Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR289W41740917850.0
Kwal_26.71104554276902e-86
KLLA0F15862g4293746655e-83
YAL022C (FUN26)5174376072e-73
CAGL0J08712g4133945968e-73
Scas_548.14031502821e-27
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR289W
         (409 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR289W [1336] [Homologous to ScYAL022C (FUN26) - SH] complement...   692   0.0  
Kwal_26.7110                                                          270   2e-86
KLLA0F15862g complement(1466697..1467986) similar to sp|P31381 S...   260   5e-83
YAL022C (FUN26) [46] chr1 complement(108880..110433) Intracellul...   238   2e-73
CAGL0J08712g 858743..859984 similar to sp|P31381 Saccharomyces c...   234   8e-73
Scas_548.1                                                            113   1e-27

>ACR289W [1336] [Homologous to ScYAL022C (FUN26) - SH]
           complement(884850..886103) [1254 bp, 417 aa]
          Length = 417

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/409 (86%), Positives = 353/409 (86%)

Query: 1   MDDRRQLIDNTGTLESSGDGTTVSGFNASGKKEENQALTTCLAIGIALLWPWNCLLSASL 60
           MDDRRQLIDNTGTLESSGDGTTVSGFNASGKKEENQALTTCLAIGIALLWPWNCLLSASL
Sbjct: 1   MDDRRQLIDNTGTLESSGDGTTVSGFNASGKKEENQALTTCLAIGIALLWPWNCLLSASL 60

Query: 61  FFQQTLFTDSTVYAAIYXXXXXXXXXGASLVYNFYLSQRQSGYVNRVSRGLECQAGVFGA 120
           FFQQTLFTDSTVYAAIY         GASLVYNFYLSQRQSGYVNRVSRGLECQAGVFGA
Sbjct: 61  FFQQTLFTDSTVYAAIYTSTMMTTSTGASLVYNFYLSQRQSGYVNRVSRGLECQAGVFGA 120

Query: 121 LCVLVLAHRAIPMPXXXXXXXXXXXXXXXXXXXXQNGIMAITNIYGPSYSRAVMVGQAIA 180
           LCVLVLAHRAIPMP                    QNGIMAITNIYGPSYSRAVMVGQAIA
Sbjct: 121 LCVLVLAHRAIPMPLTFVLLMALVLLSSLATTMTQNGIMAITNIYGPSYSRAVMVGQAIA 180

Query: 181 GVLPSVVMFVLSLATQQERQSSGSAIVYFLSTVGISVTALLLYRSSSLHAGLVTPAQAIH 240
           GVLPSVVMFVLSLATQQERQSSGSAIVYFLSTVGISVTALLLYRSSSLHAGLVTPAQAIH
Sbjct: 181 GVLPSVVMFVLSLATQQERQSSGSAIVYFLSTVGISVTALLLYRSSSLHAGLVTPAQAIH 240

Query: 241 VPFRLLYSRLQAVVXXXXXXXXXXXXXPVFANATLAAVLLPNSQFIPLAFTIWNAGDLFG 300
           VPFRLLYSRLQAVV             PVFANATLAAVLLPNSQFIPLAFTIWNAGDLFG
Sbjct: 241 VPFRLLYSRLQAVVLSIFITFLFSLSFPVFANATLAAVLLPNSQFIPLAFTIWNAGDLFG 300

Query: 301 RLVADRPWVQAASIPHRLLAASALRGFMIPVFFLFNINGTHPHSGXXXXXXXXXXXXXXG 360
           RLVADRPWVQAASIPHRLLAASALRGFMIPVFFLFNINGTHPHSG              G
Sbjct: 301 RLVADRPWVQAASIPHRLLAASALRGFMIPVFFLFNINGTHPHSGLLLDLLYLFWHLFFG 360

Query: 361 LTNGLFITLAFMSVSALLDSDDQRKAASGFTNLFLALGLTCGSIFSYLV 409
           LTNGLFITLAFMSVSALLDSDDQRKAASGFTNLFLALGLTCGSIFSYLV
Sbjct: 361 LTNGLFITLAFMSVSALLDSDDQRKAASGFTNLFLALGLTCGSIFSYLV 409

>Kwal_26.7110
          Length = 455

 Score =  270 bits (690), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 156/427 (36%), Positives = 228/427 (53%), Gaps = 26/427 (6%)

Query: 4   RRQLIDNTGTLESSGDGTTVSGFNASGKKEENQALTTCLA---------IGIALLWPWNC 54
           ++  +D  G  E+  +   ++ F+      EN +L T L          IG+ALLWPWN 
Sbjct: 18  KKGAMDTPGEFEAFAE---INRFSRGDDLLENTSLLTKLKNLNYVSFLMIGVALLWPWNS 74

Query: 55  LLSASLFFQQTLFTDSTVYAAIYXXXXXXXXXGASLVYNFYLSQRQSGYVNRVSRGLECQ 114
            LSASL+FQ  +F D+T+YA +Y          +S+V+NF+LS+RQ  Y  R++RGL  +
Sbjct: 75  FLSASLYFQHDVFKDTTIYAHVYISTMMTISTISSVVFNFWLSKRQHSYAKRIARGLVWE 134

Query: 115 AGVFGALCVLVLAHRAIPMPXXXXXXXXXXXXXXXXXXXXQNGIMAITNIYGPSYSRAVM 174
             VFG LC+ V+ H+  P                      QNG MA+ N++G  +S+AVM
Sbjct: 135 ILVFGLLCLFVVVHKGFPDWMNFTFLMSMVLVSSLGTAMTQNGAMALANVFGAQFSQAVM 194

Query: 175 VGQAIAGVLPSVVMFVLSLATQQERQSSGSAIVYFLSTVGISVTALLLYRSSSLHAG--- 231
           +GQAIAGVLPS+V+F +S   +   QS G    YF STV +SV  ++LYR SS+      
Sbjct: 195 MGQAIAGVLPSLVLFAISYIGESRDQSVGGIFAYFFSTVLVSVACIILYRVSSIDGADKV 254

Query: 232 ------LVTPAQAIHVPFRLLYSRLQAVVXXXXXXXXXXXXXPVF-ANATLAAVLLPNSQ 284
                 + +  QA  VPF LL+ +L+ +V             PVF AN  +  + + N+Q
Sbjct: 255 DLLIQDVESDPQAEAVPFSLLFKKLRYLVLAIFTTFAVTLLFPVFAANTFVNGLPMHNAQ 314

Query: 285 FIPLAFTIWNAGDLFGRLVADRPWVQAASI-PHRLLAASALRGFMIPVFFLFNINGTHPH 343
           +IP  FT+WN GDL+GR ++   + Q+ +  P +    S  R  ++P FF FN+N +   
Sbjct: 315 YIPFIFTVWNLGDLYGRAISGYSFFQSENFTPFKAFLYSVARIALVPAFFCFNLNDSRKL 374

Query: 344 SG---XXXXXXXXXXXXXXGLTNGLFITLAFMSVSALLDSDDQRKAASGFTNLFLALGLT 400
           S                  G+TNG  ++++FM VS+ L +D QRKAA GFTN FL+ GL 
Sbjct: 375 SSPSPVLSDLLYILLQFVFGVTNGNALSVSFMKVSSQLTTDKQRKAAGGFTNTFLSAGLA 434

Query: 401 CGSIFSY 407
            GS+ SY
Sbjct: 435 FGSVLSY 441

>KLLA0F15862g complement(1466697..1467986) similar to sp|P31381
           Saccharomyces cerevisiae YAL022c FUN26 intracellular
           membrane protein involved in nucleoside transport
           singleton, start by similarity
          Length = 429

 Score =  260 bits (665), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 143/374 (38%), Positives = 208/374 (55%), Gaps = 9/374 (2%)

Query: 44  IGIALLWPWNCLLSASLFFQQTLFTDSTVYAAIYXXXXXXXXXGASLVYNFYLSQRQSGY 103
           IGIALLWPWN  LSASL+FQ  +F D++VYA IY          +S++ N  LS+ Q  Y
Sbjct: 48  IGIALLWPWNSFLSASLYFQHDVFQDTSVYARIYISTMMTVSTISSVLSNIILSKIQHHY 107

Query: 104 VNRVSRGLECQAGVFGALCVLVLAHRAIPMPXXXXXXXXXXXXXXXXXXXXQNGIMAITN 163
             R+  GL  +  VF +LC +VL HR +                       Q G+MA+ N
Sbjct: 108 TERIVSGLFFEIIVFTSLCGVVLFHRWLSHLLSFIMIMFLVLVSSVATALSQTGVMAMAN 167

Query: 164 IYGPSYSRAVMVGQAIAGVLPSVVMFVLSLATQQERQSSGSAIVYFLSTVGISVTALLLY 223
           ++GP Y+ AVMVGQA+AGVLPS+V+F++S+  Q++ Q++    +YFLST  +S  +++ Y
Sbjct: 168 VFGPEYNHAVMVGQAVAGVLPSLVLFMVSIFNQKQEQTATGINLYFLSTSVMSFASIVAY 227

Query: 224 RSSSL------HAGLVTPAQAIHVPFRLLYSRLQAVVXXXXXXXXXXXXXPVFANATLAA 277
           + S +       A        ++VPF++L+ +L+ +V             PVFA+ T   
Sbjct: 228 KKSDIPIIGGDMAQRTADEPKVYVPFKVLFLKLRYLVLSIFTIFCVTLIFPVFASNTYVV 287

Query: 278 VL-LPNSQFIPLAFTIWNAGDLFGRLVADRPWVQAASIPHRLLAASALRGFMIPVFFLFN 336
              L NS+FIP  F +WN GDL GR++A+  +      P ++   S LR  M+ VFFLFN
Sbjct: 288 RFPLRNSEFIPFIFMLWNIGDLVGRIIAEHTFNSKMLTPRKIFIYSQLRILMVAVFFLFN 347

Query: 337 ING--THPHSGXXXXXXXXXXXXXXGLTNGLFITLAFMSVSALLDSDDQRKAASGFTNLF 394
           +     + H G              GLTNGL  + +FM+V   LD++D+RKAA G TN+F
Sbjct: 348 VRNIRKNSHLGVFLDLSYSFWQFMFGLTNGLLASCSFMNVGRSLDTEDERKAAGGITNVF 407

Query: 395 LALGLTCGSIFSYL 408
           L++GL  GS+ SYL
Sbjct: 408 LSIGLASGSVISYL 421

>YAL022C (FUN26) [46] chr1 complement(108880..110433) Intracellular
           membrane protein involved in nucleoside transport [1554
           bp, 517 aa]
          Length = 517

 Score =  238 bits (607), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 141/437 (32%), Positives = 213/437 (48%), Gaps = 59/437 (13%)

Query: 31  KKEENQALTTCLAIGIALLWPWNCLLSASLFFQQTLFTDSTVYAAIYXXXXXXXXXGASL 90
           KK +N +  T  AIGI LLWPWNC+LSAS +F+  +F D++++A I+          +S+
Sbjct: 71  KKLKNLSYITFFAIGIGLLWPWNCILSASQYFKHDIFKDTSIWAKIFTSSMMSFSTISSM 130

Query: 91  VYNFYLSQRQSGYVNRVSRGLECQAGVFGALCVLVLAHRAIPMPXXXXXXXXXXXXXXXX 150
           ++N YL++RQ  Y  RV  GL  +  VF  +C   + H  +P                  
Sbjct: 131 LFNIYLAKRQYKYSRRVINGLVWEIIVFTVMCFFTILHFLLPKWFNFMFIMMLVVISSMG 190

Query: 151 XXXXQNGIMAITNIYGPSYSRAVMVGQAIAGVLPSVVMFVLSLATQQERQSSGSAIVYFL 210
               QNGIMAI N++G  YS+ VMVGQA+AGVLPS+V+F L+        ++G  ++YF 
Sbjct: 191 TAMTQNGIMAIANVFGSEYSQGVMVGQAVAGVLPSLVLFALAFIENSSVSTTGGILLYFF 250

Query: 211 STVGISVTALLLYRSSS-------------------LHAGLVTPAQAIHV---------- 241
           +T  +    ++++  S                    L   L +  + I +          
Sbjct: 251 TTTLVVTICVVMFSVSKISRKVNENWNVEDGHITDVLLGSLRSNEEEIRIVGRIDQMEDE 310

Query: 242 ----------------------PFRLLYSRLQAVVXXXXXXXXXXXXXPVFANATLAAVL 279
                                 PF +L+++L+ +V             PVFA+AT    L
Sbjct: 311 DHRRTNGTRDDNDEGEELQLKVPFEVLFAKLKYLVLSIFTTFVVTLVFPVFASATYVTGL 370

Query: 280 -LPNSQFIPLAFTIWNAGDLFGRLVADRPWVQAASI-PHRLLAASALRGFMIPVFFLFNI 337
            L N+Q+IPL FT+WN GDL+GR++AD P  +     P +    S LR   IP+F +F  
Sbjct: 371 PLSNAQYIPLIFTLWNLGDLYGRVIADWPMFRDQKFTPRKTFIYSLLRVAAIPLFLMFTA 430

Query: 338 -----NGTHPHSGXXXXXX-XXXXXXXXGLTNGLFITLAFMSVSALLDSDDQRKAASGFT 391
                +G   H+G               G+TNG  I+++FM V   LD+DD+++AA GFT
Sbjct: 431 ITSSSSGDEEHNGSVIVDLCYMLLQFLFGVTNGHVISMSFMKVPEQLDNDDEKEAAGGFT 490

Query: 392 NLFLALGLTCGSIFSYL 408
           N+F++ GL  GSI SY+
Sbjct: 491 NIFVSTGLALGSIISYV 507

>CAGL0J08712g 858743..859984 similar to sp|P31381 Saccharomyces
           cerevisiae YAL022c FUN26, hypothetical start
          Length = 413

 Score =  234 bits (596), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 141/394 (35%), Positives = 209/394 (53%), Gaps = 18/394 (4%)

Query: 31  KKEENQALTTCLAIGIALLWPWNCLLSASLFFQQTLFTDSTVYAAIYXXXXXXXXXGASL 90
           KK  N    T   IGI LLWPWNC+LSA L+F+ + F D T +A ++           SL
Sbjct: 16  KKLSNLEYFTFCMIGIGLLWPWNCVLSAVLYFKHSFFQDVTNWAKVFASSMMAVSTITSL 75

Query: 91  VYNFYLSQRQSGYVNRVSRGLECQAGVFGALCVLVLAHRAIPMPXXXXXXXXXXXXXXXX 150
           V+N +L+ RQ  Y  RV RGL  Q   F  L ++ + H  +PM                 
Sbjct: 76  VFNVWLANRQRNYTQRVVRGLVWQVMAFVVLAIICMVHNMLPMWFSFLFIMVVILFSSVA 135

Query: 151 XXXXQNGIMAITNIYGPSYSRAVMVGQAIAGVLPSVVMFVLSL-----ATQQERQSSGSA 205
               QNGI+AI N++G  YS+AVM+GQA+AGVLPSVV+F +S      A +   QS    
Sbjct: 136 TALTQNGILAIANVFGSEYSQAVMLGQAVAGVLPSVVLFGISYIGDSTAAETGEQSQAGI 195

Query: 206 IVYFLSTVGISVTALLLYRSSSLHAGL--VTPAQAIHV-------PFRLLYSRLQAVVXX 256
           IVY ++T  +   +  L++ + +      +   ++I V       PFR+L+ +L+ +V  
Sbjct: 196 IVYIITTAIVCGISTTLFKFTGIGGQFMAIMREESIDVDDNDEQIPFRVLFDKLRLLVLS 255

Query: 257 XXXXXXXXXXXPVFANATLAAVL-LPNSQFIPLAFTIWNAGDLFGRLVADRPWVQAASI- 314
                      PVFA+   +  L + +  ++PL FT+WN GDL+GR++AD P+ Q+ S  
Sbjct: 256 ILLTFVITLIFPVFASTVRSTGLGMKDEHYMPLIFTLWNLGDLYGRVLADLPYFQSPSFT 315

Query: 315 PHRLLAASALRGFMIPVFFLFNINGTHPHSGXXXXXXXXXXXXXXGLTNGLFITLAFMSV 374
           P +    + LR   IP FF F+ +    HS               GLTNG  I+L+FM V
Sbjct: 316 PLKTFIYALLRFLHIPFFFYFS-SRNDGHS-VALDIGYMLLQFVFGLTNGHVISLSFMKV 373

Query: 375 SALLDSDDQRKAASGFTNLFLALGLTCGSIFSYL 408
             +LD+D +++AA GFTN+F+++GL  GS+ SY+
Sbjct: 374 PQVLDNDLEKEAAGGFTNIFVSVGLALGSLVSYI 407

>Scas_548.1
          Length = 403

 Score =  113 bits (282), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 81/150 (54%)

Query: 32  KEENQALTTCLAIGIALLWPWNCLLSASLFFQQTLFTDSTVYAAIYXXXXXXXXXGASLV 91
           K ++    T + IGI LLWPWNC+LSAS +F+  +F D+T+++ I+          +S++
Sbjct: 197 KLQDLTYLTFVFIGIGLLWPWNCILSASQYFKHDIFQDTTIWSKIFTSSMMTTSTLSSMI 256

Query: 92  YNFYLSQRQSGYVNRVSRGLECQAGVFGALCVLVLAHRAIPMPXXXXXXXXXXXXXXXXX 151
           +N +LS+RQ  Y  RV RGL  +  VF  L  + L H    +                  
Sbjct: 257 FNIWLSRRQHSYSQRVIRGLIWEIIVFILLTFISLGHHWTXLWFNFVNVMILVLLSSVAT 316

Query: 152 XXXQNGIMAITNIYGPSYSRAVMVGQAIAG 181
              QNGIMAI N++G  YS+A MVGQ IAG
Sbjct: 317 AMTQNGIMAIANVHGGEYSQAXMVGQGIAG 346

 Score = 89.4 bits (220), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 85/145 (58%), Gaps = 5/145 (3%)

Query: 268 PVFANATLAAVLLP--NSQFIPLAFTIWNAGDLFGRLVADRPWVQAASIP-HRLLAASAL 324
           PVFA +T+ A  +P  +SQ+IPL FT+WN GDL+GR++AD P  +  +    ++   + L
Sbjct: 19  PVFA-STITATKIPMKDSQYIPLIFTVWNLGDLYGRVIADWPIFRNPNFTAFKVFIYAIL 77

Query: 325 RGFMIPVFFLFNINGTHPHSGXXXXXXXXXXXXXXGLTNGLFITLAFMSVSALLDSDDQR 384
           R   +P FF+        HS               G+TNG  I+++FM V   L SDD++
Sbjct: 78  RIIFVPFFFIIEHKNNTTHS-IMLDVCYILLQFFFGVTNGHAISVSFMKVPDQLVSDDEK 136

Query: 385 KAASGFTNLFLALGLTCGSIFSYLV 409
           +AA GFTN+F++ GL  GS+ SYLV
Sbjct: 137 EAAGGFTNIFVSTGLAVGSVLSYLV 161

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.137    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,667,047
Number of extensions: 301377
Number of successful extensions: 929
Number of sequences better than 10.0: 6
Number of HSP's gapped: 918
Number of HSP's successfully gapped: 8
Length of query: 409
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 305
Effective length of database: 12,995,837
Effective search space: 3963730285
Effective search space used: 3963730285
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 63 (28.9 bits)