Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR287W31831215560.0
KLLA0F15906g3493226018e-76
Sklu_1651.22392335241e-65
YAL020C (ATS1)3332734521e-53
Kwal_26.71183263234432e-52
CAGL0H06171g3543294418e-52
Scas_548.33693344281e-49
Kwal_14.15635033101303e-08
KLLA0F06600g4802941143e-06
Sklu_2379.25253071073e-05
AFL045C486307940.001
KLLA0D05753g613219870.008
Scas_652.20*48560850.012
CAGL0J05346g47756820.026
YLR077W583187820.031
YGL097W (SRM1)482333820.032
Kwal_34.159311398182820.036
CAGL0M05137g1351146750.28
Scas_519.4603186700.82
Scas_696.5d135994691.3
Kwal_14.1053592128672.0
ABR238W58334662.8
CAGL0M06567g39941628.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR287W
         (312 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR287W [1334] [Homologous to ScYAL020C (ATS1) - SH] complement(...   603   0.0  
KLLA0F15906g complement(1472413..1473462) similar to sp|P31386 S...   236   8e-76
Sklu_1651.2 YAL020C, Contig c1651 2778-3497 reverse complement        206   1e-65
YAL020C (ATS1) [48] chr1 complement(113617..114618) Protein invo...   178   1e-53
Kwal_26.7118                                                          175   2e-52
CAGL0H06171g complement(602526..603590) similar to sp|P31386 Sac...   174   8e-52
Scas_548.3                                                            169   1e-49
Kwal_14.1563                                                           55   3e-08
KLLA0F06600g complement(636501..637943) similar to sp|P21827 Sac...    49   3e-06
Sklu_2379.2 YGL097W, Contig c2379 2109-3686 reverse complement         46   3e-05
AFL045C [3148] [Homologous to ScYGL097W (SRM1) - SH] (354791..35...    41   0.001
KLLA0D05753g 494751..496592 similar to sgd|S0004067 Saccharomyce...    38   0.008
Scas_652.20*                                                           37   0.012
CAGL0J05346g complement(511794..513227) similar to sp|P21827 Sac...    36   0.026
YLR077W (YLR077W) [3492] chr12 (283873..285624) Protein of unkno...    36   0.031
YGL097W (SRM1) [1886] chr7 (321783..323231) GDP/GTP exchange fac...    36   0.032
Kwal_34.15931                                                          36   0.036
CAGL0M05137g 552160..556215 weakly similar to sp|P21827 Saccharo...    33   0.28 
Scas_519.4                                                             32   0.82 
Scas_696.5d                                                            31   1.3  
Kwal_14.1053                                                           30   2.0  
ABR238W [832] [Homologous to ScYLR077W - SH] complement(844738.....    30   2.8  
CAGL0M06567g complement(679126..680325) highly similar to sp|Q12...    28   8.1  

>ACR287W [1334] [Homologous to ScYAL020C (ATS1) - SH]
           complement(880816..881772) [957 bp, 318 aa]
          Length = 318

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/312 (93%), Positives = 293/312 (93%)

Query: 1   MVPHLTFECAKKPIKIACGGNHSLMLMEDGQLWAAGDGRQGQFASKDTKCAFAWSELPGT 60
           MVPHLTFECAKKPIKIACGGNHSLMLMEDGQLWAAGDGRQGQFASKDTKCAFAWSELPGT
Sbjct: 1   MVPHLTFECAKKPIKIACGGNHSLMLMEDGQLWAAGDGRQGQFASKDTKCAFAWSELPGT 60

Query: 61  FEDVACGWDYSVVIDEHGNVLACGAGLNGELGLGHVKCSGAWRRVTTCLNPSRAVYSSFQ 120
           FEDVACGWDYSVVIDEHGNVLACGAGLNGELGLGHVKCSGAWRRVTTCLNPSRAVYSSFQ
Sbjct: 61  FEDVACGWDYSVVIDEHGNVLACGAGLNGELGLGHVKCSGAWRRVTTCLNPSRAVYSSFQ 120

Query: 121 NVVLRDGNKLYGWGPNRKGQLKEPKNKGFDTPTLIYEGRDITQVAMGKDFIAIVDAGKLV 180
           NVVLRDGNKLYGWGPNRKGQLKEPKNKGFDTPTLIYEGRDITQVAMGKDFIAIVDAGKLV
Sbjct: 121 NVVLRDGNKLYGWGPNRKGQLKEPKNKGFDTPTLIYEGRDITQVAMGKDFIAIVDAGKLV 180

Query: 181 ISGTMXXXXXXXXXXXXXXXXXXXAAMWSSLHIWTKRDIFSYGNGNYGQMFVWERPPNMT 240
           ISGTM                   AAMWSSLHIWTKRDIFSYGNGNYGQMFVWERPPNMT
Sbjct: 181 ISGTMKDRINDIIRDISSEEIIKIAAMWSSLHIWTKRDIFSYGNGNYGQMFVWERPPNMT 240

Query: 241 HFAAGSEHGVMSLADGRVFCWGWGEHGNCGPSAKGHDAASPFNDKSNIVSPLNCVLETNE 300
           HFAAGSEHGVMSLADGRVFCWGWGEHGNCGPSAKGHDAASPFNDKSNIVSPLNCVLETNE
Sbjct: 241 HFAAGSEHGVMSLADGRVFCWGWGEHGNCGPSAKGHDAASPFNDKSNIVSPLNCVLETNE 300

Query: 301 KIIWIQGGCATS 312
           KIIWIQGGCATS
Sbjct: 301 KIIWIQGGCATS 312

>KLLA0F15906g complement(1472413..1473462) similar to sp|P31386
           Saccharomyces cerevisiae YAL020c ATS1 alpha-tubulin
           suppressor singleton, start by similarity
          Length = 349

 Score =  236 bits (601), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 137/322 (42%), Positives = 190/322 (59%), Gaps = 14/322 (4%)

Query: 1   MVPHLTFECAKKPIK-IACGGNHSLMLMEDGQLWAAGDGRQGQFASKDTKCAFAWSELPG 59
           M+P L+F+     IK ++CGGNHSL+L+EDG L+  GD   GQ AS D K +  W  +PG
Sbjct: 26  MLPQLSFQSDGVGIKKVSCGGNHSLLLLEDGSLYWCGDNSSGQCASSDIKISLEWIPIPG 85

Query: 60  TFEDVACGWDYSVVIDEHGNVLACGAGLNGELGLGHVKCSGAWRRVTTCLNPSRA-VYSS 118
            F D+ACGW+ ++VIDE G V   G G  GELG+  +K S  W  +  C +P  +  Y++
Sbjct: 86  KFLDIACGWEVTIVIDEDGWVKTRGRGDKGELGVPRLKHSTEWIDLFRCEDPKGSRCYAT 145

Query: 119 FQNVVLRDGNKLYGWGPNRKGQL-KEPKNKGFDTPTLIYEG--RDITQVAMGKDFIAIVD 175
           FQ+ V+    K+YGWG NRK Q+  +   K  + P +IYEG   DI ++A+GKDF  ++ 
Sbjct: 146 FQHCVVVVPEKIYGWGNNRKLQVCDDSALKIIEEPKVIYEGDTSDI-EMALGKDFTCVLS 204

Query: 176 --AGKLVISGTMXXXXXXXXXXXXXX--XXXXXAAMWSSLHIWT-KRDIFSYGNGNYGQM 230
               KL+I G++                      +MWSSLHI T +R + S G G++GQ 
Sbjct: 205 RTENKLIIKGSLAKELPELISQLSHDFGSIAKIDSMWSSLHILTGERKLISIGRGSHGQF 264

Query: 231 FVWERPPNMTHFAAGSEHGVMSLADGRVFCWGWGEHGNCGPSAKGHDAASPFNDKSNIVS 290
                P     F  GSEHGV++ AD +V+CWGWGEHGNCG   K     +P NDKSN++S
Sbjct: 265 LEEPLPSETLDFVTGSEHGVVTTADMKVYCWGWGEHGNCGSLFKTE--TNPINDKSNVIS 322

Query: 291 PLNCVLETNEKIIWIQGGCATS 312
           PLN ++   EK++ I GGCAT+
Sbjct: 323 PLN-MIGKYEKVVSIFGGCATT 343

>Sklu_1651.2 YAL020C, Contig c1651 2778-3497 reverse complement
          Length = 239

 Score =  206 bits (524), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 135/233 (57%), Gaps = 3/233 (1%)

Query: 81  LACGAGLNGELGLGHVKCSGAWRRVTTCLNPSRAVYSSFQNVVLRDGNKLYGWGPNRKGQ 140
           ++CG G  GELG G  K   +   V    + +R +YSSFQN  L DG K++GWGPNR+ Q
Sbjct: 1   MSCGWGPKGELGQGSTKKCQSLELVMETSSTAR-IYSSFQNCYLVDGQKIFGWGPNRRCQ 59

Query: 141 LKEPKNKGFDTPTLIYEGRDITQVAMGKDFIAIVDAGKLVISGTMXXXXXXXXXXXXXXX 200
           L   K+KGFD P LIY+G  +     G+DF+      KL I+G++               
Sbjct: 60  LNSSKSKGFDVPVLIYDGERVDHFCTGRDFVCFSSGQKLHINGSLNTQLTKMSYDVENKD 119

Query: 201 XXXXAAMWSSLHIWTKRDIFSYGNGNYGQMFVWERPPNMTHFAAGSEHGVMSLADGRVFC 260
               A MWSSLHIW    + SYGNG++GQM   E PP +T    GSEHG++ L D RV C
Sbjct: 120 VLKLAGMWSSLHIWIPDRVLSYGNGSHGQMLTDELPPGVTQLVTGSEHGILCLNDKRVVC 179

Query: 261 WGWGEHGNCGPSAKGHDAASPFNDKSNIVSPLNCVLETN-EKIIWIQGGCATS 312
           WGWGEHGNCG       + S  ND+SN VSPLN V E + E++ W  GGCA++
Sbjct: 180 WGWGEHGNCG-RLPNSSSKSEINDRSNTVSPLNVVYECHGERVEWCYGGCAST 231

>YAL020C (ATS1) [48] chr1 complement(113617..114618) Protein
           involved in susceptibility to the Kluyveromyces lactis
           toxin zymocin, overproduction suppresses mutations in
           alpha tubulin [1002 bp, 333 aa]
          Length = 333

 Score =  178 bits (452), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 105/273 (38%), Positives = 141/273 (51%), Gaps = 24/273 (8%)

Query: 15  KIACGGNHSLMLMEDGQLWAAGDGRQGQFASKDT-KCAFAWS--ELPGTFEDVACGWDYS 71
           KIACGGNHS+ML  DG L   GD R+G+  S    +    W   E+P    DVACGWD +
Sbjct: 40  KIACGGNHSVMLTNDGNLVGCGDNRRGELDSAQALRQVHDWRPVEVPAPVVDVACGWDTT 99

Query: 72  VVIDEHGNVLACGAGLNGELGLGHVKCSGAWRRVTTCLNPSRAVYSSFQNVVLRDGNKLY 131
           V++D  G V   G G   E    HV  +    R+        AVY  FQN V+  G ++Y
Sbjct: 100 VIVDADGRVWQRGGGCY-EFTQQHVPLNSNDERI--------AVYGCFQNFVVVQGTRVY 150

Query: 132 GWGPNRKGQLKEPKNKGFDTPTLIYEGRDIT--QVAMGKDFIAIVDAGKLVISGTMXXXX 189
           GWG N K QL+EPK++    P L+Y+   +    VAMGKDF+ IVD G  ++  +     
Sbjct: 151 GWGSNTKCQLQEPKSRSLKEPVLVYDTGSVAVDYVAMGKDFMVIVDEGGRIVHASGRLPT 210

Query: 190 XXXXXXXXXXXXXXXAAMWSSLHIWTKR--DIFSYGNGNYGQMFVWERPP-NMTHFAAGS 246
                            MW+S+H+W  R   + S+G G + Q+F  ER    +   A GS
Sbjct: 211 GFELKQQQKRHNLVVLCMWTSIHLWNARLNTVESFGRGTHSQLFPQERLDFPIVGVATGS 270

Query: 247 EHGVMSLADGR-------VFCWGWGEHGNCGPS 272
           EHG+++ A+         V+CWGWGEHGNCGP 
Sbjct: 271 EHGILTTANQEGKSHCYNVYCWGWGEHGNCGPQ 303

>Kwal_26.7118
          Length = 326

 Score =  175 bits (443), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 112/323 (34%), Positives = 160/323 (49%), Gaps = 18/323 (5%)

Query: 1   MVPHLTFECAKKPIKIACGGNHSLMLMEDGQLWAAGDGRQGQFASKDTKCAFAWSELPGT 60
           MVP  TF    +P+K+  GGN +++L+ +G+++ AGD         +T     WS++PGT
Sbjct: 1   MVPQTTFVSEIRPVKVVAGGNFTVILLRNGEMYIAGDCMLEPDRQTET-----WSKIPGT 55

Query: 61  FEDVACGWDYSVVIDEHGNVLACGAGLNGELGLGHVKCSGAWRRVTTCLNPSRAVYSSFQ 120
           F DVACGW + V I     V+  G G  GELG G    S     V    + +  V++ F 
Sbjct: 56  FSDVACGWSHIVAITGDSKVVTAGVGAKGELGQGKRVESPKLETVMEVQDQNAQVFACFY 115

Query: 121 NVVLRDGNKLYGWGPNRKGQLKEPKNKGFDTPTLIYEGRDITQVAMGKDFIAIVDAGKLV 180
           N  + DG  LYGWG N K QL++ K+K    P L+  G DI++V  GK+ I  V  G++ 
Sbjct: 116 NSYVLDGENLYGWGSNTKCQLQDSKSKSEKLPVLVQAG-DISRVCAGKNSICFVAGGQIY 174

Query: 181 ISGTMXXXXXXXXXXXXXXXXXXXAAMWSSLHIWTKRDIFSYGNGNYGQMFVWERPP-NM 239
             G M                    +MW+S+    K     +G   + Q  +   P  ++
Sbjct: 175 ARGAMAKYLSQMRSELQVSDELQLKSMWTSVTSLDKGQFRFFGPAAHKQDAIVGWPAGSV 234

Query: 240 THFAAGSEHGVMSLADGRVFCWGWGEHGNCGP---SAKGHDAASPF-----NDKSNIVSP 291
           T ++ GSEH V+   +  VFCWGWGEHGNCG    S+    A +P      ND+SNI SP
Sbjct: 235 TTWSTGSEHAVL-CREQHVFCWGWGEHGNCGAPNGSSVALAATNPVQDLGANDQSNICSP 293

Query: 292 LN--CVLETNEKIIWIQGGCATS 312
           +N   V    E +     GCAT+
Sbjct: 294 VNPVYVCAPYENVYSCFAGCATT 316

>CAGL0H06171g complement(602526..603590) similar to sp|P31386
           Saccharomyces cerevisiae YAL020c ATS1, hypothetical
           start
          Length = 354

 Score =  174 bits (441), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 119/329 (36%), Positives = 175/329 (53%), Gaps = 33/329 (10%)

Query: 15  KIACGGNHSLMLMEDGQLWAAGDGRQGQFASKD-TKCAFAWSELPGTFE--DVACGWDYS 71
           KI+CGGNH+++L+  G++   GD   GQ  S D  K    W E+   +   DV C WD +
Sbjct: 17  KISCGGNHTVILLSTGRVLGCGDNSLGQLCSDDQAKQIIGWKEICSGYNVIDVTCCWDST 76

Query: 72  VVIDEHGNVLACGAGLNGELGLG--HVKCSGAWRRVTTCLNPS-RAVYSSFQNVVL---- 124
            ++   G V + G+GL GELGLG  +++    +  V  C   +   VYSSFQN +L    
Sbjct: 77  TIVTADGKVYSRGSGLKGELGLGSSNLENKSNFELVMDCSKYAGYRVYSSFQNCILVLDK 136

Query: 125 --RDGNKLYGWGPNRKGQLKEPKNKGFDTPTLIYEGRDI--TQVAMGKDF-IAIVDAGKL 179
              +G+ +Y WG N K Q+ EPK++   +P ++YE  +I    V MGKDF + +   GK+
Sbjct: 137 KEDNGSIVYAWGNNTKCQINEPKSRRLASPIVMYETFEIRVANVVMGKDFNLLMTPQGKI 196

Query: 180 V-ISG-TMXXXXXXXXXXXXXXXXXXXAAMWSSLHIWTKRD---IFSYGNGNYGQMFVWE 234
           + ++G T                     +MWSS+HI  K D   I SYGN  +GQ+F   
Sbjct: 197 IHVNGKTPEDFTKDFETRWKFAKELEVKSMWSSIHIRDKSDPNKIHSYGNNIHGQVFDQS 256

Query: 235 R-PPN--MTHFAAGSEHGVMSLADG--------RVFCWGWGEHGNCGPSAKGHDAASPFN 283
           +  P+  + +F  GSEHG++   D         ++ CWGWGEHGNCG S + H+     N
Sbjct: 257 QLSPSECIANFTTGSEHGILVSKDRDHNDHELYQLSCWGWGEHGNCG-SVQDHEEKQWVN 315

Query: 284 DKSNIVSPLNCVLETNEKIIWIQGGCATS 312
           DK N+ SPLN V +   + + + GGCAT+
Sbjct: 316 DKHNVTSPLNPVAKAISRPM-VYGGCATT 343

>Scas_548.3
          Length = 369

 Score =  169 bits (428), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 124/334 (37%), Positives = 177/334 (52%), Gaps = 22/334 (6%)

Query: 1   MVPHLTFECAKKPIKIACGGNHSLMLMEDGQLWAAGDGRQGQFASKD-TKCAFAWSELPG 59
           +VP +TF       KIACGGNH+LMLM DG  +  GD    +      T+    W  L  
Sbjct: 30  IVPQMTFMNESASKKIACGGNHTLMLMADGSCYGTGDNSMREIRDDTGTEILKGWHLLND 89

Query: 60  T---FEDVACGWDYSVVIDEHGNVLACGAGLNGELGLGHVKCSGAWRRVTTC-LNPSRAV 115
           +   ++DV CGW+++V+ +    +L+ G G  GELGLG +  S  +++V     +    +
Sbjct: 90  SESRYKDVTCGWEFTVICNSQNEILSRGIGGKGELGLGGMCKSDIFKKVMAFGKDDEVKL 149

Query: 116 YSSFQN--VVLRDGNK--LYGWGPNRKGQLKEPKN-KGFDTPTLIYEGRD--ITQVAMGK 168
           +SSFQN  V++  G K  +YGWG N K QL EP+  K  D P  I+E     +  V+MGK
Sbjct: 150 FSSFQNCCVLVNTGTKSTVYGWGSNMKCQLFEPRTGKKVDQPIKIFESTTDILDYVSMGK 209

Query: 169 DFIAIVDA-GKLV-ISGTMXXXXXXXXXXXXXXXXXXXAAMWSSLHIWTKRDIFSYGNGN 226
           DFI  V+  G++V I G +                   + MWSS+HI  +  I+SYG G 
Sbjct: 210 DFIVFVNKLGQIVDIKGNIPKGFQREEWLRADQKGIQVSCMWSSIHILKEGKIYSYGYGT 269

Query: 227 YGQMFVWE--RPPNMTHFAAGSEHGVMSLADG-----RVFCWGWGEHGNCGP-SAKGHDA 278
           +GQ+F  E  R  ++  F  GSEHG++ L D      +V CWGWGEHGNCG   ++    
Sbjct: 270 FGQIFQNEENRSLSVEGFTTGSEHGILVLPDKHDKTQQVSCWGWGEHGNCGRLQSQQESQ 329

Query: 279 ASPFNDKSNIVSPLNCVLETNEKIIWIQGGCATS 312
               ND SN+ SPLN V+      + I GGC+++
Sbjct: 330 QEDVNDYSNMSSPLNTVMSGLPNGVRIFGGCSST 363

>Kwal_14.1563
          Length = 503

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 78/310 (25%), Positives = 119/310 (38%), Gaps = 47/310 (15%)

Query: 12  KPIKIACGGNHSLMLMEDGQLWAAGDGRQGQ----FASKDTKC-AFAW---SELPGTFED 63
           K +++A   N S +L+++G+++A G  R  +    F     K  A  W   S  P     
Sbjct: 187 KVVQLAATDNLSCVLLDNGKVYAWGTFRSNEGILGFYEDQIKIQAMPWEIPSFSPSKIVQ 246

Query: 64  VACGWDYSVVIDEHGNVLACGAGLNGELGLGHVKCSGAWRRVTTCLNPSRAVY-SSFQN- 121
           +A G D+ + +DE G V A G G   +LG   ++ S             +  Y +S +N 
Sbjct: 247 MAPGKDHILFLDEGGVVYAWGNGQQYQLGRKIMERSRLRTLSPRAFGLDKVKYIASGENH 306

Query: 122 --VVLRDGNKLYGWGPNRKGQ--LKEPKNKG----FDTPTLIYEGRDITQVAMGKDF-IA 172
              + RDG KLY WG N+ GQ  + E    G      T  L+ EG  +  V+ G+   + 
Sbjct: 307 SFALTRDG-KLYSWGLNQFGQCGVSEEVEDGALVTIPTEVLLPEGTKVKMVSAGEHHSMV 365

Query: 173 IVDAGKLVISGTMXXXXXXXXXXXXXXXXXXXAAMWSSLHIWTKRDIFSYGNGNYGQMFV 232
           + + G+L   G                           L   T  D+       +G+   
Sbjct: 366 LTEEGELFTFGRFDMFEIGIAK--------------DKLPEETYVDV-------HGKPRA 404

Query: 233 WERP------PNMTHFAAGSEHGVMSLADGRVFCWGWGEHGNCGPSAKGHDAASPFNDKS 286
              P      P   + AAGS H +    DG VF WG+GE    G    G D  +P   K+
Sbjct: 405 VPVPTKLVDVPRFKNIAAGSHHSLAISEDGVVFSWGFGETYAVGLGPSGDDIETPTRIKN 464

Query: 287 NIVSPLNCVL 296
                 N + 
Sbjct: 465 TATQDHNIMF 474

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 69/206 (33%), Gaps = 66/206 (32%)

Query: 123 VLRDGNKLYGWGPNRKGQ----LKEPKNKGFDTPTLI--YEGRDITQVAMGKDFIAIVDA 176
           VL D  K+Y WG  R  +      E + K    P  I  +    I Q+A GKD I  +D 
Sbjct: 200 VLLDNGKVYAWGTFRSNEGILGFYEDQIKIQAMPWEIPSFSPSKIVQMAPGKDHILFLDE 259

Query: 177 GKLVISGTMXXXXXXXXXXXXXXXXXXXAAMWSSLHIWTKRDIFSYGNGNYGQM--FVWE 234
           G +V                                       +++GNG   Q+   + E
Sbjct: 260 GGVV---------------------------------------YAWGNGQQYQLGRKIME 280

Query: 235 RP------------PNMTHFAAGSEHGVMSLADGRVFCWGWGEHGNCGPSAKGHDAASPF 282
           R               + + A+G  H      DG+++ WG  + G CG S +  D A   
Sbjct: 281 RSRLRTLSPRAFGLDKVKYIASGENHSFALTRDGKLYSWGLNQFGQCGVSEEVEDGAL-- 338

Query: 283 NDKSNIVSPLNCVLETNEKIIWIQGG 308
                +  P   +L    K+  +  G
Sbjct: 339 -----VTIPTEVLLPEGTKVKMVSAG 359

>KLLA0F06600g complement(636501..637943) similar to sp|P21827
           Saccharomyces cerevisiae YGL097w SRM1 GDP/GTP exchange
           factor for GSP1P/GSP2P singleton, start by similarity
          Length = 480

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 117/294 (39%), Gaps = 48/294 (16%)

Query: 14  IKIACGGNHSLMLMEDGQLWAAG-----DGRQGQFASKDTKCAFAWSELP-----GTFED 63
           ++IA   N S  L E+G ++A G     +G  G +  + T     W  +P          
Sbjct: 165 VQIAATDNLSAALFENGDVYAWGTFRCNEGILGFYRDEITVQKTPWI-IPNFSKKAKIVQ 223

Query: 64  VACGWDYSVVIDEHGNVLACGAGLNGELGLGHVKCSGAWRRVTTCLNP------SRAVYS 117
           +A G D+ + +DE G V A G G   +LG   ++ S    R+ T L+P      +    S
Sbjct: 224 MAAGKDHILFLDETGIVYAWGNGQQQQLGRRILERS----RLRT-LDPRPFGLDNIKYIS 278

Query: 118 SFQN--VVLRDGNKLYGWGPNRKGQ------LKEPKNKGFDTPTLIYEGRDITQVAMGKD 169
           S +N    L    KLY WG N+ GQ      L++       T  ++ EG +I  V+ G+ 
Sbjct: 279 SGENHSFALSTDGKLYSWGLNQFGQCGISTELEDGSLVSVPTEVILPEGVEIDSVSAGEH 338

Query: 170 FIAIV-DAGKLVISGTMXXXXXXXXXXXXXXXXXXXAAMWSSLHIWTKRDIFSYGNGNYG 228
              I+  +G L   G +                         L  +T +D+  +G     
Sbjct: 339 HTLILAKSGDLYSCGRLDMFEVGISK--------------DKLPEYTYKDV--HGKARSI 382

Query: 229 QMFV-WERPPNMTHFAAGSEHGVMSLADGRVFCWGWGEHGNCGPSAKGHDAASP 281
            +    E  P+    AAGS H +    +G V+ WG+GE    G    G D  +P
Sbjct: 383 PLPTKLEDVPSFKAIAAGSHHSLAIAKNGIVYSWGFGETYAVGLGPSGDDIETP 436

>Sklu_2379.2 YGL097W, Contig c2379 2109-3686 reverse complement
          Length = 525

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 68/307 (22%), Positives = 111/307 (36%), Gaps = 39/307 (12%)

Query: 12  KPIKIACGGNHSLMLMEDGQLWAAG-----DGRQGQFASKDTKCAFAW-----SELPGTF 61
           K +++A   N S  L+++G+++A G     +G  G + +K       W     S      
Sbjct: 207 KVVQLAATDNFSCALLDNGEVYAWGTFRCNEGILGFYQNKIKIQRTPWKVPTFSSTKSKI 266

Query: 62  EDVACGWDYSVVIDEHGNVLACGAGLNGELG---LGHVKCSGAWRRVTTCLNPSRAVYSS 118
             +A G D+ + +DE G V A G G   +LG   +   +      R     N        
Sbjct: 267 VQLAPGKDHILFLDECGVVYAWGNGQQYQLGRKIMERSRLRTLEPRAFGLDNIKYIASGE 326

Query: 119 FQNVVLRDGNKLYGWGPNRKGQ------LKEPKNKGFDTPTLIYEGRDITQVAMGKDF-I 171
             +  L    KLY WG N+ GQ      +++       T  L+ EG  +  V+ G+   I
Sbjct: 327 NHSFALAKDGKLYSWGLNQFGQCGVSSEVEDGALVTVPTEVLLPEGTRVKAVSAGEHHSI 386

Query: 172 AIVDAGKLVISGTMXXXXXXXXXXXXXXXXXXXA-AMWSSLHIWTK-RDIFSYGNGNYGQ 229
            + + G L   G +                   A     ++ + TK  D+          
Sbjct: 387 VLTEDGDLYTFGRLDMFEVGIPKDKLPESTFKDAHGKARAIPVPTKLSDV---------- 436

Query: 230 MFVWERPPNMTHFAAGSEHGVMSLADGRVFCWGWGEHGNCGPSAKGHDAASPFNDKSNIV 289
                  P   + +AGS H +    DG V+ WG+GE    G    G D  +P   K+   
Sbjct: 437 -------PKFKNVSAGSHHSLAVSEDGIVYSWGFGETYAVGLGPSGEDIETPTRIKNTAT 489

Query: 290 SPLNCVL 296
              N + 
Sbjct: 490 QDHNIMF 496

>AFL045C [3148] [Homologous to ScYGL097W (SRM1) - SH]
           (354791..356251) [1461 bp, 486 aa]
          Length = 486

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 72/307 (23%), Positives = 118/307 (38%), Gaps = 48/307 (15%)

Query: 1   MVPHLTFEC-AKKPIKIACGGNHSLMLMEDGQLWAAGDGR--QG-----QFASKDTKCAF 52
           M+P  +     +K +++A   N S +L E+G ++A G  R  +G     Q A +  +  +
Sbjct: 157 MLPRDSLPLDTQKVVQLAATDNLSCVLFENGDVYAWGTFRCNEGILGFYQDAIESQRSPW 216

Query: 53  AWSELPGT-FEDVACGWDYSVVIDEHGNVLACGAGLNGELGLGHVKCSGAWRRVTTCLNP 111
                 G+    +A G D+ + +DEHG V A G G   +LG   ++ S    R+ T L+P
Sbjct: 217 KLPSFSGSRIVQMAPGKDHILFLDEHGVVYAWGNGQQYQLGRKIMERS----RLRT-LDP 271

Query: 112 SRAV-------YSSFQN--VVLRDGNKLYGWGPNRKGQ------LKEPKNKGFDTPTLIY 156
            RA         +S +N    L D  +L+ WG N+ GQ      +++       T  L+ 
Sbjct: 272 -RAFGLDGVKYIASGENHSFALADDGRLFAWGLNQFGQCGISNEVEDGAMVTVPTEVLLP 330

Query: 157 EGRDITQVAMGKDF-IAIVDAGKLVISGTMXXXXXXXXXXXXXXXXXXXA-AMWSSLHIW 214
               +  +A G+   I +   G L   G +                         S+ + 
Sbjct: 331 PDVKVESIAAGEHHSIVLTQDGDLYTFGRLDMFEVGISAEDYPESTYKDVHGKARSVPVP 390

Query: 215 TKRDIFSYGNGNYGQMFVWERPPNMTHFAAGSEHGVMSLADGRVFCWGWGEHGNCGPSAK 274
           TK                 +  P     AAGS H +    +G ++ WG+GE    G    
Sbjct: 391 TK----------------LKGLPKFKAIAAGSHHSLAVARNGIIYSWGFGETYAVGLGPA 434

Query: 275 GHDAASP 281
           G D   P
Sbjct: 435 GEDVEVP 441

>KLLA0D05753g 494751..496592 similar to sgd|S0004067 Saccharomyces
           cerevisiae YLR077w, hypothetical start
          Length = 613

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 84/219 (38%), Gaps = 51/219 (23%)

Query: 15  KIACGGNHSLMLMEDGQLWAAG---DGRQGQFASKDTKCA---FAWSELPGTFE------ 62
           KIACG  H+L     G+L++ G    G+ GQ  S D +        S   G FE      
Sbjct: 377 KIACGDYHTLACDSVGELYSFGLNTYGQLGQSISYDMEYVPFPKKVSSFSGHFEKHDFLK 436

Query: 63  --DVACG-------------------WDYSVVIDEHGN---VLACGAGLNGELGLGHVKC 98
             ++ C                     D+++ ID   +     A G G+ G+LG GH K 
Sbjct: 437 CVEINCSGNTSFVSILPQDVHRYFKNKDFAIDIDNDKDNITYFAFGNGIQGQLGNGHFKH 496

Query: 99  SGAWRRVTTCLNPSRA-VYSSFQNVVLRD-------------GNKLYGWGPNRKGQLKEP 144
           S +       +N  +    +S + +++RD               ++  WG N  GQL   
Sbjct: 497 SQSTPTRMKVINDLKDNTVNSDKRILIRDWYCGEQHAFVRLKNGEIMCWGYNENGQLGNG 556

Query: 145 KNKGFDTPTLIYEGRDITQVAMGKDFIAIVDA-GKLVIS 182
           K   +D P  I    +  +   GK+   + D   KLVIS
Sbjct: 557 KKIKWDKPAYIPRLLEPGERFNGKNLDILYDENNKLVIS 595

 Score = 32.3 bits (72), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 245 GSEHGVMSLADGRVFCWGWGEHGNCGPSAK 274
           G +H  + L +G + CWG+ E+G  G   K
Sbjct: 529 GEQHAFVRLKNGEIMCWGYNENGQLGNGKK 558

>Scas_652.20*
          Length = 485

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 27/60 (45%)

Query: 237 PNMTHFAAGSEHGVMSLADGRVFCWGWGEHGNCGPSAKGHDAASPFNDKSNIVSPLNCVL 296
           P   + AAGS H +    +G V+ WG+GE    G    G D  +P   K+      N +L
Sbjct: 396 PAFKNIAAGSHHSLAIATNGIVYSWGFGETYAVGLGPAGEDVETPTRIKNTATQDHNIIL 455

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 45/97 (46%), Gaps = 20/97 (20%)

Query: 16  IACGGNHSLMLMEDGQLWAAGDGRQGQFA---SKDTKCAFAWSELPG------------- 59
           I+ G +HSL+L+EDG L+    GR   F     KD    + + ++ G             
Sbjct: 337 ISAGEHHSLVLLEDGTLYTF--GRLDMFEVGIGKDHLPRYTYKDVHGKARSVPLPTKLTG 394

Query: 60  --TFEDVACGWDYSVVIDEHGNVLACGAGLNGELGLG 94
              F+++A G  +S+ I  +G V + G G    +GLG
Sbjct: 395 VPAFKNIAAGSHHSLAIATNGIVYSWGFGETYAVGLG 431

>CAGL0J05346g complement(511794..513227) similar to sp|P21827
           Saccharomyces cerevisiae YGL097w SRM1 GDP/GTP exchange
           factor for GSP1P/GSP2P, start by similarity
          Length = 477

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 26/56 (46%)

Query: 241 HFAAGSEHGVMSLADGRVFCWGWGEHGNCGPSAKGHDAASPFNDKSNIVSPLNCVL 296
           + AAGS H +    DG+++ WG+GE    G    G D   P    +     ++ VL
Sbjct: 407 NIAAGSHHSIAISQDGKLYTWGFGETYAVGQGPAGDDIEVPVKITNTATKEVDMVL 462

>YLR077W (YLR077W) [3492] chr12 (283873..285624) Protein of unknown
           function [1752 bp, 583 aa]
          Length = 583

 Score = 36.2 bits (82), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 72/187 (38%), Gaps = 45/187 (24%)

Query: 15  KIACGGNHSLMLMEDGQLWAAGDGRQGQFA------------SKDTKCAFAWSELPGTFE 62
           KIACG  H+L + + G+++A G  R GQ A             +    AF     PG   
Sbjct: 376 KIACGSYHTLAIDKTGEIYAFGWNRFGQLALPISYNLEYVSFPRSVTHAFK-PHFPGMTN 434

Query: 63  ----DVACGWDYSVVI--------DEHGNVLACGAGLNGELG--------LGHVKCSGAW 102
               D+ C  + S V         D H    A G GL GELG           +K     
Sbjct: 435 WKCVDIHCDDETSFVTIRKPGSTSDHH--YFAFGNGLFGELGNNTFKNSQCDPIKIKSDD 492

Query: 103 RRVTTCLNPSRAVYSSFQNVVLRDGNKLYGWGPNRKGQLKEPKN-----KGFDTPTLIYE 157
           +++T     S  V++  +       N++  WG N  GQL   K      K  + P ++  
Sbjct: 493 KKLTNWSCGSHCVFTETEQ-----ENEVIAWGNNDHGQLGIGKKTMKCAKPMNIPEVLKP 547

Query: 158 GRDITQV 164
           G+D T +
Sbjct: 548 GQDTTDL 554

>YGL097W (SRM1) [1886] chr7 (321783..323231) GDP/GTP exchange factor
           for Gsp1p and Gsp2p, functions in the nuclear export of
           the small ribosomal subunit [1449 bp, 482 aa]
          Length = 482

 Score = 36.2 bits (82), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 78/333 (23%), Positives = 120/333 (36%), Gaps = 77/333 (23%)

Query: 12  KPIKIACGGNHSLMLMEDGQLWAAG-----DGRQGQFASKDTKCAFAWSELPGTFE---- 62
           K +++A   N S  L  +G+++A G     +G  G +  K       W ++P TF     
Sbjct: 166 KVVQLAATDNMSCALFSNGEVYAWGTFRCNEGILGFYQDKIKIQKTPW-KVP-TFSKYNI 223

Query: 63  -DVACGWDYSVVIDEHGNVLACGAGLNGELGLGHVKCSGAWRRVTTCLNP--SRAV--YS 117
             +A G D+ + +DE G V A G G   +LG    K    +R  T    P   R V   +
Sbjct: 224 VQLAPGKDHILFLDEEGMVFAWGNGQQNQLGR---KVMERFRLKTLDPRPFGLRHVKYIA 280

Query: 118 SFQN--VVLRDGNKLYGWGPNRKGQ------------LKEPKNKGFDTPTLIYEGRDITQ 163
           S +N    L   NKL  WG N+ GQ            + +PK        +      I  
Sbjct: 281 SGENHCFALTKDNKLVSWGLNQFGQCGVSEDVEDGALVTKPKRLALPDNVV------IRS 334

Query: 164 VAMGKDFIAIVDA-GKLVISGTMXXXXXXXXXXXXXXXXXXXAAMWSSLHIWTKRDIFSY 222
           +A G+    I+   G L   G +                        +L  +T +D+   
Sbjct: 335 IAAGEHHSLILSQDGDLYSCGRLDMFEVGIPK--------------DNLPEYTYKDV--- 377

Query: 223 GNGNYGQMFVWERP------PNMTHFAAGSEHGVMSLADGRVFCWGWGEHGNCGPSAKGH 276
               +G+      P      P     AAGS H V    +G  + WG+GE    G      
Sbjct: 378 ----HGKARAVPLPTKLNNVPKFKSVAAGSHHSVAVAQNGIAYSWGFGETYAVG------ 427

Query: 277 DAASPFNDKSNIVSPLNCVLETNEKIIWIQGGC 309
               PF D + + + +      +  II +  GC
Sbjct: 428 --LGPFEDDTEVPTRIKNTATQDHNIILV--GC 456

>Kwal_34.15931
          Length = 1398

 Score = 36.2 bits (82), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 67/182 (36%), Gaps = 40/182 (21%)

Query: 9   CAKKPIKIACGGN-HSLMLMEDGQLWAAGDGRQGQFASKDTKCAFAWSELPGTFEDVACG 67
           C K   + A     HS+++   G ++ AG G +G+  + DT      S +  T  D+   
Sbjct: 200 CEKSRFRTAIMKRYHSVLVTTSGDVFTAGSGSRGRLGNGDTNA----SNVSHTKVDLGTN 255

Query: 68  W--------DYSVVIDEHGNVLACGAGLNGELGLGHVK--------------CSGAWRRV 105
                     +SVV+ E G++   G     +LG                   CS   +RV
Sbjct: 256 AVNLIDSSDHHSVVLTEAGDIYCWGWNRYSQLGFSTPANNTKKLDNSALENICSAKPKRV 315

Query: 106 TTCLNPSRAVY---------SSFQNVVLRDGNKLYGWGPNRKGQLKEPKNKGFDTPTLIY 156
               NP R            S     +L D N LY WG N  GQ+   KN G D   L Y
Sbjct: 316 VN--NPWRKTMDQGVSLVACSKVHTCLLDDNNNLYSWGLNL-GQMGSSKNHGEDFDAL-Y 371

Query: 157 EG 158
            G
Sbjct: 372 NG 373

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 37/84 (44%), Gaps = 13/84 (15%)

Query: 208 WSSLHIWTKRDIFSYGNGNYGQMFVWE-RPPNMTH------------FAAGSEHGVMSLA 254
           + S+ + T  D+F+ G+G+ G++   +    N++H              +   H V+   
Sbjct: 213 YHSVLVTTSGDVFTAGSGSRGRLGNGDTNASNVSHTKVDLGTNAVNLIDSSDHHSVVLTE 272

Query: 255 DGRVFCWGWGEHGNCGPSAKGHDA 278
            G ++CWGW  +   G S   ++ 
Sbjct: 273 AGDIYCWGWNRYSQLGFSTPANNT 296

>CAGL0M05137g 552160..556215 weakly similar to sp|P21827
           Saccharomyces cerevisiae YGL097w SRM1, hypothetical
           start
          Length = 1351

 Score = 33.5 bits (75), Expect = 0.28,   Method: Composition-based stats.
 Identities = 33/146 (22%), Positives = 60/146 (41%), Gaps = 18/146 (12%)

Query: 22  HSLMLMEDGQLWAAGDGRQGQFASKDTKCAFAWSELPGTFED----VACGWDYSVVIDEH 77
           H L++   G+++  G+  +G+  + +T    +      TFE     V+    +++++D +
Sbjct: 231 HCLVINSFGEVFTCGNSNRGRLGNGETNTTVSVFTKIATFETGVRHVSISNHHNLLVDGN 290

Query: 78  GNVLACGAGLNGELGLGHVKCSGAWRRVTTCLNPSRAVY-----------SSFQNVVLRD 126
           G + + G     +LG       G  +      +P R  Y           S   +  L  
Sbjct: 291 GYIYSWGWNQYYQLGYTSSNKQGDSKHTLCKSSPKRIPYFDNINIKYVACSKVHSCALSQ 350

Query: 127 GNKLYGWGPNRKGQL--KEPKNKGFD 150
            NKLY WG N  GQ+  K+P +   D
Sbjct: 351 DNKLYLWGLNL-GQMGNKKPLHVNLD 375

 Score = 28.5 bits (62), Expect = 8.5,   Method: Composition-based stats.
 Identities = 14/76 (18%), Positives = 32/76 (42%), Gaps = 13/76 (17%)

Query: 218 DIFSYGNGNYGQMFVWERPPNMT-------------HFAAGSEHGVMSLADGRVFCWGWG 264
           ++F+ GN N G++   E    ++             H +  + H ++   +G ++ WGW 
Sbjct: 240 EVFTCGNSNRGRLGNGETNTTVSVFTKIATFETGVRHVSISNHHNLLVDGNGYIYSWGWN 299

Query: 265 EHGNCGPSAKGHDAAS 280
           ++   G ++      S
Sbjct: 300 QYYQLGYTSSNKQGDS 315

>Scas_519.4
          Length = 603

 Score = 31.6 bits (70), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 62/186 (33%), Gaps = 38/186 (20%)

Query: 119 FQNVVLRDGNKLYGWGPNRKGQLKEPKNKGFDTPTLIYEGRDITQVAMGKDFIAIVDAGK 178
           F N+VL   N+ + +G NR GQL  P         + Y   +I+   +    I +V  G+
Sbjct: 384 FHNLVLDSNNECHSFGWNRFGQLGFP---------ITYMMEEISYPKL----IPMVSFGQ 430

Query: 179 LVISGTMXXXXXXXXXXXXXXXXXXXAAMWSSLHIWTKR--DIFSYGNGNYGQM------ 230
              S                          ++     KR  D FS GNG YG++      
Sbjct: 431 FYPSNENIELRIVDIDCNEETSFFTVEVSTANNRKDVKRSYDYFSMGNGIYGELGNGSVK 490

Query: 231 -FVWERPPNMTHFA--------------AGSEHGVMSLADGRVFCWGWGEHGNCGPSAKG 275
              WE  P M   A                S H +M   DG +  WG  ++G  G   + 
Sbjct: 491 NSQWE--PTMLKLARTDTNDNINEWICNGKSHHLLMKSNDGNILSWGLNDNGQLGNGKEK 548

Query: 276 HDAASP 281
                P
Sbjct: 549 IKGIKP 554

>Scas_696.5d
          Length = 1359

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 41/94 (43%), Gaps = 4/94 (4%)

Query: 58  PGTFEDVACGWDYSVVIDEHGNVLACGAGLNGELGLGHV-KCSGAWRRVTTCLN--PSRA 114
           P  F+D+     +S+++     V +CG G  G LG  +    S A       LN      
Sbjct: 210 PVRFKDILMTRYHSILVTTDNKVYSCGNGTRGRLGNHNTDNVSQANYAEIMDLNDIDINL 269

Query: 115 VYSSFQNVVLRDG-NKLYGWGPNRKGQLKEPKNK 147
           V +S  + +L DG + LY WG N   QL  P  +
Sbjct: 270 VRTSDHHTLLLDGESNLYSWGWNGYNQLGYPTKQ 303

>Kwal_14.1053
          Length = 592

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 50/128 (39%), Gaps = 43/128 (33%)

Query: 11  KKPIKIACGGNHSLMLMEDGQLWAAG---DGRQGQFASKDTKCAFAWSELPGTFE----- 62
           +K  K+ACG  HS++L   G +++ G    G+ GQ  S D +        P   E     
Sbjct: 352 RKIKKVACGNYHSVVLDSLGDVYSFGLNTYGQLGQAISYDMEIV----PFPKKVEKFNAH 407

Query: 63  ----------DVACGWDYSVVI-------------------DEHGNV--LACGAGLNGEL 91
                     D+ CG + S V                    DE  N+   + G GL+GEL
Sbjct: 408 FARDTYLKCIDIHCGGNTSFVSVLPQNIHKLLRNSGKTSFSDEAENICYFSFGCGLHGEL 467

Query: 92  GLGHVKCS 99
           G GH K S
Sbjct: 468 GNGHFKHS 475

>ABR238W [832] [Homologous to ScYLR077W - SH]
           complement(844738..846489) [1752 bp, 583 aa]
          Length = 583

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 60  TFEDVACGWDYSVVIDEHGNVLACGAGLNGELGL 93
           T   +ACG  +++ ID  G + A GA   G+LGL
Sbjct: 355 TITHIACGNYHTLAIDSKGELYAFGANTYGQLGL 388

>CAGL0M06567g complement(679126..680325) highly similar to sp|Q12099
           Saccharomyces cerevisiae YDR021w FAL1 involved in
           maturation of 18S rRNA, start by similarity
          Length = 399

 Score = 28.5 bits (62), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 137 RKGQLKEPKNKGFDTPTLIYEGRDITQVAMGKDFIAIVDAG 177
           ++G L+   + GF+ P+ I + R ITQ+  GKD IA   +G
Sbjct: 31  KEGLLRGIYSYGFEAPSAI-QSRAITQIISGKDVIAQAQSG 70

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.456 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,522,339
Number of extensions: 424566
Number of successful extensions: 814
Number of sequences better than 10.0: 27
Number of HSP's gapped: 749
Number of HSP's successfully gapped: 50
Length of query: 312
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 211
Effective length of database: 13,099,691
Effective search space: 2764034801
Effective search space used: 2764034801
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)