Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR172W61260029920.0
Sklu_2380.362262518670.0
Kwal_14.86362863418330.0
KLLA0E08085g65665716480.0
Scas_685.764543115120.0
CAGL0L09889g71744112251e-160
YKL025C (PAN3)67945611801e-154
ADR313W57848780.21
YDL025C620166780.22
KLLA0D16610g31033701.7
AGR044C30033692.2
Scas_649.2129422683.0
AFL127C152123684.0
YDR151C (CTH1)32522674.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR172W
         (600 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR172W [1219] [Homologous to ScYKL025C (PAN3) - SH] complement(...  1157   0.0  
Sklu_2380.3 YKL025C, Contig c2380 7858-9726 reverse complement        723   0.0  
Kwal_14.863                                                           710   0.0  
KLLA0E08085g 727056..729026 similar to sp|P36102 Saccharomyces c...   639   0.0  
Scas_685.7                                                            587   0.0  
CAGL0L09889g 1055765..1057918 similar to sp|P36102 Saccharomyces...   476   e-160
YKL025C (PAN3) [3230] chr11 complement(389883..391922) Component...   459   e-154
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    35   0.21 
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    35   0.22 
KLLA0D16610g complement(1410447..1411379) weakly similar to sp|P...    32   1.7  
AGR044C [4354] [Homologous to ScYDR151C (CTH1) - SH; ScYLR136C (...    31   2.2  
Scas_649.21                                                            31   3.0  
AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH] (193474..19...    31   4.0  
YDR151C (CTH1) [995] chr4 complement(764172..765149) Protein con...    30   4.0  

>ACR172W [1219] [Homologous to ScYKL025C (PAN3) - SH]
           complement(655564..657402) [1839 bp, 612 aa]
          Length = 612

 Score = 1157 bits (2992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/600 (93%), Positives = 559/600 (93%)

Query: 1   MMMNKSKTDWAKDTPCKNITIYGYCKYENDGCIFNHGKPLXXXXXXXXXXXXXXXXXXXX 60
           MMMNKSKTDWAKDTPCKNITIYGYCKYENDGCIFNHGKPL                    
Sbjct: 1   MMMNKSKTDWAKDTPCKNITIYGYCKYENDGCIFNHGKPLSTSSNTGGAAAGSAEDSAAS 60

Query: 61  XXVTVGNTGKSTFNAKTATSFTPSVAIPDFNNIPSFTPERIVSSPAGDGATAFTPSFNPY 120
             VTVGNTGKSTFNAKTATSFTPSVAIPDFNNIPSFTPERIVSSPAGDGATAFTPSFNPY
Sbjct: 61  GGVTVGNTGKSTFNAKTATSFTPSVAIPDFNNIPSFTPERIVSSPAGDGATAFTPSFNPY 120

Query: 121 GSDSFNPSANVSGPXXXXXXXXXXXXXXXXXXXPRSQSVHVGTGGYLPLAGTAFPTVYPP 180
           GSDSFNPSANVSGP                   PRSQSVHVGTGGYLPLAGTAFPTVYPP
Sbjct: 121 GSDSFNPSANVSGPGSAVFAAASGNAGASATAAPRSQSVHVGTGGYLPLAGTAFPTVYPP 180

Query: 181 SHSILQYHLYAPDPPPHLQVPLKANERTPETLFIPNNLREHLLKRNLSALQVFPSDGNLP 240
           SHSILQYHLYAPDPPPHLQVPLKANERTPETLFIPNNLREHLLKRNLSALQVFPSDGNLP
Sbjct: 181 SHSILQYHLYAPDPPPHLQVPLKANERTPETLFIPNNLREHLLKRNLSALQVFPSDGNLP 240

Query: 241 DIVGDYFGLVPLEFHNRQTGKGRYLGHQNSLYKVFSNFDGKVYIIRRIHDVKTTDVGQIS 300
           DIVGDYFGLVPLEFHNRQTGKGRYLGHQNSLYKVFSNFDGKVYIIRRIHDVKTTDVGQIS
Sbjct: 241 DIVGDYFGLVPLEFHNRQTGKGRYLGHQNSLYKVFSNFDGKVYIIRRIHDVKTTDVGQIS 300

Query: 301 LPFRKWQKVSCPNVVKVKDAFTTLAFGDSSLCVVHDYYPQSNSLYETHVANYTVVPVTQK 360
           LPFRKWQKVSCPNVVKVKDAFTTLAFGDSSLCVVHDYYPQSNSLYETHVANYTVVPVTQK
Sbjct: 301 LPFRKWQKVSCPNVVKVKDAFTTLAFGDSSLCVVHDYYPQSNSLYETHVANYTVVPVTQK 360

Query: 361 YLWSYLVQLSNALNEVHRHGLSMNNISLDKVIVTGDPGRIKVGDSAVHDILAFDEGRDIA 420
           YLWSYLVQLSNALNEVHRHGLSMNNISLDKVIVTGDPGRIKVGDSAVHDILAFDEGRDIA
Sbjct: 361 YLWSYLVQLSNALNEVHRHGLSMNNISLDKVIVTGDPGRIKVGDSAVHDILAFDEGRDIA 420

Query: 421 KEQQADYSAVGALLMDLAQRMLGTRDQPLDSMDIDPLFKRVLAYLLSDEKKTIAEFTALF 480
           KEQQADYSAVGALLMDLAQRMLGTRDQPLDSMDIDPLFKRVLAYLLSDEKKTIAEFTALF
Sbjct: 421 KEQQADYSAVGALLMDLAQRMLGTRDQPLDSMDIDPLFKRVLAYLLSDEKKTIAEFTALF 480

Query: 481 SHKMLDIISSSQTYSEYIEQHLSRELENGRLFRLMCKLNFIFGRMESSMDIHWSEAGDKF 540
           SHKMLDIISSSQTYSEYIEQHLSRELENGRLFRLMCKLNFIFGRMESSMDIHWSEAGDKF
Sbjct: 481 SHKMLDIISSSQTYSEYIEQHLSRELENGRLFRLMCKLNFIFGRMESSMDIHWSEAGDKF 540

Query: 541 PIILFYDYVFHQVDENGKSVMDLTHVLRCLNKLDTGVSEKIILVTPDEMNCIIISYKELK 600
           PIILFYDYVFHQVDENGKSVMDLTHVLRCLNKLDTGVSEKIILVTPDEMNCIIISYKELK
Sbjct: 541 PIILFYDYVFHQVDENGKSVMDLTHVLRCLNKLDTGVSEKIILVTPDEMNCIIISYKELK 600

>Sklu_2380.3 YKL025C, Contig c2380 7858-9726 reverse complement
          Length = 622

 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/625 (58%), Positives = 438/625 (70%), Gaps = 42/625 (6%)

Query: 3   MNKSKTDWAKDTPCKNITIYGYCKYENDGCIFNHGKPLXXXXXXXXXXXXXXXXXXXXXX 62
           M+K+ T+WAKD PCKNITI+G+CK+ENDGCIFNHG                         
Sbjct: 1   MDKANTEWAKDIPCKNITIHGFCKFENDGCIFNHGS--------------SGTKTGVNTP 46

Query: 63  VTVGNTGKSTFNAKTATSFTPS-VAIPDFNNIPSFTPER---IVSSPAGDGAT---AFTP 115
             + N+  S FNAKTA+SFTPS +   DFN +  FT ++   + ++P          F  
Sbjct: 47  TGIMNSA-SKFNAKTASSFTPSKITSSDFNGVSGFTSDKSATVTTAPVAASVVNSPTFAT 105

Query: 116 SFNPYGSDSFNPS--ANVSGPXXXXXXXXXXXXXXXXXXX----------------PRSQ 157
           +FNPY +DSF PS  A VS P                                   PRS 
Sbjct: 106 NFNPYVADSFTPSGSAGVSSPSFNPYSAPSGIGGASSTATHTQTAPVTGFTQRPPDPRSS 165

Query: 158 SVHVGTGGYLPLAGTA-FPTVYPPSHSILQYHLYAPDPPPHLQVPLKANERTPETLFIPN 216
               G      ++ T  FPT+YPP HSILQYHLYAPDPPPHL+VPLK NERTPETLFIPN
Sbjct: 166 LTSAGPIASSRVSATQNFPTIYPPPHSILQYHLYAPDPPPHLKVPLKPNERTPETLFIPN 225

Query: 217 NLREHLLKRNLSALQVFPSDGNLPDIVGDYFGLVPLEFHNRQTGKGRYLGHQNSLYKVFS 276
           +LRE L+K+N SALQVFPS G+LP+IVGDYFGLVPLEFH+R + K RY+GHQNSLYKVFS
Sbjct: 226 DLREELVKKNQSALQVFPSGGSLPEIVGDYFGLVPLEFHSRASYKQRYMGHQNSLYKVFS 285

Query: 277 NFDGKVYIIRRIHDVKTTDVGQISLPFRKWQKVSCPNVVKVKDAFTTLAFGDSSLCVVHD 336
           N DGK+YI+RRIHDV  T+  Q+S PF+ WQKVSC NVVK+KDAF T AF DSSLCVVH+
Sbjct: 286 NSDGKIYIMRRIHDVNITEATQVSRPFQMWQKVSCANVVKIKDAFITRAFNDSSLCVVHE 345

Query: 337 YYPQSNSLYETHVANYTVVPVTQKYLWSYLVQLSNALNEVHRHGLSMNNISLDKVIVTGD 396
           Y+PQS+SLYETH  N+T+ P+TQ YLW+YLVQL+NAL EVH   LS+N +  DKVIVTG+
Sbjct: 346 YFPQSSSLYETHFVNFTLTPITQDYLWAYLVQLTNALKEVHSQNLSINILGWDKVIVTGE 405

Query: 397 PGRIKVGDSAVHDILAFDEGRDIAKEQQADYSAVGALLMDLAQRMLGTRDQPLDSMDIDP 456
           PGRIKV D  V+DIL   E RDI +EQQ D+  +G LL  L  ++  ++D     + +D 
Sbjct: 406 PGRIKVSDCGVYDILHSLESRDIEEEQQKDFEELGKLLNGLVTKIASSKDTSTQDLKVDS 465

Query: 457 LFKRVLAY-LLSDEKKTIAEFTALFSHKMLDIISSSQTYSEYIEQHLSRELENGRLFRLM 515
            FK VL Y LL+D KK + E  +LF+ ++L ++SS QT+ E  E +LSRELENGRLFRLM
Sbjct: 466 DFKIVLDYLLLNDHKKNVRELASLFTDRILSVVSSLQTHVECTEAYLSRELENGRLFRLM 525

Query: 516 CKLNFIFGRMESSMDIHWSEAGDKFPIILFYDYVFHQVDENGKSVMDLTHVLRCLNKLDT 575
           CKLNFIFGR ES +DI+WSE+G+KFPIILFYDYVFHQVDE GKS+MDLTHVLRCLNKLD 
Sbjct: 526 CKLNFIFGRTESRVDINWSESGEKFPIILFYDYVFHQVDEAGKSIMDLTHVLRCLNKLDA 585

Query: 576 GVSEKIILVTPDEMNCIIISYKELK 600
           GV+EKI+LVTPDEMNCIIISYKELK
Sbjct: 586 GVTEKIMLVTPDEMNCIIISYKELK 610

>Kwal_14.863
          Length = 628

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/634 (56%), Positives = 435/634 (68%), Gaps = 68/634 (10%)

Query: 3   MNKSKTDWAKDTPCKNITIYGYCKYENDGCIFNHGKPLXXXXXXXXXXXXXXXXXXXXXX 62
           M+K+  +WAKD PCKNITIYG+CKYEN+GCIFNHG                         
Sbjct: 15  MDKANAEWAKDIPCKNITIYGFCKYENEGCIFNHGNANQNT------------------- 55

Query: 63  VTVGNTGKSTFNAKTATSFTPSVAIPDFNN-------------IPSFTPERIVSSPAGDG 109
               N+    FNAKTA+SFTPS A+   N+             + S   +   SSP    
Sbjct: 56  ----NSAGLKFNAKTASSFTPSKALSTKNSTSTAIKAEKVAKALASAAEQPSTSSPLAAK 111

Query: 110 ATAFTPSFNPYGSDSFNP--SANVSGPXXXXXXXXXXXXXXXXXXXPRSQSVHVGTGGYL 167
           +  F  S+NPY ++ F P  SA  S P                   P S    + T G  
Sbjct: 112 SAPFGSSYNPYAAN-FTPVGSAGTSTPPPAAASRTSFN--------PYSAPAGMTTPGEA 162

Query: 168 PLAG--------------------TAFPTVYPPSHSILQYHLYAPDPPPHLQVPLKANER 207
           PL                      T FP++YPPSHSILQYHLYAPDPP HL+VPLKANER
Sbjct: 163 PLQPGASFIPGSPAPYAQDAPGRYTNFPSIYPPSHSILQYHLYAPDPPLHLKVPLKANER 222

Query: 208 TPETLFIPNNLREHLLKRNLSALQVFPSDGNLPDIVGDYFGLVPLEFHNRQTGKGRYLGH 267
           TPETLFIPNN+RE LLK+N +ALQVFPS GNLP+IVGDYFGLVPLEFHNR + K RY GH
Sbjct: 223 TPETLFIPNNMREELLKKNHAALQVFPSGGNLPEIVGDYFGLVPLEFHNRVSNKDRYQGH 282

Query: 268 QNSLYKVFSNFDGKVYIIRRIHDVKTTDVGQISLPFRKWQKVSCPNVVKVKDAFTTLAFG 327
           QNSLYKVFSNFDGKVYI+RRIHDVK  +  Q+  PF+ W+KV   NVV+ KDAF T AF 
Sbjct: 283 QNSLYKVFSNFDGKVYIMRRIHDVKMKESVQLFKPFQDWKKVVNSNVVETKDAFITRAFN 342

Query: 328 DSSLCVVHDYYPQSNSLYETHVANYTVVPVTQKYLWSYLVQLSNALNEVHRHGLSMNNIS 387
           D+SLCVVH+Y+PQS+SLYETH  +++  P+TQ  LWSYLVQL +A+   H   L+ NNI 
Sbjct: 343 DASLCVVHEYFPQSSSLYETHFVSFSPTPITQDLLWSYLVQLCSAIQAAHTRNLAFNNIC 402

Query: 388 LDKVIVTGDPGRIKVGDSAVHDILAFDEGRDIAKEQQADYSAVGALLMDLAQRMLGTRDQ 447
           LDKVIVTG+PGR+K+GDS VHDIL F + RD+ KEQ+ D++ +G LL DLA +++G++D 
Sbjct: 403 LDKVIVTGNPGRVKIGDSCVHDILYFQDERDVLKEQKHDFADLGGLLKDLAAKLVGSQDN 462

Query: 448 PLDSMDIDPLFKRVLAYLLSDEK-KTIAEFTALFSHKMLDIISSSQTYSEYIEQHLSREL 506
            +DS+ +D  FK+VL YLL  +  KT+ E  ALFSHK+L IISS QT++EY E  L+REL
Sbjct: 463 TVDSLAVDDDFKQVLNYLLDPKSLKTLPELMALFSHKILPIISSLQTFTEYTESILAREL 522

Query: 507 ENGRLFRLMCKLNFIFGRMESSMDIHWSEAGDKFPIILFYDYVFHQVDENGKSVMDLTHV 566
           EN RLFRLMCK+NFIFGR+ES +DI+WSE+G+KFPIILFYDYVFHQ DE GK VMDLTHV
Sbjct: 523 ENARLFRLMCKMNFIFGRIESRIDINWSESGEKFPIILFYDYVFHQADETGKPVMDLTHV 582

Query: 567 LRCLNKLDTGVSEKIILVTPDEMNCIIISYKELK 600
           LRCLNKLD G+ EK++LVTPDEMNCIIISYKELK
Sbjct: 583 LRCLNKLDAGIGEKLMLVTPDEMNCIIISYKELK 616

>KLLA0E08085g 727056..729026 similar to sp|P36102 Saccharomyces
           cerevisiae YKL025c PAN3 component of the PAB1P-dependent
           poly(A) ribonuclease singleton, start by similarity
          Length = 656

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/657 (52%), Positives = 432/657 (65%), Gaps = 70/657 (10%)

Query: 1   MMMNKSKTDWA-----KDTPCKNITIYGYCKYENDGCIFNHGKPLXXXXXXXXXXXXXXX 55
           M+ + S T+W      K T C+NI I+GYCK+EN+GC FNHG                  
Sbjct: 1   MISSASGTNWNRPDSFKGTQCRNIIIHGYCKFENEGCQFNHGN-------SKETEGQTTD 53

Query: 56  XXXXXXXVTVGNTGKSTFNAKTATSFTP----SVAIPDFNNIPSFTPERIVS-------- 103
                  +T  N     FNAKT++SFTP    +V  PDF+++P+F P   V+        
Sbjct: 54  EVPTQRSMTPLNV---KFNAKTSSSFTPGKSPAVRSPDFSSLPAFQPGAPVNDQPMLADG 110

Query: 104 -------SPA--GDGATAFTPSFNPYGSDSFNPSANVSGPXXXXXXXXXXXXXXXXXXXP 154
                  SP+     ATAF PSFNPY S+SF PS +  G                    P
Sbjct: 111 PQISGTMSPSLMNSNATAFAPSFNPYASESFTPSVSAGGIPSSQELAGTLHGSNPSIPSP 170

Query: 155 RSQSVHVGTGGYLPLAG-------------------------TAFPTVYPPSHSILQYHL 189
              + +V + G LP  G                         T FPTVYPP+HS+LQYHL
Sbjct: 171 VPSNPYVNSAG-LPSGGMLGVGHPMQGLPPPPPPGALPVNPITQFPTVYPPTHSVLQYHL 229

Query: 190 YAPDPPPHLQVPLKANERTPETLFIPNNLREHLLKRNLSALQVFPSDGNLPDIVGDYFGL 249
           YAPDPPPHL++PLK NERTPETLFI N+LR+ L+K N +ALQVFP  G+LPDIVGDYFGL
Sbjct: 230 YAPDPPPHLKIPLKPNERTPETLFINNHLRDRLVKNNQTALQVFPR-GSLPDIVGDYFGL 288

Query: 250 VPLEFHNRQTGKGRYLGHQNSLYKVFSNFDGKVYIIRRIHDVKTTDVGQISLPFRKWQKV 309
           VP++FHNR + K RY GH+NSLYKVFSN DGK+Y +RRIHDVK TD  Q+S PF+ W  +
Sbjct: 289 VPMDFHNRTSDKKRYNGHKNSLYKVFSNLDGKIYFMRRIHDVKITDSAQVSKPFQTWSHL 348

Query: 310 SCPNVVKVKDAFTTLAFGDSSLCVVHDYYPQSNSLYETHVANYTVVPVTQKYLWSYLVQL 369
              N+  +KD+F T AF DSSLC+V DYYPQS SLYET+    +V  + Q+YLW++LVQL
Sbjct: 349 RSANITVLKDSFVTSAFNDSSLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQL 408

Query: 370 SNALNEVHRHGLSMNNISLDKVIVTGDPGRIKVGDSAVHDILAF-DEGRDIAKEQQADYS 428
           + AL EVH +GL++N++   KVIVTG+PGRIKV D  V+D L +  EGR +  EQQ +Y 
Sbjct: 409 TIALQEVHSNGLALNDLDWKKVIVTGEPGRIKVTDIGVYDTLNYHQEGRMLHTEQQQNYL 468

Query: 429 AVGALLMDLAQRMLGTRDQPLD---SMDIDPLFKRVLAYL--LSDEKKTIAEFTALFSHK 483
           ++  LL++L QR+ G    PLD   S  IDPLFK+ + YL   S+  K I +FT LFSHK
Sbjct: 469 SLAELLLNLVQRLCGASG-PLDDVKSYHIDPLFKKCIQYLQDTSNNNKNIEDFTKLFSHK 527

Query: 484 MLDIISSSQTYSEYIEQHLSRELENGRLFRLMCKLNFIFGRMESSMDIHWSEAGDKFPII 543
           +L +++S Q  SEY+EQ LSRELEN RLFRLMCKLN I+GR+ES +DI+W+E+G+KFPII
Sbjct: 528 VLSVVNSLQYNSEYLEQQLSRELENARLFRLMCKLNAIYGRLESRIDINWAESGEKFPII 587

Query: 544 LFYDYVFHQVDENGKSVMDLTHVLRCLNKLDTGVSEKIILVTPDEMNCIIISYKELK 600
           LF+DYVFHQ D+ GK+VMDLTHVLRCLNKLD GVSE+++LVTPDEMNCIIISYKELK
Sbjct: 588 LFFDYVFHQKDDTGKNVMDLTHVLRCLNKLDAGVSERLMLVTPDEMNCIIISYKELK 644

>Scas_685.7
          Length = 645

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/431 (63%), Positives = 338/431 (78%), Gaps = 2/431 (0%)

Query: 172 TAFPTVYPPSHSILQYHLYAPDPPPHLQVPLKANERTPETLFIPNNLREHLLKRNLSALQ 231
           + +P++YPP HSILQYHLYAPDPPP L++PLK NERTPETLFIPN+LRE L+K+NL++LQ
Sbjct: 203 SRYPSIYPPPHSILQYHLYAPDPPPQLRLPLKPNERTPETLFIPNDLREQLVKKNLASLQ 262

Query: 232 VFPSDGNLPDIVGDYFGLVPLEFHNRQTGKGRYLGHQNSLYKVFSNFDGKVYIIRRIHDV 291
           +FPS G +PDIV DYFGLVPL+FH ++  K RY GH+NSLYKVFSN DGKVYI+RRIHDV
Sbjct: 263 IFPSGGAIPDIVQDYFGLVPLDFHQKEVTKDRYQGHKNSLYKVFSNLDGKVYILRRIHDV 322

Query: 292 KTTDVGQISLPFRKWQKVSCPNVVKVKDAFTTLAFGDSSLCVVHDYYPQSNSLYETHVAN 351
           +  D  QI+ PF+KW  + C  +VK++D F T  FGDSSLC+V+D+YPQ+NSLYE H  N
Sbjct: 323 QIMDPQQIAKPFQKWNNLECNQIVKLRDLFLTTKFGDSSLCLVYDFYPQANSLYEHHFTN 382

Query: 352 YTVVPVTQKYLWSYLVQLSNALNEVHRHGLSMNNISLDKVIVTGDPGRIKVGDSAVHDIL 411
           + +VP+TQ YLW+YLVQL+NA+N VH  G  +  I  DK+IVTGDPGRIK+      D+L
Sbjct: 383 FPLVPITQDYLWTYLVQLTNAINVVHSKGFYIGLIDWDKIIVTGDPGRIKLSGCGAIDVL 442

Query: 412 AFDEGRDIAKEQQADYSAVGALLMDLAQRMLGTRDQPLDSMDIDPLFKRVLAYLLSD--E 469
             +E  D+  +QQ D+  +G LL  LA ++    +  +D + +D  FK VL YLL+D  +
Sbjct: 443 GANEELDLHSKQQMDFENLGQLLFKLASKIGNNANAKIDELSVDDQFKTVLQYLLNDTND 502

Query: 470 KKTIAEFTALFSHKMLDIISSSQTYSEYIEQHLSRELENGRLFRLMCKLNFIFGRMESSM 529
           +KTI E + LF  K+L  + SSQ Y+EY E  LSRELENGRLFRL+CKLNFIFG++ES +
Sbjct: 503 RKTINELSQLFIDKILSNVESSQGYAEYTEGILSRELENGRLFRLICKLNFIFGKIESRV 562

Query: 530 DIHWSEAGDKFPIILFYDYVFHQVDENGKSVMDLTHVLRCLNKLDTGVSEKIILVTPDEM 589
           DI+WSE+G+KFPIILFYD+VFHQVDE GKSVMDLTHVLRCLNKLD G  EK+IL TPDEM
Sbjct: 563 DINWSESGEKFPIILFYDFVFHQVDETGKSVMDLTHVLRCLNKLDAGAPEKLILATPDEM 622

Query: 590 NCIIISYKELK 600
           NCIIISYKELK
Sbjct: 623 NCIIISYKELK 633

>CAGL0L09889g 1055765..1057918 similar to sp|P36102 Saccharomyces
           cerevisiae YKL025c PAN3 component of the PAB1P-dependent
           poly(A) ribonuclease, start by similarity
          Length = 717

 Score =  476 bits (1225), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 236/441 (53%), Positives = 311/441 (70%), Gaps = 15/441 (3%)

Query: 174 FPTVYPPSHSILQYHLYAPDPPPHLQVPLKANERTPETLFIPNNLREHLLKRNLSALQVF 233
           +PT+YPP+HSILQYHLYAPDPPP L++ LK NERTP  LFIPN+LRE L+KRNL++LQ+F
Sbjct: 266 YPTIYPPTHSILQYHLYAPDPPPQLEIALKENERTPRMLFIPNDLREELVKRNLASLQLF 325

Query: 234 PSDGNLPDIVGDYFGLVPLEFHNRQTGKGRYLGHQNSLYKVFSNFDGKVYIIRRIHDVKT 293
           PS GNLP IV DYFGLVPL+FH R + K RY  H+NSLYKVFSN DG++Y++RRIHDV  
Sbjct: 326 PSGGNLPHIVKDYFGLVPLDFHQRSSVKDRYKKHKNSLYKVFSNVDGRIYLLRRIHDVNI 385

Query: 294 TDVGQISLPFRKWQKVSCPNVVKVKDAFTTLAFGDSSLCVVHDYYPQSNSLYETHVANYT 353
           +D   IS  F+KW K+   NVV +KD F T AFGDSSL +V+DYYP + SLYE H  NY 
Sbjct: 386 SDPTIISKTFQKWSKIDSSNVVALKDLFLTTAFGDSSLGIVYDYYPNATSLYEAHFVNYP 445

Query: 354 VVPVTQKYLWSYLVQLSNALNEVHR-HGLSMNNISLDKVIVTGDPGRIKVGDSAVHDILA 412
            V VT+  LWSY VQ+ N L E+H  +G+++ ++  DK+I+TG  GRIK+   A +DI+ 
Sbjct: 446 TVEVTEDLLWSYAVQILNGLREIHNTNGVNIGDLDCDKIILTGK-GRIKISAGAEYDIMN 504

Query: 413 F------DEGRDIAKEQQADYSAVGALLMDLAQRMLGTRDQPLDSM-DIDPLFKRVLAYL 465
                  ++  +  K ++ ++  +G +L  LA +M     + + ++  +    K ++  L
Sbjct: 505 MCCPEDNEDDDNEEKLRKRNFVDLGEILFKLASKMCNCHGKDVANLAQVSEKLKNLIKSL 564

Query: 466 LSDEKKTIAEFTALFSHKM-LDII----SSSQTYSEYIEQHLSRELENGRLFRLMCKLNF 520
             ++         +    + LD++     + QTYSEY E  LSRELENGRLFRL+CKLNF
Sbjct: 565 AFEQLHDYVNVATIIEKYIGLDVVFKVMEAQQTYSEYAENVLSRELENGRLFRLICKLNF 624

Query: 521 IFGRMESSMDIHWSEAGDKFPIILFYDYVFHQVDEN-GKSVMDLTHVLRCLNKLDTGVSE 579
           IFGR+E+ +DI+WSE GDKF I+LFYDYVFHQ+D N GK V DLTHVLRCLNKLD GV E
Sbjct: 625 IFGRVENRLDINWSEPGDKFVIVLFYDYVFHQIDPNTGKPVTDLTHVLRCLNKLDAGVEE 684

Query: 580 KIILVTPDEMNCIIISYKELK 600
            I+LVTPDE+N  ++SYK++K
Sbjct: 685 NILLVTPDELNTAVVSYKKVK 705

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 82/217 (37%), Gaps = 42/217 (19%)

Query: 3   MNKSKTDWAKDTPCKNITIYGYCKYENDGCIFNHGKPLXXXXXXXXXXXXXXXXXXXXXX 62
           M+K   DWA+D PC+N+ IYG+CK + +GC F H                          
Sbjct: 1   MDKINPDWARDVPCRNVIIYGFCKKKTEGCPFKHDD---------------DDIATPTST 45

Query: 63  VTVGNTGKSTFNAKTATSFTPSVAIPDFNNIPSFT-PERIVSSPAGDGATAFTPSFNPYG 121
             V +T  +        S     ++P  N+ PS T P    ++ A  G+ +  P FN   
Sbjct: 46  PKVADTVPAPSGVIQQPSKISVSSLPSLNSQPSSTAPTSAPNATAHTGSKSQVPKFNAKA 105

Query: 122 SDSFNPSANVSGPXXXXXXXXXXXXXXXXXXXPRSQSVHVGTGGYLPLAGTAFPTVYPPS 181
           S SF P +  +                     P  +S   G+ G +  AGT         
Sbjct: 106 SASFTPMSKAAD-------------GTQETQAPYLESPVAGSPGPILKAGTPV------- 145

Query: 182 HSILQYHLYAPDPPPHLQVPLKANERTPETLFIPNNL 218
            S +Q ++Y+  P     VP  A+   P  +  PN++
Sbjct: 146 -SFMQPNIYSTTP-----VPSPASMAMPNVVMPPNDM 176

>YKL025C (PAN3) [3230] chr11 complement(389883..391922) Component of
           Pab1p-stimulated poly(A) ribonuclease [2040 bp, 679 aa]
          Length = 679

 Score =  459 bits (1180), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 237/456 (51%), Positives = 308/456 (67%), Gaps = 35/456 (7%)

Query: 174 FPTVYPPSHSILQYHLYAPDPPPHLQVPLKANERTPETLFIPNNLREHLLKRNLSALQVF 233
           +P +YPP HS+LQYHLYAP+ P  L+  LK NER+ + LFIPNN+RE L K+NLS LQVF
Sbjct: 218 YPRIYPPPHSLLQYHLYAPEQPSSLKSLLKPNERSADQLFIPNNIREDLTKKNLSILQVF 277

Query: 234 PSDGN-LPDIVGDYFGLVPLEFHNRQTGKGRYLGHQNSLYKVFSNFDGKVYIIRRIHDV- 291
           PS G  +P IV DYF LVP               ++ +L+KVFSN+DGK Y+++R+ ++ 
Sbjct: 278 PSSGKVIPSIVQDYFNLVP------LNFNNNDFLNKTTLFKVFSNYDGKAYVLKRLPNID 331

Query: 292 KTTDVGQISLPFRKWQKVSCPNVVKVKDAFTTLAFGDSSLCVVHDYYPQSNSLYETHVAN 351
           K+ +  +IS  ++ W K++C N++K +D F T  FGD S+C+V DYYP S SLY+ H  N
Sbjct: 332 KSMNPNKISKIYQIWSKINCTNLIKFRDIFQTTKFGDLSICLVFDYYPNSLSLYDYHFVN 391

Query: 352 YTVVPVTQKYLWSYLVQLSNALNEVHRHGLSM-NNISLDKVIVTGDPGRIKVGDSAVHDI 410
           +   P+T  YLW YLVQL+N +N +H   LS+ N ++  KV++TGDPGRIK+      D+
Sbjct: 392 FPKFPITNNYLWIYLVQLTNVINSIHSQNLSIGNTLNWRKVLITGDPGRIKLSHCNFMDL 451

Query: 411 LAFDE--------GRDIAKEQQADYSAVGALLMDLAQ--------------RMLGTRDQP 448
           L  D+        G  I  +QQ DY  +G LL +L+               R+     Q 
Sbjct: 452 LFNDDTDTVVSSGGSTIEGQQQLDYKYLGELLFNLSINIENSNNNTAPKEYRLEEITPQS 511

Query: 449 LDSM-DIDPLFKRVLAYLLSD---EKKTIAEFTALFSHKMLDIISSSQTYSEYIEQHLSR 504
           +D M  ID  FK VL YL+SD    KK+I + T+ F  KM  ++ SSQTY+EY+E  LSR
Sbjct: 512 IDDMRQIDDKFKDVLKYLISDNGDSKKSIHDLTSHFYDKMFMVLESSQTYTEYMESVLSR 571

Query: 505 ELENGRLFRLMCKLNFIFGRMESSMDIHWSEAGDKFPIILFYDYVFHQVDENGKSVMDLT 564
           ELENGRLFRL+ KLN IFGR+ES +DI+WSE+G KFPIILFYDYVFHQVD NGK +MDLT
Sbjct: 572 ELENGRLFRLVNKLNCIFGRIESRIDINWSESGTKFPIILFYDYVFHQVDSNGKPIMDLT 631

Query: 565 HVLRCLNKLDTGVSEKIILVTPDEMNCIIISYKELK 600
           HVLRCLNKLD G+ EK++LVTPDE+NCIIISYKELK
Sbjct: 632 HVLRCLNKLDAGIQEKLMLVTPDELNCIIISYKELK 667

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 37/81 (45%), Gaps = 5/81 (6%)

Query: 3  MNKSKTDWAKDTPCKNITIYGYCKYENDGCIFNHGKPLXXXXXXXXXXXXXXXXXXXXXX 62
          M+K   DWAKD PC+NITIYGYCK E +GC F H                          
Sbjct: 1  MDKINPDWAKDIPCRNITIYGYCKKEKEGCPFKHSD-----NTTATTINDVPPPIDVGEA 55

Query: 63 VTVGNTGKSTFNAKTATSFTP 83
           T   T    FNAK + SFTP
Sbjct: 56 TTPTMTSVPKFNAKVSASFTP 76

>ADR313W [2054] [Homologous to ScYDL025C - SH]
           complement(1255932..1257668) [1737 bp, 578 aa]
          Length = 578

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 357 VTQKYLWSYLVQLSNALNEVHRHGLSMNNISLDKVIVTGDPGRIKVGD 404
           +T+  +W Y  Q+   ++ +H  GL+  ++ LD  +VT D G +K+ D
Sbjct: 358 MTKHEVWCYFKQICRGVDYLHSQGLAHRDLKLDNCVVTAD-GILKLID 404

>YDL025C (YDL025C) [836] chr4 complement(405341..407203)
           Serine/threonine protein kinase with similarity to
           members of the NPR1 subfamily [1863 bp, 620 aa]
          Length = 620

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 76/166 (45%), Gaps = 23/166 (13%)

Query: 251 PLEFHNRQTGKGRYLGHQNS-LYKVFSNFDGKVY---IIRRIH-DVKTTDVGQISLPFRK 305
           P+E   +    GR LG   S    V    DGK++   + R+ H + + T+  Q++   +K
Sbjct: 294 PVELLEKYGIPGRKLGEGASGSVSVVERTDGKLFACKMFRKPHLNNEGTNQSQLANYSKK 353

Query: 306 WQKVSC-------PNVVKVKDAFTTLAFGDSSLCVVHDYYPQSNSLYETHVANYTVVPVT 358
                C        N+V+  D  T    GD+ L V+ +Y P     +   ++N     +T
Sbjct: 354 VTTEFCIGSTLHHENIVETLDMLTE---GDTYLLVM-EYAPYD--FFNLVMSNL----MT 403

Query: 359 QKYLWSYLVQLSNALNEVHRHGLSMNNISLDKVIVTGDPGRIKVGD 404
           Q  +  Y  QL + +N +H  GL+  ++ LD  +VT D G +K+ D
Sbjct: 404 QDEVNCYFKQLCHGVNYLHSMGLAHRDLKLDNCVVTKD-GILKLID 448

>KLLA0D16610g complement(1410447..1411379) weakly similar to
           sp|P47976 Saccharomyces cerevisiae YDR151c CTH1, start
           by similarity
          Length = 310

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 5   KSKTDWAKDTPCKNITIYGYCKYENDGCIFNHG 37
           K +++  +  PC N   YGYC+Y    C F HG
Sbjct: 241 KERSNNFRTKPCVNWQKYGYCRY-GKRCCFKHG 272

>AGR044C [4354] [Homologous to ScYDR151C (CTH1) - SH; ScYLR136C
           (TIS11) - SH] (798425..799327) [903 bp, 300 aa]
          Length = 300

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 5   KSKTDWAKDTPCKNITIYGYCKYENDGCIFNHG 37
           K ++D  +  PC N +  GYC+Y    C F HG
Sbjct: 218 KERSDKFRTKPCINWSKTGYCRY-GKRCCFKHG 249

>Scas_649.21
          Length = 294

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 15/22 (68%), Gaps = 1/22 (4%)

Query: 16  CKNITIYGYCKYENDGCIFNHG 37
           C+  T+ GYCKYE+  C F HG
Sbjct: 187 CETFTVKGYCKYES-KCQFAHG 207

>AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH]
           (193474..198039) [4566 bp, 1521 aa]
          Length = 1521

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 15/23 (65%)

Query: 442 LGTRDQPLDSMDIDPLFKRVLAY 464
           LG RD P D +D+DP FK+   Y
Sbjct: 624 LGKRDHPTDELDVDPEFKKSEFY 646

>YDR151C (CTH1) [995] chr4 complement(764172..765149) Protein
           containing two CCCH-type zinc finger domains, which bind
           DNA or RNA, has a region of high similarity to a region
           of mouse Zfp36l2, which is an apoptosis activator that
           may destabilize transcripts containing an AU-rich
           elements [978 bp, 325 aa]
          Length = 325

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%)

Query: 16  CKNITIYGYCKYENDGCIFNHG 37
           C++ TI GYCKY N  C F HG
Sbjct: 210 CESFTIKGYCKYGN-KCQFAHG 230

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,053,917
Number of extensions: 879779
Number of successful extensions: 2435
Number of sequences better than 10.0: 21
Number of HSP's gapped: 2453
Number of HSP's successfully gapped: 28
Length of query: 600
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 493
Effective length of database: 12,891,983
Effective search space: 6355747619
Effective search space used: 6355747619
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)