKNVEMGCYL-AQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVN- 530
           L + + SFR+ +V+    L       LP+WGF+Q E+    N    D    W ++  VN 
Sbjct: 467 LKSKTVSFRLFHVDTSVALWTHNDELLPDWGFQQQEIN--GNKKVIDPSNNWVVDEIVNL 524

Query: 531 --ERLPPMPEDFKYPKTSFFKDFVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTLNVG 588
              R   +P+  K     F K ++    +M   NN L  +       AS  + WP    G
Sbjct: 525 DEVRKVYIPKVVK--PLPFLKKWIETQKSMFEHNNKLSSE----HPFASEPYSWPGSLSG 578

Query: 589 IRLCSWADDVRKYFLIGSPASTWPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIF- 647
           +   +  D+ ++ + IG+    W    ++ VF  I V  L+   R            ++ 
Sbjct: 579 VSFWTNGDEKKQIYFIGNIIGWWFQVISLAVFVGIIVADLITRHRGYYALNKMTREKLYG 638

Query: 648 -LMGGIYPLLGWGLHYLPFAVMGRVTYVHHYLPALYFALLILAYVFEASLRAARQ----- 701
            LM   +  + W  HY PF +M R  ++HHYLPA   A L    ++E      +      
Sbjct: 639 PLM---FFFVSWCCHYFPFFLMARQKFLHHYLPAHLIACLFSGALWEVIFSDCKSLDLEK 695

Query: 702 ----SQKSYWK-ILVYVV-YAVYYCTIICG----FYYFYPITVG 735
               S  SY +   VYV  Y V+   + C     F YF P+  G
Sbjct: 696 DEDISGASYERNPKVYVKPYTVFLVCVSCAVAWFFVYFSPLVYG 739

>Scas_442.1
          Length = 309

 Score =  254 bits (649), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 130/298 (43%), Positives = 185/298 (62%), Gaps = 22/298 (7%)

Query: 451 GDPKDNWIIEFVSQPSD-------EDKSVLHTISTSFRIKNVEMGCYLAQTGPSLPEWGF 503
           GD  D+WI+E V Q          ED++++H +ST FR+++  +GCYLA TG + P WGF
Sbjct: 6   GDVYDDWILEIVDQMDSGNPDFHKEDQNIVHPVSTFFRLRHKVLGCYLASTGLAYPSWGF 65

Query: 504 RQGEVACISNPFKRDKRTWWNIETNVNERLPPMPEDFKYPKTSFFKDFVHLNLAMMATNN 563
           +Q E+ C  +   RDK TWWN+E + N++LP + ED+  PK+ F+ DF+ +N AM ++N+
Sbjct: 66  QQAEIVCKKSWSHRDKATWWNVEDHWNDQLP-IEEDYVPPKSKFWTDFILINFAMASSNS 124

Query: 564 ALVPDPDKLDQLASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPASTWPSTAAVGVFCLI 623
           ALVPD DK D LAS  W+WPTL+ G+RLCSW+ DV KY+L+GSP +TW ST ++ +F  I
Sbjct: 125 ALVPDADKFDPLASKPWEWPTLHRGLRLCSWSRDVYKYYLLGSPFNTWLSTLSLFLFVFI 184

Query: 624 TVYYLLKWQRQLVLFQASDDANIFLMGGIYPLLGWGLHYLPFAVMGRVTYVHHYLPALYF 683
                 +W+RQ +  Q  D      + GI+P L W  H+ PF +MGRVTYVHHYLPALYF
Sbjct: 185 ISKIAYQWRRQHLNLQ-EDQLWRLGIQGIFPFLAWITHFFPFVMMGRVTYVHHYLPALYF 243

Query: 684 ALLILAYVFEASLRAARQSQKSYWKILVYVVYAVYYCTII-CGFYY--FYPITVGMEG 738
           A+L   +V + S+  A            ++ Y +Y    + C + Y  F PI  G+ G
Sbjct: 244 AILTFGFVLDYSIGRANP----------FIKYPIYLALFVGCTYIYVLFAPICQGLHG 291

>Scas_710.1
          Length = 919

 Score =  264 bits (675), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 211/694 (30%), Positives = 335/694 (48%), Gaps = 43/694 (6%)

Query: 44  DVSKLREVQQERNPLYKLEAFVMPVLFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYYL 103
           D    +++ Q R      E  ++  L    AL  R+H +G  N VV+DEA +G   S YL
Sbjct: 33  DTEPSQDLVQLRTISTTHEIILVLSLLAFTAL-IRLHDLGWPNGVVFDEAVYGNIVSKYL 91

Query: 104 RHEFYHDVHPPLGKMLVGLSGYIAGYNGSWDFPS-GEEYPEYIDYVKMRMFNAVFSAMCA 162
           ++  + DVHPPL K+L     +  G+ G ++F   G  +P    Y  MR+F+A   ++  
Sbjct: 92  KNILFVDVHPPLIKLLYAGIAHFLGFEGQFEFNDIGVPFPTTTPYYAMRLFSATLGSLTV 151

Query: 163 PVAYFTGKAIGFSLPTVWLFSILVVFENSYATLGRFILLDSMLLFFTVCSFY---TFVLF 219
            + Y T +A G  +      SI +V ENS+ T+ R I+L+  L+FF   + Y      LF
Sbjct: 152 LLMYLTLRASGVRIWVALAGSICLVIENSFVTVSRHIMLEGPLMFFIAAAVYFTKKSDLF 211

Query: 220 HNERHRPFGRKWWKWLFFLGVSLGCTISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVS 279
             +    +       +    V+LG  IS K VG+  +   G+  V  LW  +   +M V 
Sbjct: 212 KADSCNSYIN-----IGIAAVALGLAISSKWVGVATLIWAGLICVWRLWFMVGNLSMPV- 265

Query: 280 RFAGHFSA---RALCLIVVPFMVFLFCFKLHFEFLSVSGTGDAMMPSLFQAGLSGSSVGI 336
              G F     +A  LI +P ++++  F  HF++  ++     +    F+  L+ +SV  
Sbjct: 266 --CGSFKVALIKAFTLIFLPIILYILTFYFHFQYTGINSDVSQLFTPEFRTTLANNSVVN 323

Query: 337 GPR-DIAVGSSLVSIKNQALGGTLLHSHVQTYPSGSSQQQVTTYGHNDSNNNWVFDRIRG 395
               +IAVG S++++++    G  LHSH   Y  GS+QQQ+T Y + D N+NW  + +  
Sbjct: 324 NVVAEIAVG-SMITLRHPGTHGGYLHSHDAFYEKGSNQQQITCYPYVDKNDNWTVE-LYD 381

Query: 396 LPAWSINETEHEFVQDGRPYRLVHANTGRNLHTHPIPAPVSK-THW--EVSGYG-DAQVG 451
           +P  +I  T  + + DG   RL+H NTG  LH+H    PVS+ + W  EVS YG     G
Sbjct: 382 VPLENI--TSFQNLTDGTKIRLLH-NTGCRLHSHDHKPPVSENSDWQKEVSCYGYPGFEG 438

Query: 452 DPKDNWIIEFVSQPS--DEDKSVLHTISTSFRIKNVEMGCYLAQTGPSLPEWGFRQGEVA 509
           D  D+WIIE     S   E +  +  I T FR+K+  MGCYL      LP+ GF Q EV 
Sbjct: 439 DANDDWIIEIDKDASIPGESQEHVRAIETKFRLKHAIMGCYLFSHNTMLPKLGFEQQEVT 498

Query: 510 CISNPFKRDKRTWWNIETNVNERLPPMPEDFKYPKTSFFKDFVHLNLAMMATNNALVPDP 569
           C  +    D  T W++E N N  +    E   Y   SF+K FV  +  M+   + +    
Sbjct: 499 CAYSGI--DSLTLWSVENNENPFVSDDAERVSYEPLSFWKKFVETHKRMLEIASGM---- 552

Query: 570 DKLDQLASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPASTWPSTAAVGVFCLITVYYLL 629
           D      S    WP +  GI    W++  +  +L+G+    W  TA +  F  I V+ L+
Sbjct: 553 DNTHMYESKPATWPFMLRGIDF--WSEQHQDIYLLGNAVLWWSVTAFIVGFAGIVVWELV 610

Query: 630 KWQRQLVLFQASDDANI--FLMGGIYPLLGWGLHYLPFAVMGRVTYVHHYLPALYFALLI 687
             Q   + ++ S D ++  F +  I  LLG+ L+++P  ++    +++HYLPA YF +L 
Sbjct: 611 SLQ---LGYEFSKDPHVINFHIQVIQYLLGFLLNFIPSLLLENQIFLYHYLPAYYFGILA 667

Query: 688 LAYVFE--ASLRAARQSQKSYWKILVYVVYAVYY 719
           L +  +   S    R+    Y  + ++    VY+
Sbjct: 668 LTHGLDILVSYIFRRRRSIGYTIVFLFATLCVYF 701

>Scas_719.80
          Length = 762

 Score =  257 bits (656), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 207/705 (29%), Positives = 318/705 (45%), Gaps = 65/705 (9%)

Query: 71  TLLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIAGYN 130
           TL+A   R + I     VV+DE HFGKF SYYL   ++ DVHPP  KM +   G++ GYN
Sbjct: 60  TLIAFVARFYMIWYPKEVVFDEVHFGKFASYYLERTYFFDVHPPFAKMAIAFIGWLVGYN 119

Query: 131 GSWDFPS-GEEYPEY-IDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSILVVF 188
           GS+ F   G  Y      Y+  R FNA+   +   + + T K + F   T +  ++LV  
Sbjct: 120 GSFKFDEIGSSYQTNPAPYIAYRSFNAMLGTLTVSIMFNTLKELNFKAITCFFGALLVAV 179

Query: 189 ENSYATLGRFILLDSMLLFFTVCSFYTFVLFHNERHR-PFGRKWWKWLFFLGVSLGCTIS 247
           +N++ T  R ILLD++LL     SFY+FV F+  + R PF  +W+ WL   G+SL   IS
Sbjct: 180 DNAHVTETRLILLDAILLISIAASFYSFVRFYKAQLRAPFSPQWYIWLHLTGLSLSFVIS 239

Query: 248 VKMVGLFIISVVGIYTVVDLWNKLS-EPNMSVSRFAGHFSARALCLIVVPFMVFLFCFKL 306
            K +G+   + +G   +V+LW  L    N+++  F  HF  R   L+  PF ++LF F +
Sbjct: 240 TKYIGVMTYAAIGTGVIVNLWQLLDLRANLTLRAFFRHFVKRLNGLVFAPFCIYLFWFWV 299

Query: 307 HFEFLSVSGTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLLHSHVQT 366
           HF  LS SG GDA M + FQ  L  S + I  +++     ++++K++      LHSH   
Sbjct: 300 HFAILSKSGPGDAFMSAEFQETLGDSPMSILSKEVHF-YDIITLKHKDTEA-FLHSHQAF 357

Query: 367 YP-------SGSSQQQVTTYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQDGRPYRLVH 419
           YP         S  QQVT +   D +N+W       LP   ++  +   V    P RL H
Sbjct: 358 YPLRYEDGRISSEGQQVTGFTGTDISNDW-----EVLPTRELDSHKGVPVVLNEPIRLRH 412

Query: 420 ANTGRNLHTHPIPAPVSKTHWEVSGYGDAQV-GDPKDNWIIEFVSQPSDEDKSVLHTIST 478
             +   L  H + +P   T+ E++   +    G+     +  F      ++  V+ T   
Sbjct: 413 VASNTYLLAHDVASPFYPTNEEITTVSEEIANGESYQQTVFTFQPLKKGDEGHVVKTKGV 472

Query: 479 SFRIKNVEMGCYL-AQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIE--TNVNERLPP 535
            F+I +      L       LP+WGF Q EV    N    D    W+++  TN++E    
Sbjct: 473 QFKIYHPNTDVVLWTHNDVLLPDWGFEQQEVNGSKN--FGDPTNAWSVDEITNLDEDRKK 530

Query: 536 MPEDFKYPKTSFFKDFVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTLNVGIRLCSWA 595
                  P  SFF+ +  L  +M   NN L  +       AS    WP    G+   + +
Sbjct: 531 FTPKVVKP-MSFFRKWSELQKSMFEQNNKLSAE----HPFASQPQSWPAGLCGVSFWTKS 585

Query: 596 DDVRKYFLIGSPASTWPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGI--- 652
           ++ ++ F   +    W    ++ VF  I           L+  Q S     F++G I   
Sbjct: 586 EERKQIFFTANIIGWWFQVISMSVFIGI-----------LLADQISRKRGYFVLGKITRE 634

Query: 653 -------YPLLGWGLHYLPFAVMGRVTYVHHYLPALYFALLILAYVFEA------SLRAA 699
                  +  + WG HY PF +M R  ++HHYLPA     L  A ++E       S+ A+
Sbjct: 635 KLYGPLAFLFISWGCHYAPFFLMHRQKFLHHYLPAHLIISLFTAGLWEVVFSDCKSIDAS 694

Query: 700 RQSQ------KSYWKI---LVYVVYAVYYCTIICGFYYFYPITVG 735
           R  +      K+  KI    + V +      I+  F YF P+  G
Sbjct: 695 RDEEIEGTPYKADPKINSTSLTVFFVAVSIAIVWFFIYFSPLVYG 739

>CAGL0L07172g complement(796354..798687) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase or sp|P52867 Saccharomyces
           cerevisiae YDL093w PMT5, start by similarity
          Length = 777

 Score =  215 bits (547), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 189/670 (28%), Positives = 303/670 (45%), Gaps = 36/670 (5%)

Query: 50  EVQQERNPLYKLEAFVMPVLFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYH 109
           E+ Q R    K +  +M ++  L A+ TR + IG    +V+DE       S Y    F  
Sbjct: 48  ELFQFRTIGSKSDGILMAIV-ALFAIVTRFYDIGFPKAIVYDEGFVIAEVSKYFNKTFSI 106

Query: 110 DVHPPLGKMLVGLSGYIAGYNGSWDF-PSGEEYPEYIDYVKMRMFNAVFSAMCAPVAYFT 168
           DV PPLGKM+    G   G++ S+ + P G ++     Y+  R   A   A      + T
Sbjct: 107 DVFPPLGKMIYYFVGKYTGFDTSYKYHPVGTQFENASVYLPERYLAAGLGACVVVFFFMT 166

Query: 169 GKAIGFSLPTVWLFSILVVFENSYATLGRFILLDSMLLFFTVCSFYTFVLFHNERHRPFG 228
            +A G S P   +FS+ +  ENS+ T  R++ LD+  LFF   + Y F    +      G
Sbjct: 167 LRASGVSRPIAGIFSVALSLENSFITASRYVHLDAPFLFFVAAAIY-FTKKSDNLRAGSG 225

Query: 229 RKWWKWLFFLGVSLGCTISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVSRFAGHFSAR 288
           R  + +       LG  IS K  GLF+++ V I T+  LW    + ++ + R    F   
Sbjct: 226 RYIFTFTH-AACLLGLAISTKWAGLFVLAWVAIVTLWRLWLLAGDLSVPICRTVKVFIFN 284

Query: 289 ALCLIVVPFMVFLFCFKLHFEFLSVSGTGDAMMPSLFQAGLSGSSV-GIGPRDIAVGSSL 347
            L L +VP +++   F  H    +V G    +M   F++ L  ++V      D+ VG + 
Sbjct: 285 LLVLSLVPAVIYFSIFSWHIGSRTVDGNDSILMKPEFRSELYNNTVIKESFADVVVGGT- 343

Query: 348 VSIKNQALGGTLLHSHVQTYPSGSSQQQVTTYGHNDSNNNWV---FDRIRGLPAWSINET 404
           V + N  + G  + +    Y +GS Q+Q+    +     +WV   ++R    P    N  
Sbjct: 344 VRLNNIGMDGGFVEAAPAYYEAGSKQRQIDLRKNESVTTDWVVEYYNRSGSTPKSFENLK 403

Query: 405 EHEFVQDGRPYRLVHANTGRNLHTHPIPAPVSK-THW--EVSGYG-DAQVGDPKDNWIIE 460
            HE +      RL        LH+H   AP+S+   W  EVS YG +  +GDP D+WI+E
Sbjct: 404 NHEKI------RLYSPKYKCRLHSHDHKAPISQHVDWQKEVSCYGYEGFMGDPNDDWIVE 457

Query: 461 F---VSQPSDEDKSVLHTISTSFRIKNVEMGCYLAQTGPSL--PEWGFRQGEVACISNPF 515
               +S+P  E +  +  I T FR+K+   GCYL      +  PE+     E+AC  +  
Sbjct: 458 IDQDLSEPG-EAREFVKAIDTKFRLKHAMSGCYLFTHDVRMRTPEF-VMDYEIACAHS-- 513

Query: 516 KRDKRTWWNIETNV-NERLPPMPEDFKYPKTSFFKDFVHLNLAMMATNNALVPDPDKLDQ 574
            + + T WNIE +  +   P  P+   Y   S     + L+ A M     +  D   L  
Sbjct: 514 GKYELTLWNIEQDQPHPNSPKNPKRVSYKPMSLKDKILDLH-AKMIEKAKVRTDKSSLIT 572

Query: 575 LASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPASTWPSTAAVGVFCLITVYYLLKWQRQ 634
             ++   WP L  GI    W    R+ + +G+PA  W  +A + +F +  V  L+ WQ  
Sbjct: 573 FPTT---WPLLEKGIPF--WNGFARQIYFLGNPAMWWSVSAFIVLFVVAFVGELIFWQMG 627

Query: 635 LVLFQASDDANIFLMGGIYPLLGWGLHYLPFAVMGRVTYVHHYLPALYFALLILAYVFEA 694
             +       N  +    Y  +G+ L+Y+P+ +     +++ YLPA YF LL LA+VFE 
Sbjct: 628 FEISSNPQFINFHIQVLQYG-IGFALNYVPYILTTDRHHLYQYLPAYYFGLLALAHVFEL 686

Query: 695 SLRAARQSQK 704
               A ++++
Sbjct: 687 VYSFAFKNKR 696

>Sklu_2215.6 YDR307W, Contig c2215 9395-11356 reverse complement
          Length = 653

 Score =  151 bits (382), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 136/479 (28%), Positives = 214/479 (44%), Gaps = 47/479 (9%)

Query: 61  LEAFVMPVLFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLV 120
           L A ++ + F L  L     ++G +   V ++   G    +YL HEFY D  PPL   L 
Sbjct: 34  LIAVLIALFFVLFQLTKVNGELGTS---VQEKEILGSI-DHYLSHEFYLDSRPPLSVQLF 89

Query: 121 GLSGYIAGYNGSWDFPSGEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTV- 179
            L  ++ G                   + + +  A  ++ C  +A      +G    +V 
Sbjct: 90  SLLTFVYGE------------------LSVELLRAATTS-CGGIA-LVLLYLGLRKSSVN 129

Query: 180 WLFSILVVFENSYATLGRFILLDSMLLFFTVC----SFYTFVLFHNERHRPFGRKWWKWL 235
            + S++ V   SY  + R   L      F VC    S Y++  F  +  +PF + W K+L
Sbjct: 130 RVISVIAVVSFSYLKVFREETLRVSTDIFQVCFLAMSLYSWKSF--KAAKPFSKTWHKYL 187

Query: 236 FFLGVSLGCTISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVSRFAGHFSARALCLIVV 295
            FL +SLG +IS K VG    S +   ++V LWN +++  ++  +   H   R + L++V
Sbjct: 188 LFLSISLGLSISNKFVGFMTWSWILSLSIVQLWNIIADVRLTGKQVFTHCVLRFMALVLV 247

Query: 296 PFMVFLFCFKLHFEFLSVSGTG-DAMMPSLFQAGLSGSSVG--IGPRDIAVGSSLVSIKN 352
           P +VFL  +  H   L+   T     M   ++  L  + +   + P  +  GS++     
Sbjct: 248 PAIVFLLSYYAHISTLTQDLTDFSTFMSPYYKHTLENNPLNKIVPPGRVYYGSTITIRHK 307

Query: 353 QALGGTLLHSHVQTYPSGSSQQQVTTYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQDG 412
            +LGG  LHSH   Y SGS +QQVT Y   D+NN W+ +  +     S        V++G
Sbjct: 308 DSLGG-YLHSHELNYQSGSHEQQVTLYDFPDNNNEWIVEHKKENKDVSSKAVA---VKNG 363

Query: 413 RPYRLVHANTGRNLHTHPIPAPVSKTHW--EVSGYGDAQ-VGDPKDNWIIEFVSQPSDED 469
              RL H  TG+ L       PVS+  +  EVS  GDA   G   + W I F  +  +  
Sbjct: 364 ENIRLRHRLTGKLLRASGAKPPVSEQDYDREVSCTGDANYTGQSDELWKIRFSGRLLEG- 422

Query: 470 KSVLHTISTSFRIKNVEMGCYLAQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETN 528
              L  + T+F++ N   GC L      LPEW   Q EV C+  P K  +RT + +E++
Sbjct: 423 ---LVPLDTTFQLTNQGQGCTLLSHDLRLPEWALFQQEVLCLDPPTK--ERTLFYVESS 476

>Scas_329.1
          Length = 273

 Score =  136 bits (343), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 117/202 (57%), Gaps = 6/202 (2%)

Query: 71  TLLALYT---RMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIA 127
            +LAL+T   R+  +   + VV+DE HFGKF SYY++ EF+ DVHPPL KML      +A
Sbjct: 62  AILALFTASIRLPNLQKPDSVVFDEVHFGKFASYYIKGEFFMDVHPPLAKMLYAGVAALA 121

Query: 128 GYNGSWDFPS-GEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSILV 186
           G+ G++ F + G+ +P  + YV MR F+A+  A+   + Y T ++ G      ++     
Sbjct: 122 GFRGNFMFENIGDVFPADVPYVLMRFFSAMLGALTVMLLYLTLRSSGVRPWVAFVSGACF 181

Query: 187 VFENSYATLGRFILLDSMLLFFTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGVSLGCTI 246
             ENSY T+ R+ILLD+ L+FF   + Y+F  + N  ++ F     K LF  GV+LG   
Sbjct: 182 AIENSYVTISRYILLDAPLIFFIAAAVYSFKKYEN--YKSFSIGSIKSLFVAGVALGMAA 239

Query: 247 SVKMVGLFIISVVGIYTVVDLW 268
           S K VGLF I+ VG+  +  LW
Sbjct: 240 SAKWVGLFTIAWVGLLCIWRLW 261

>Scas_30.1
          Length = 128

 Score =  125 bits (313), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 73/103 (70%), Gaps = 2/103 (1%)

Query: 638 FQASDDANIFLMGGIYPLLGWGLHYLPFAVMGRVTYVHHYLPALYFALLILAYVFEASLR 697
           F   +D N FLMG  YPLLGWGLHYLPF +M RVTYVHHYLPALYFALLILAY+F+  ++
Sbjct: 13  FANPEDLNTFLMGAFYPLLGWGLHYLPFVIMSRVTYVHHYLPALYFALLILAYLFDFFMK 72

Query: 698 AARQSQKSYWKILVYVVYAVYYCTIICGFYYFYPITVGMEGPS 740
              +S+     I    +Y  YY  II GFYYF PI+ GM+GPS
Sbjct: 73  KWTKSKCG--SITKLAIYFCYYAVIIYGFYYFSPISFGMDGPS 113

>AAL050W [137] [Homologous to ScYDR307W - SH]
           complement(256490..258463) [1974 bp, 657 aa]
          Length = 657

 Score =  116 bits (291), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 100/371 (26%), Positives = 159/371 (42%), Gaps = 33/371 (8%)

Query: 158 SAMCAPVA-YFTGKAIGFSLPTVWLFSILVVFENSYATLGRFILLDSMLLFFTVCSFYTF 216
           S  CA +   + G A+G         ++L VF ++ A      +  +M L   + ++ +F
Sbjct: 138 SLRCAGIQRLWAGAAVG-------CIALLEVFRDA-AVHASLEMYHAMFLAIILYNWKSF 189

Query: 217 VLFHNERHRPFGRKWWKWLFFLGVSLGCTISVKMVGLFIISVVGIYTVVDLWNKLSEPNM 276
            L       PFG+ WW  L  + V  G     K VGL   + V +     ++  + +  +
Sbjct: 190 KL-----QEPFGQAWWLRLSAVAVCSGLAAGTKFVGLGTWAWVLLLNSAHIFQLIGDLEV 244

Query: 277 SVSRFAGHFSARALCLIVVPFMVFLFCFKLHFEFLSVSGTGDAMMPSLFQAGLSGSSVGI 336
           S      H   R   L +VP  + L  +  H +  S S    + MP+LF+A L G  V +
Sbjct: 245 STRTVWKHVLIRLPLLTLVPLSIILLGYHSHLQAPSYSSRDSSYMPTLFKAQLDGYQV-L 303

Query: 337 GPRDIAVGSSLVSIKNQALGGTLLHSHVQTYPSGSSQQQVTTYGHNDSNNNWVFDRIRGL 396
            P  +  GS +V   + ++GG  LHSH  TYP GS +QQ+T Y   D+NN W  + +   
Sbjct: 304 QPASVYYGSGVVIRHSSSIGG-YLHSHELTYPGGSEEQQITLYDFEDANNKWTVEPV--- 359

Query: 397 PAWSINETEHEFVQDGRPYR------LVHANTGRNLHTHPIPAPVSKTHW--EVSGYGDA 448
                NE   + +   +P R      L H  TG+ L       PVS+  +  EVS  GD+
Sbjct: 360 ----YNEAMDDIINSTQPVRNGDLIKLRHVQTGKLLRASAAKPPVSQRDYDQEVSCTGDS 415

Query: 449 QV-GDPKDNWIIEFVSQPSDEDKSVLHTISTSFRI-KNVEMGCYLAQTGPSLPEWGFRQG 506
              GD  + W ++       ED      I  S R+ K   +   L+  G +       + 
Sbjct: 416 GYSGDSDETWRVDIQDAEYHEDPKAWFCIHFSPRVNKGPVLPPLLSHDGQAAEVGPCTRQ 475

Query: 507 EVACISNPFKR 517
           EV C+++P  +
Sbjct: 476 EVICLASPVHK 486

>Scas_588.7
          Length = 726

 Score =  105 bits (261), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 151/684 (22%), Positives = 255/684 (37%), Gaps = 90/684 (13%)

Query: 65  VMPVLFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG 124
           ++ +   L+ LY  +  I     +   E        YY + +F  +  PPLG  L  L  
Sbjct: 106 ILSITVALVTLYIGIRNIEKEVPLFPKEQDIFASVEYYQKDKFILNSFPPLGIQLYSL-- 163

Query: 125 YIAGYNGSWDFPSGEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSI 184
                      P G        Y  MR+ +   S+      Y   + +        + ++
Sbjct: 164 ----------LPVGS-------YSAMRLMSLSASSFSLLFLYLAFRRVNVPYLIALVSTV 206

Query: 185 LVVFENSYATLGRFILLDSMLLFFTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGVSLGC 244
            ++    +      I LD++  F+   S Y++       H  F  KW        +S+GC
Sbjct: 207 CILSIPLFRKESTRISLDTLQWFWLSISIYSWASLKCFSH--FSIKWTIHSLIFAMSIGC 264

Query: 245 TISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVSRFAGHFSARALCLIVVPFMVFLFCF 304
           +++ K +G        + + +  W  + +  +S S    H + +  CL+V+P  +F    
Sbjct: 265 SMATKYIGFATWGWAILISSIYFWQMIGDVRLSTSHIVKHTTFQIFCLLVIPMTIFATTL 324

Query: 305 KLHFEFLSV-SGTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLLHSH 363
            L      + S      M S ++  L   S  + P +I  GS +      +LGG L    
Sbjct: 325 YLQINHSRIDSPEYSQYMSSYYKIFLRSKSPILQPMEITNGSIITIRHLNSLGGYLTSPA 384

Query: 364 VQTYPSGSSQQQVT-TYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQDGRPYRLVHANT 422
            ++YP GS++Q V+ T   ++ +N W+ +         +++     + D +  +L H  T
Sbjct: 385 NESYPEGSAEQIVSLTDMESNVDNQWILEY--------VDDYNKGPLIDSQRIKLRHRTT 436

Query: 423 GRNLHTHPIPAPVSKTHW--EVSGYGDAQV-GDPKDNWIIEFVSQPSDEDKSVLHTISTS 479
           G+ L       PVS+  +  EVS  GD    GD  + W I+ V       +  L      
Sbjct: 437 GKLLRASSAKPPVSEQEYNSEVSCTGDWDYHGDSDEFWKIDLV-------EGSLIPCWNI 489

Query: 480 FRIKNVEMGCYLAQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVNERLPPMPED 539
             + NV   C L      LP+WG  + EV CI +P    +R  + IE   N+ +      
Sbjct: 490 MELDNVGQMCTLISHDTRLPDWGEFEQEVFCIQSP--DPQRAKFQIEFVDNDEI------ 541

Query: 540 FKYPKT--------SFFKDFVHLNLAMMATNN--------ALVPDPDKLDQLASSAWQWP 583
            K P T        ++ + + ++ LA               L  D D+ D++  +  +WP
Sbjct: 542 -KNPITLAGLPGYGNYSRCYQYIKLAAELIQREFKYDYMVKLQNDNDENDKVHINKEKWP 600

Query: 584 TLNVGIRLCSWADDVRKYFLIGSPASTWPSTAAVGVFCL--ITVYYLLKWQRQLVLFQAS 641
               G       +D      + S      S A V V C   + V     W+       + 
Sbjct: 601 IYITG-------NDTTDLIWLTS------SIAVVIVACRFGLQVMNWNPWKIDNGDSSSH 647

Query: 642 DDANIFLMGGIYPLLGWGLHYLPFAVMGRV-TYVHHYLPALYFALLILAYVFEASLRAAR 700
            +  I+    I  LLGW +HY  F         +  YLP+  FA L+      A+     
Sbjct: 648 LNMKIYHEFAIESLLGWFVHYYIFLKSSNDHLEIVLYLPSFVFAHLL------ATETVTA 701

Query: 701 QSQKSYWKILVYVVYAVYYCTIIC 724
             Q S WK    ++  VY  TI C
Sbjct: 702 IGQWSQWK--CAIILLVYIVTIKC 723

>Kwal_33.14357
          Length = 657

 Score = 94.4 bits (233), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 116/462 (25%), Positives = 193/462 (41%), Gaps = 42/462 (9%)

Query: 64  FVMPVLFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLS 123
           F+M  L  +  L   +      + +   E    +  S Y++ EF+    PP    ++ L 
Sbjct: 33  FIMAALLGISLLLKGIRGWQQESYITPSEEDLVEAISEYMKKEFFLMSSPPFMVQILALV 92

Query: 124 GYIAGYNGSWDFPSGEEYPEYIDYVKMRMFNAVFSAMCAPVAYF----TGKAIGFSLPTV 179
             I G                +    +R  N   +A      Y     +G     S  T 
Sbjct: 93  SRIMGS---------------LSIEVLRKINLTTTAFVVSSFYLALSRSGVVFVVSAVTA 137

Query: 180 WLFSILVVFENSYATLGRFILLDSMLLFFTVCSFYTFVLFHNERHR-PFGRKWWKWLFFL 238
              S L +F  +   L    L++  +LF + C     + +++ +H   F R+W+  L  L
Sbjct: 138 GSLSYLSLFAENSQHLS---LINFQVLFLSCC----LLSWNSFKHSTSFTRRWYVALTSL 190

Query: 239 GVSLGCTISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVSRFAGHFSARALCLIVVPFM 298
            + L  ++S   +G    S   I  +  +W+ + + ++S+ +   H   R L +I VPF 
Sbjct: 191 SLFLSLSLSTTFLGAITWSWFLILMIKQMWSIVGDVDVSMWKILKHTFWRVLMIICVPFG 250

Query: 299 VFLFCFKLHFEFLSVSGTGDAMMPSLFQAGLSGSSVGIG---PRDIAVGSSLVSIKNQAL 355
           + L  +   F FL  S        SL         +  G   P  +  GS+L+    ++L
Sbjct: 251 LMLSSY---FVFLLNSRGAGMNHSSLVSPYFKTWFLPQGLPQPDAVYYGSNLLIRHAESL 307

Query: 356 GGTLLHSHVQTYPSGSSQQQVTTYG-HNDSNNNWVFDRIRGLPAWSINETEHEFVQDGRP 414
           GG  LHSH  TY SGS +QQVT     ND++N W+ +         +++T    V++G  
Sbjct: 308 GG-YLHSHNYTYESGSLEQQVTLVDFSNDADNEWIIEAQN--ENLKLDKTLQP-VRNGDF 363

Query: 415 YRLVHANTGRNLHTHPIPAPVSKTHW--EVSGYGDAQ-VGDPKDNWIIEFVSQPSDEDKS 471
            +L H  +G+ L      APVS+  +  EVS  GD    GD  + W I F  + +  ++ 
Sbjct: 364 VKLRHRTSGKLLRASSAKAPVSEQDYDHEVSCTGDHDYTGDSDETWRIRF-ERGNTPNEG 422

Query: 472 VLHTISTSFRIKNVEMGCYLAQTGPSLPEWGFRQGEVACISN 513
           +L   +  F ++N    C L      LP+WGF Q EV C+ +
Sbjct: 423 ILCPFTMYFSLENKGHDCKLLSHDLRLPDWGFGQQEVLCVDS 464

>KLLA0C14828g complement(1292713..1294602) weakly similar to
           sp|Q06644 Saccharomyces cerevisiae YDR307w, start by
           similarity
          Length = 629

 Score = 87.0 bits (214), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 116/486 (23%), Positives = 189/486 (38%), Gaps = 54/486 (11%)

Query: 222 ERHRPFGRKWWKWLFFLGVSLGCTISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVSRF 281
           +  + F   W+  +  + +SL   IS K +GL     + I ++  LW  + + ++   + 
Sbjct: 175 QASKDFSVDWYMNITLVSMSLIFVISGKFIGLVSWIWLIIVSLKSLWIVVGDLDVKNRQL 234

Query: 282 AGHFSARALCLIVVPFMVFLFCFKLHFEFLSVSGTGDAMMPSLFQAGLSGSSVGIGPRDI 341
                 R L  +V+P M   + +       + S    A M S FQ   S S     P  I
Sbjct: 235 FAIMFCRLLFFVVIPLMSLWYSYSSLIGGFTTSSNSIAYMSSSFQ-HYSMSQHNDIPSSI 293

Query: 342 AVGSSLVSIKNQALGGTLLHSHVQTYPSGSSQQQVTTYGHNDSNNNWVFDRIRGLPAWSI 401
             GSS+      +LGG L    +  YP  +      +   +D  N W+ +  +G    + 
Sbjct: 294 IYGSSIRLRHVNSLGGYLSALEI-PYPKSNDTLVTVSDDPDDEANFWIIESNKGRN--TE 350

Query: 402 NETEHEFVQDGRPYRLVHANTGRNLHTHPIPAPVSKTHWE----VSGYGDAQVGDPKDNW 457
               +  V+     +L +  TG+ L       P+S   ++    V+G  D Q GD  + W
Sbjct: 351 QTGSNALVKQTDKVKLRNKKTGQLLRASEEKPPISDKEYDKRISVTGDSDYQ-GDQDELW 409

Query: 458 IIEFVSQPSDEDKSVLHTISTSFRIKNVEMGCYLAQTGPSLPEWGFRQGEVACISNPFKR 517
            IE   + S   + VL        +KN    C L      +P WG R+ EV C+ +P + 
Sbjct: 410 KIEIQGKAS--FREVLRPFKQFIVLKNPARRCSLLSHEIKIPHWGDRRQEVLCV-DPARV 466

Query: 518 DKRTWW-----NIETNVNERLPPMPEDFKYPKTSFFKDFV----HLNLAMMATNNALVPD 568
           ++  ++     + E  V E+    PE   YP      ++V     LN      N ++ P 
Sbjct: 467 NRALFYIDFVSSPEAGVVEKYKWAPE---YPFYKLAFEYVVGQFRLNKRQNIDNTSMSP- 522

Query: 569 PDKLDQLASSAWQWPTL---NVGIRLCSWADDVRKYFLIGSPASTWPSTAAVGVFCLITV 625
           PD L         WP L   N  I    W                  ST +VGV+  +  
Sbjct: 523 PDCL--------SWPILFDNNNQIGKILWI----------------TSTVSVGVYTFMEA 558

Query: 626 YYLLKWQR-QLVLFQASDDANIFLMGGIYPLLGWGLHYLPFAV-MGRVTYVHHYLPALYF 683
           Y  L W   +  L   + +  +     +   LGW LH   F   + R   V+ Y+P+L F
Sbjct: 559 YSWLSWNIFEDTLLNTTANQLMKREVTLEAFLGWILHLYIFTYSLHRNLSVNQYMPSLLF 618

Query: 684 ALLILA 689
           A++IL+
Sbjct: 619 AVIILS 624

>Scas_710.0d
          Length = 271

 Score = 67.8 bits (164), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 72/140 (51%), Gaps = 13/140 (9%)

Query: 602 FLIGSPASTWPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGIYPLLGWGLH 661
           +L+G+    W  TA +G+F ++ +  L+ WQ    + Q  D  N F +  I+ LLG+ +H
Sbjct: 16  YLLGNAVVWWSVTAFIGIFVVLCLSELIAWQVGKPVLQDKDVIN-FHIQVIHYLLGFAVH 74

Query: 662 YLPFAVMGRVTYVHHYLPALYFALLILAYVFEASLRAARQSQKSYWKILVYVVYAVYYCT 721
             P  +MGR  ++HHYLPA YF +L   +  + +     + +K++   L+ V +A+    
Sbjct: 75  IGPSFLMGRQMFLHHYLPAYYFGILAFGHALDITATYVLRRKKNFAYTLLAVFFALS--- 131

Query: 722 IICGFYYFY----PITVGME 737
                YYF+    PI  G E
Sbjct: 132 -----YYFFKDHSPIIYGTE 146

>YDR307W (YDR307W) [1135] chr4 (1075857..1077845) Protein containing
           three MIR (protein mannosyltransferase, IP3R and RyR)
           domains, which may have a ligand transferase function,
           has weak similarity to mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase, S.
           cerevisiae Pmt1p) [1989 bp, 662 aa]
          Length = 662

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 74/333 (22%), Positives = 139/333 (41%), Gaps = 28/333 (8%)

Query: 231 WWKWLFFLGVSLGCTISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVSRFAGHFSARAL 290
           W+  +  L +SLG  IS K +G+   + V +  V      +S+  ++  +         L
Sbjct: 183 WFANVITLSISLGLAISSKFIGIVTWAFVILSFVRQFDRLISDVKVTTIQIIKFVILCLL 242

Query: 291 CLIVVPFMVFLFCF-KLHFEFLSVSGTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVS 349
            ++++P  +F+  +  L   F + +      M + F++ L G  V   P  +  GS++  
Sbjct: 243 FVLIIPGSIFIISYSNLLSNFKTDTPQFSKYMSTYFKSYLRGPQVQ--PSRLYYGSTITL 300

Query: 350 IKNQALGGTLLHSHVQTYPSGSSQQQVT-TYGHNDSNNNWVFDRIRGLPAWSINETEHEF 408
               ++ G  L SH  +YPS   +Q V  ++    ++N W+ +        S +E  H  
Sbjct: 301 RHLDSMVG-YLASHDISYPSDVDEQLVALSFEEFAADNEWLIEH--PTLNLSFSEVYHAD 357

Query: 409 ----VQDGRPYRLVHANTGRNLHTHPIPAPVSKTHW--EVSGYGDAQV-GDPKDNWIIEF 461
               V+ G+  +L H +TG+ L       P+S+  +  ++S   D+   G   + W +  
Sbjct: 358 QLIPVEFGQSIKLRHKSTGKLLRASTAKPPISEQDYDFQISCTKDSNYEGGMDERWDVLL 417

Query: 462 VSQPSDEDKS------VLHTISTSFRIKNVEMGCYLAQTGPSLPEWGFRQGEVACISNPF 515
           +    + DK        +  + +  R  N    C L      LPEWG  + EV C+  P 
Sbjct: 418 IKDEINNDKKDNADDKYIKPLQSEIRFYNNGQRCGLLGHDLRLPEWGRFEQEVLCMEYPV 477

Query: 516 KRDKRTWWNIETNVNERLPPMPEDFKYPKTSFF 548
               RT + I++        +P DF+ P   ++
Sbjct: 478 I--PRTTFLIDS------VQLPVDFQVPMIEYY 502

>CAGL0J11044g complement(1073988..1076198) weakly similar to
           sp|Q06644 Saccharomyces cerevisiae YDR307w PMT7,
           hypothetical start
          Length = 736

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 91/218 (41%), Gaps = 35/218 (16%)

Query: 340 DIAVGSSLVSIKN-QALGGTLLHSHVQTYPSGSSQQQVTTYGHNDSN-NNWVFDRIRGLP 397
           +I    S V I++ ++LGG L       Y SGS +Q        DS  NNW+ +      
Sbjct: 319 EIIFKKSTVRIRHVESLGGYLSTLPNVNYMSGSFEQIAFLSQFEDSELNNWIIEP----- 373

Query: 398 AWSINETEHEFVQDGRPYRLVHANTGRNLHTHPIPAPVSKTHW--EVSGYGDAQV-GDPK 454
             S     ++ V+ G   RL +  TG+ L       P+S   +  EVS  G A   GD  
Sbjct: 374 --STEAQNNKEVRSGSRIRLRNVVTGKLLRASSSRPPMSDQEYNSEVSLTGSANFSGDAD 431

Query: 455 DNWIIE------------FVSQPSDEDKSVLHTISTSFRIKNVEMGCYLAQTGPSLP-EW 501
           + W+I+             +  P  E+ + L   ++ F ++N   GC L      LP +W
Sbjct: 432 ETWLIDQKYVIGKAIPFNKMGLPPSENINALINTNSVFTLRNDGHGCMLLSHDTDLPDDW 491

Query: 502 G--------FRQGEVACISNPFKRDKRTWWNIETNVNE 531
                    F + E+ C + P K  K T++  E+ V++
Sbjct: 492 DSMSSFKPEFHRQELTCNTTPTK--KLTYFMFESVVDQ 527

>Kwal_33.13860
          Length = 578

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 470 KSVLHTISTSFRIKNVEMG--CYLAQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIET 527
           KS  H   T  ++K  ++G   Y ++   S PE G  QGE    S P+   KRT  +  T
Sbjct: 177 KSYQHQRPTEEKVKESKLGSSTYSSRFPSSAPEHGGTQGEHEGPSTPYSDGKRTRLHKTT 236

Query: 528 ----NVNERLPPMPEDF 540
               NV+    P P ++
Sbjct: 237 KQELNVDPPTSPFPTNY 253

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.139    0.448 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,449,593
Number of extensions: 1148364
Number of successful extensions: 3604
Number of sequences better than 10.0: 47
Number of HSP's gapped: 3486
Number of HSP's successfully gapped: 48
Length of query: 741
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 632
Effective length of database: 12,822,747
Effective search space: 8103976104
Effective search space used: 8103976104
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 65 (29.6 bits)