Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR171C25124711361e-159
YIR035C2542506432e-84
Scas_628.62522486363e-83
Scas_685.82522486077e-79
CAGL0F06897g2582475939e-77
CAGL0F06919g2502465911e-76
YIR036C2632595452e-69
ABR249W2502464642e-57
ABR247W2502504503e-55
ABR248W2612524452e-54
Sklu_2380.41601453772e-45
KLLA0E08063g1861443775e-45
ABR246W2502493739e-44
KLLA0E08052g1171032628e-29
KLLA0E13860g8891631124e-06
KLLA0E09834g2681621042e-05
AER373C3001661033e-05
Sklu_1570.17561321043e-05
Kwal_26.79508971241001e-04
KLLA0D15521g256129981e-04
AGL060W891163973e-04
Kwal_14.2444288165944e-04
Kwal_47.17102285153945e-04
CAGL0L02167g901134948e-04
Scas_666.17*283160900.001
Sklu_1578.3268170860.005
YMR226C267169860.005
KLLA0F04455g305164840.009
AFR561W267165830.011
CAGL0G08690g294168820.016
Kwal_26.9160267169810.018
YIL124W (AYR1)297164800.025
YKL071W256168790.034
Scas_594.12267169780.055
Sklu_268.124487760.073
Scas_662.4307171750.11
Kwal_34.16024292166750.13
Sklu_2348.5289165730.19
Scas_652.19d1344117730.22
AEL164C30738730.23
KLLA0B09812g346125720.27
CAGL0J04774g338165720.27
Kwal_14.151127794710.32
Scas_721.4734466710.45
Kwal_27.1215528061690.59
KLLA0E24046g28089690.75
Kwal_27.1191018461670.86
YBR159W34789680.90
YLR426W326121681.0
Scas_478.292093671.4
Scas_613.18286160642.6
CAGL0M11242g268103634.1
Kwal_55.19569288119634.3
Kwal_26.828229817616.6
Sklu_2404.1330126607.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR171C
         (247 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH] (6...   442   e-159
YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member ...   252   2e-84
Scas_628.6                                                            249   3e-83
Scas_685.8                                                            238   7e-79
CAGL0F06897g complement(675416..676192) highly similar to sp|P40...   233   9e-77
CAGL0F06919g complement(677473..678225) similar to sp|P40579 Sac...   232   1e-76
YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reducta...   214   2e-69
ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   183   2e-57
ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   177   3e-55
ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   176   2e-54
Sklu_2380.4 YIR035C, Contig c2380 9858-10340                          149   2e-45
KLLA0E08063g complement(726232..726792) some similarities with s...   149   5e-45
ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   148   9e-44
KLLA0E08052g complement(725895..726248) similar to sp|P40580 Sac...   105   8e-29
KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces...    48   4e-06
KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7 Ent...    45   2e-05
AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH] (1327314..1...    44   3e-05
Sklu_1570.1 YKR009C, Contig c1570 100-2370                             45   3e-05
Kwal_26.7950                                                           43   1e-04
KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcin...    42   1e-04
AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH] complement(...    42   3e-04
Kwal_14.2444                                                           41   4e-04
Kwal_47.17102                                                          41   5e-04
CAGL0L02167g 253055..255760 highly similar to sp|Q02207 Saccharo...    41   8e-04
Scas_666.17*                                                           39   0.001
Sklu_1578.3 YMR226C, Contig c1578 1774-2580                            38   0.005
YMR226C (YMR226C) [4182] chr13 complement(721592..722395) NADP+-...    38   0.005
KLLA0F04455g complement(428010..428927) similar to sp|P40471 Sac...    37   0.009
AFR561W [3753] [Homologous to ScYMR226C - SH] complement(1438981...    37   0.011
CAGL0G08690g complement(822798..823682) similar to sp|P40471 Sac...    36   0.016
Kwal_26.9160                                                           36   0.018
YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacet...    35   0.025
YKL071W (YKL071W) [3189] chr11 (304759..305529) Protein with sim...    35   0.034
Scas_594.12                                                            35   0.055
Sklu_268.1 , Contig c268 57-791 reverse complement                     34   0.073
Scas_662.4                                                             33   0.11 
Kwal_34.16024                                                          33   0.13 
Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement       33   0.19 
Scas_652.19d1                                                          33   0.22 
AEL164C [2342] [Homologous to ScYBR265W (TSC10) - SH] (326834..3...    33   0.23 
KLLA0B09812g complement(856799..857839) similar to sp|P38286 Sac...    32   0.27 
CAGL0J04774g join(452094..452179,452259..453189) similar to tr|Q...    32   0.27 
Kwal_14.1511                                                           32   0.32 
Scas_721.47                                                            32   0.45 
Kwal_27.12155                                                          31   0.59 
KLLA0E24046g complement(2136583..2137425) similar to ca|CA3771|C...    31   0.75 
Kwal_27.11910                                                          30   0.86 
YBR159W (YBR159W) [344] chr2 (558641..559684) Major 3-ketoreduct...    31   0.90 
YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109) M...    31   1.0  
Scas_478.2                                                             30   1.4  
Scas_613.18                                                            29   2.6  
CAGL0M11242g complement(1105723..1106529) highly similar to sp|Q...    29   4.1  
Kwal_55.19569                                                          29   4.3  
Kwal_26.8282                                                           28   6.6  
Sklu_2404.13 YKL055C, Contig c2404 24100-25005                         28   7.9  

>ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH]
           (654580..654909,654959..655384) [756 bp, 251 aa]
          Length = 251

 Score =  442 bits (1136), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 220/247 (89%), Positives = 220/247 (89%)

Query: 1   MPRLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQFEYVVGDVAS 60
           MPRLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQFEYVVGDVAS
Sbjct: 1   MPRLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQFEYVVGDVAS 60

Query: 61  EDAQDALVARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGRAL 120
           EDAQDALVARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGRAL
Sbjct: 61  EDAQDALVARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGRAL 120

Query: 121 PLLKKAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTLXXXXXXXXXXXXXXXXXD 180
           PLLKKA          ASTKAYSAWGAYGSSKAALNHFAMTL                 D
Sbjct: 121 PLLKKAGGSVVFVSSGASTKAYSAWGAYGSSKAALNHFAMTLAAEEPAVRAVAVAPGVVD 180

Query: 181 TQMQNDIRDKFGHRMAPEALRRFTELKKNSELLDPQIPATIFANLALRGIPDCANGKYLR 240
           TQMQNDIRDKFGHRMAPEALRRFTELKKNSELLDPQIPATIFANLALRGIPDCANGKYLR
Sbjct: 181 TQMQNDIRDKFGHRMAPEALRRFTELKKNSELLDPQIPATIFANLALRGIPDCANGKYLR 240

Query: 241 YNDDILA 247
           YNDDILA
Sbjct: 241 YNDDILA 247

>YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member of
           the short-chain alcohol dehydrogenase family [765 bp,
           254 aa]
          Length = 254

 Score =  252 bits (643), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 131/250 (52%), Positives = 168/250 (67%), Gaps = 3/250 (1%)

Query: 1   MPRLIIVTGVSRGIGRSVVEKVCR-QPDTVVLGVARSEAALQELRATYGEQFEYVVGDVA 59
           M ++I+VTGVSRGIG+S+V+ +     DTVV GVARSEA L++L+  YG++F YVVGD+ 
Sbjct: 1   MGKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDIT 60

Query: 60  SEDAQDALV-ARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGR 118
            +     LV A    +G+ID++VANAGVLEPVQ+VN IDV AW++LY++NFFS+V LVG 
Sbjct: 61  EDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGI 120

Query: 119 ALPLLKKAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTLXXXXXXXXXXXXXXXX 178
           ALP LKK           A    +S+WGAYGSSKAALNHFAMTL                
Sbjct: 121 ALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGI 180

Query: 179 XDTQMQNDIRDKFG-HRMAPEALRRFTELKKNSELLDPQIPATIFANLALRGIPDCANGK 237
            DT MQ +IR+  G   M+ E L+ F  LK+N++LLD  +PAT++A LAL GIPD  NG+
Sbjct: 181 VDTDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAKLALHGIPDGVNGQ 240

Query: 238 YLRYNDDILA 247
           YL YND  LA
Sbjct: 241 YLSYNDPALA 250

>Scas_628.6
          Length = 252

 Score =  249 bits (636), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 121/248 (48%), Positives = 164/248 (66%), Gaps = 2/248 (0%)

Query: 2   PRLIIVTGVSRGIGRSVVEKVC-RQPDTVVLGVARSEAALQELRATYGEQFEYVVGDVAS 60
           P++IIVTGVSRGIGR++V K+     + VV G+AR+ A L+EL++ +GE+F Y+VGDV +
Sbjct: 3   PKVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTN 62

Query: 61  E-DAQDALVARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGRA 119
           + D +  + A    +GR+D+VVANAGVLEPV +V  +D  AW+RL+++NFFS+V LV   
Sbjct: 63  KSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQST 122

Query: 120 LPLLKKAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTLXXXXXXXXXXXXXXXXX 179
           LP ++            AS KAY  W AY +SKAALN FAM++                 
Sbjct: 123 LPFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPKVKTISVAPGVV 182

Query: 180 DTQMQNDIRDKFGHRMAPEALRRFTELKKNSELLDPQIPATIFANLALRGIPDCANGKYL 239
           DTQMQ DIR+K+G+ M  E+L+RF +L KN ELLD  +P  ++A LA+ GIPD  NGKY 
Sbjct: 183 DTQMQVDIREKYGNEMTTESLKRFIDLHKNGELLDSDVPGEVYAKLAVNGIPDELNGKYS 242

Query: 240 RYNDDILA 247
           RYNDD LA
Sbjct: 243 RYNDDRLA 250

>Scas_685.8
          Length = 252

 Score =  238 bits (607), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 121/248 (48%), Positives = 161/248 (64%), Gaps = 2/248 (0%)

Query: 1   MPRLIIVTGVSRGIGRSVVEKVCR-QPDTVVLGVARSEAALQELRATYGEQFEYVVGDVA 59
           M ++IIVTGVSRGIG+S+VE++ +   D +V G+ARSEA L+ L+ TYG++F YV GD+ 
Sbjct: 1   MGKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDIT 60

Query: 60  SEDAQDALV-ARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGR 118
            + A   LV   A   G+ID+VVANAGVLEPVQDVNHID+ AW++L+++NFFSVV L   
Sbjct: 61  DQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSI 120

Query: 119 ALPLLKKAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTLXXXXXXXXXXXXXXXX 178
            LP LKK           AS   +S+WGAY +SKA LN FAMT+                
Sbjct: 121 TLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGI 180

Query: 179 XDTQMQNDIRDKFGHRMAPEALRRFTELKKNSELLDPQIPATIFANLALRGIPDCANGKY 238
            DT MQ +IR+  G  M  E    F +LK++++LLD  +PAT+++ LAL GIP   NGKY
Sbjct: 181 VDTSMQVNIRENVGKDMTSEDHAMFKDLKESNKLLDSNVPATVYSKLALNGIPVDVNGKY 240

Query: 239 LRYNDDIL 246
           L ++D IL
Sbjct: 241 LSFDDPIL 248

>CAGL0F06897g complement(675416..676192) highly similar to sp|P40579
           Saccharomyces cerevisiae YIR035c, hypothetical start
          Length = 258

 Score =  233 bits (593), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 166/247 (67%), Gaps = 3/247 (1%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCR-QPDTVVLGVARSEAALQELRATYGEQFEYVVGDVASE 61
           ++I+VTGVSRGIG+S+V+ +     + +V G+ARSEA L+ L+ TYG++F Y VGD+ ++
Sbjct: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITND 66

Query: 62  DAQDALVARAT-AYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGRAL 120
           D     V  A   +G+I++++ANAGVLEPVQ++N+IDV AW++LY +NFFS+V LV  AL
Sbjct: 67  DTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIAL 126

Query: 121 PLLKKAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTLXXXXXXXXXXXXXXXXXD 180
           P LKK           AS   +S+WGAYGSSKAALNHFAMTL                 D
Sbjct: 127 PHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIVD 186

Query: 181 TQMQNDIRDKFGHR-MAPEALRRFTELKKNSELLDPQIPATIFANLALRGIPDCANGKYL 239
           T MQ +IR+  G + M+ E L  F +LKK+++LL   IPAT+++ LAL GIP+  NG+YL
Sbjct: 187 TDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLALNGIPEEINGQYL 246

Query: 240 RYNDDIL 246
            ++ ++L
Sbjct: 247 SFDAEVL 253

>CAGL0F06919g complement(677473..678225) similar to sp|P40579
           Saccharomyces cerevisiae YIR035c or sp|P40580
           Saccharomyces cerevisiae YIR036c, start by similarity
          Length = 250

 Score =  232 bits (591), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 115/246 (46%), Positives = 159/246 (64%), Gaps = 3/246 (1%)

Query: 1   MPRLIIVTGVSRGIGRSVVEKV-CRQPDTVVLGVARSEAALQELRATYGEQFEYVVGDVA 59
           M ++++VTG SRGIG ++V+ +     + VV G+AR+E AL+ L+ T G +F+Y+ GD+ 
Sbjct: 1   MKKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDIT 60

Query: 60  SEDAQDALVARAT-AYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGR 118
            ED  + +V +     GRID++VANAGVLEPV  V    VA W++LY++NFFS++ L+ +
Sbjct: 61  DEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINK 120

Query: 119 ALPLLKKAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTLXXXXXXXXXXXXXXXX 178
            LP L+K+          ASTK Y  W AYGSSKAA+NH  M+L                
Sbjct: 121 TLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGV 180

Query: 179 XDTQMQNDIRDKFG-HRMAPEALRRFTELKKNSELLDPQIPATIFANLALRGIPDCANGK 237
            DT+MQ+DIRDKFG   M  +AL+RFT+LKKN ELLD  +P  I+A LA+ GIP   NG+
Sbjct: 181 VDTKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAVSGIPAELNGE 240

Query: 238 YLRYND 243
           Y+RYND
Sbjct: 241 YVRYND 246

>YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reductase
           in the short-chain dehydrogenase/reductase (SDR) family
           of proteins [792 bp, 263 aa]
          Length = 263

 Score =  214 bits (545), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 118/259 (45%), Positives = 157/259 (60%), Gaps = 12/259 (4%)

Query: 1   MPRLIIVTGVSRGIGRSVVEKVCRQPD-TVVLGVARSEAALQELRATYG-EQFEYVVGDV 58
           M ++I++TG SRGIG  +V+ V  + D  +V GVAR+EA LQ L+  YG ++F Y V D+
Sbjct: 1   MGKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDI 60

Query: 59  ASEDAQDALVARA-TAYGRIDAVVANAGVLEPVQDVNHI----DVAAWRRLYEVNFFSVV 113
                 +ALV      +G++D +VANAG+LEPV+ ++      D+  W RL++VNFFS+V
Sbjct: 61  TDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV 120

Query: 114 GLVGRALPLLKKA--XXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTLXXXXXXXXX 171
            LV   LPLLK +            AS K Y+ W AYG SKAALNHFAM +         
Sbjct: 121 SLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKV 180

Query: 172 XXXXXX--XXDTQMQNDIRDKFGHR-MAPEALRRFTELKKNSELLDPQIPATIFANLALR 228
                     DTQMQ DIR+  G + M P+AL RFT+L K S LLDP++PA + A L L+
Sbjct: 181 RAVCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVLK 240

Query: 229 GIPDCANGKYLRYNDDILA 247
           GIPD  NG+YLRYND+ L 
Sbjct: 241 GIPDSLNGQYLRYNDERLG 259

>ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(861237..861989) [753 bp, 250 aa]
          Length = 250

 Score =  183 bits (464), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 140/246 (56%), Gaps = 3/246 (1%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQFEYVVGDVASED 62
           ++IIVTG SRGIG + V+++C  PD VV+GVAR+E  LQEL+A +G++F+YVVGDV  E 
Sbjct: 2   KVIIVTGASRGIGAATVDRLCSTPDVVVVGVARAETKLQELKARHGKKFDYVVGDVTDER 61

Query: 63  AQDALVARATA-YGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGRALP 121
              A++ + ++ YGR+DAVVANAGV    Q +   D+  WRRL+E+N FSVV L  +ALP
Sbjct: 62  VVQAVIDKVSSEYGRLDAVVANAGV-SYQQRIAEADIKEWRRLFEINLFSVVNLASKALP 120

Query: 122 LLKKAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTLXXXXXXXXXXXXXXXXXDT 181
           LL+K+           S   + A  AY SSK ALNHFA+ L                  T
Sbjct: 121 LLRKSQGAFIAVTSGLSQMGHPALAAYASSKIALNHFALILAMEETEIRSLALDPGLVQT 180

Query: 182 QMQNDIRDKFGHRMAPEALRRFTELKKNSELLDPQIPATIFANLALRGIPDCANGKYLRY 241
            M              +      EL K   ++ P+ P T+ A LA +GIP+  NGKY+ +
Sbjct: 181 DMTAAALVAADKAAGTQD-NSVRELTKQIRMVSPEEPGTVLAALAAKGIPEELNGKYVTF 239

Query: 242 NDDILA 247
           + + LA
Sbjct: 240 DSEKLA 245

>ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(858589..859341) [753 bp, 250 aa]
          Length = 250

 Score =  177 bits (450), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 105/250 (42%), Positives = 142/250 (56%), Gaps = 11/250 (4%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQFEYVVGDVASED 62
           R++IVTG SRGIG + VEK+C   D VV+GVAR+E  LQ+L+A +G++F+YVVGDV  E 
Sbjct: 2   RVVIVTGASRGIGEATVEKLCPTADVVVVGVARAETKLQKLKARHGKKFDYVVGDVTDER 61

Query: 63  AQDALVARATA-YGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGRALP 121
              A++ + ++ YGR+DAVVANAGV    + +   D+  WRRL+E+N FSVV LV +ALP
Sbjct: 62  VVQAVIDKVSSEYGRLDAVVANAGVSRH-ERIATADIKEWRRLFEINLFSVVNLVSKALP 120

Query: 122 LLKKAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTLXXXXXXXXXXXXXXXXXDT 181
           LL+++           S   + A  AY SSK ALNHFA+ L                  T
Sbjct: 121 LLRESQGTVIVVSSGLSQMGHPALAAYASSKIALNHFALILAMEEPEIRTIALDPGAVQT 180

Query: 182 QMQNDIRDKFGHRMAPEAL----RRFTELKKNSELLDPQIPATIFANLALRGIPDCANGK 237
            M  +     G   A EA         EL K   +  P+ P  + A LA RGIP+  NGK
Sbjct: 181 DMLAE-----GINAADEAAGSQDNAVRELLKQVRVATPEEPGAVLAALAARGIPEELNGK 235

Query: 238 YLRYNDDILA 247
           Y+R + + LA
Sbjct: 236 YVRADSEKLA 245

>ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(859663..860448) [786 bp, 261 aa]
          Length = 261

 Score =  176 bits (445), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 103/252 (40%), Positives = 143/252 (56%), Gaps = 15/252 (5%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQFEYVVGDVASED 62
           ++IIVTG SRGIG + V+++C  P+ VV+GVAR+E  LQEL+A +G++F+YVVGDV  E 
Sbjct: 13  KVIIVTGASRGIGAATVDRLCSTPEVVVVGVARAETKLQELKARHGKKFDYVVGDVTDER 72

Query: 63  AQDALVAR-ATAYGRIDAVVANAGVL--EPVQDVNHIDVAAWRRLYEVNFFSVVGLVGRA 119
              A++ + ++ YGR+DAVVANAGV   E ++D    D+  WRRL+E+N FSVV L  +A
Sbjct: 73  VVQAVIDKVSSGYGRLDAVVANAGVAGHERIEDA---DIKEWRRLFEINLFSVVNLASKA 129

Query: 120 LPLLKKAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTLXXXXXXXXXXXXXXXXX 179
           LPLL+K+           S     A   Y SSK ALNHFAM L                 
Sbjct: 130 LPLLRKSQGAFLVVSSMLSQMGVPAVATYASSKIALNHFAMILAMEEPEIRTIALDPGVA 189

Query: 180 DTQMQNDIRDKFGHRMAPEAL----RRFTELKKNSELLDPQIPATIFANLALRGIPDCAN 235
            T M  D     G   A +A         E+ ++  +  P  P T+ A LA +GIP+  N
Sbjct: 190 QTDMLTD-----GLNAADQAAGTQDNAAREMMRHVRVASPDEPGTVLAALAAKGIPEELN 244

Query: 236 GKYLRYNDDILA 247
           GK++ Y+ + LA
Sbjct: 245 GKFVVYDSEELA 256

>Sklu_2380.4 YIR035C, Contig c2380 9858-10340
          Length = 160

 Score =  149 bits (377), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 101/145 (69%), Gaps = 3/145 (2%)

Query: 1   MPRLIIVTGVSRGIGRSVVEKVCR--QPDTVVLGVARSEAALQELRATYGEQFEYVVGDV 58
           M ++++VTG SRGIG+++V  +C     + VV+G+ARSE  L  ++  +G++FEY++GD+
Sbjct: 1   MAKVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDI 60

Query: 59  ASEDAQDALVARATA-YGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVG 117
           + E+     V  A   +GRIDAVVANAGVLEPVQDVN+IDVA W+RL++VNFFS+V LV 
Sbjct: 61  SDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIVSLVS 120

Query: 118 RALPLLKKAXXXXXXXXXXASTKAY 142
            +LP LKK           ASTK Y
Sbjct: 121 LSLPHLKKFNGNIVFVSSGASTKPY 145

>KLLA0E08063g complement(726232..726792) some similarities with
           sp|P40579 Saccharomyces cerevisiae YIR035c, hypothetical
           start
          Length = 186

 Score =  149 bits (377), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 70/144 (48%), Positives = 104/144 (72%), Gaps = 2/144 (1%)

Query: 1   MPRLIIVTGVSRGIGRSVVEKVCRQPDT-VVLGVARSEAALQELRATYGEQFEYVVGDVA 59
           M ++ +VTGVSRGIG S+VEK+C    T +V+G+ARS+  L+EL+  Y  +F+Y+ GDV+
Sbjct: 1   MSKVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVS 60

Query: 60  SEDA-QDALVARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGR 118
            E+   +A+    + Y R+D +VANAGVL+PV+DVN+I ++ W++L+++NFFSVV LVG 
Sbjct: 61  DEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGH 120

Query: 119 ALPLLKKAXXXXXXXXXXASTKAY 142
           ALPLLK++          ASTK+Y
Sbjct: 121 ALPLLKQSNGNIVLVSSGASTKSY 144

>ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(857415..858167) [753 bp, 250 aa]
          Length = 250

 Score =  148 bits (373), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 92/249 (36%), Positives = 135/249 (54%), Gaps = 6/249 (2%)

Query: 1   MPRLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQFEYVVGDVAS 60
           M R+IIVTG SRGIG + VEK+C  PD VV+GVAR+E  L+ L+  YG +F+YV GDV  
Sbjct: 1   MVRVIIVTGASRGIGEATVEKLCTAPDVVVVGVARAEKTLKVLKERYGSKFDYVAGDVTD 60

Query: 61  EDAQDALVARATA-YGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGRA 119
           E    A++ + ++ YGR+DA++ANAGV    + +   D+  W+R +E+   S V LV +A
Sbjct: 61  ESVVQAVLDKVSSDYGRLDAIIANAGV-SRFERIAEADIQQWKRTFEI-IVSAVSLVSKA 118

Query: 120 LPLLKKAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTLXXXXXXXXXXXXXXXXX 179
           LP+L+K+           S   Y A  +  SSK ALNHF   L                 
Sbjct: 119 LPMLRKSQGTVIVVTSGLSKVGYRASASSASSKIALNHFIRILAAEEPALRAVAVAPGVV 178

Query: 180 DTQMQNDIRDKFGHRMAPEALRRFTE-LKKNSELLDPQIPATIFANLALRGIPDCANGKY 238
            T M  +  D      AP A   F + + K   ++ P  P  + A LA++GIP   NG++
Sbjct: 179 RTDMTVEALD--ASEDAPGARDNFFKAVLKQGRVVLPDAPGAVLAALAVKGIPQELNGRF 236

Query: 239 LRYNDDILA 247
           ++++ + LA
Sbjct: 237 VQFDSEKLA 245

>KLLA0E08052g complement(725895..726248) similar to sp|P40580
           Saccharomyces cerevisiae YIR036c, hypothetical start
          Length = 117

 Score =  105 bits (262), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 64/103 (62%), Gaps = 1/103 (0%)

Query: 145 WGAYGSSKAALNHFAMTLXXXXXXXXXXXXXXXXXDTQMQNDIRDKFGHR-MAPEALRRF 203
           WGAYG+SKAALNHFA T+                  T+MQ DIR+ FG   M  EAL+RF
Sbjct: 10  WGAYGASKAALNHFAATIAAEEPAVKAISVAPGVVKTKMQEDIRETFGPSGMTKEALQRF 69

Query: 204 TELKKNSELLDPQIPATIFANLALRGIPDCANGKYLRYNDDIL 246
            +L  N +LL P +P TI+ANLA +GIP   +G YLRYND+ L
Sbjct: 70  VDLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKL 112

>KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces
           cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase, peroxisomal
           singleton, start by similarity
          Length = 889

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 71/163 (43%), Gaps = 5/163 (3%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAAL-QELRATYGEQFEYVVGDVASE 61
           +++I+TG   G+G+S  +   R    VV+   R  +A+  E+   YG            +
Sbjct: 314 KVVIITGSGSGLGKSHAQWFARYGAKVVINDIRDPSAVVDEINKKYGSGSAVADTHDIVK 373

Query: 62  DAQDALVARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGRALP 121
           +AQ  +      +GR+D +V NAG+L   +    +    W  +  V+ FS   L     P
Sbjct: 374 EAQQVVQTAVDKFGRVDILVNNAGILRD-RSFAKMTEDEWNAVINVHLFSTFALSKAVWP 432

Query: 122 LLKKAXXXXXXXXXXASTKAYSAWGA--YGSSKAALNHFAMTL 162
           +  K           +++  Y  +G   Y ++KAA+  F+ TL
Sbjct: 433 IFLK-QKSGYIINTTSTSGIYGNFGQCNYAAAKAAILGFSRTL 474

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 47/88 (53%), Gaps = 3/88 (3%)

Query: 3  RLIIVTGVSRGIGRSVVEKVCRQPDTVV---LGVARSEAALQELRATYGEQFEYVVGDVA 59
          R++I+TG   G+GR    +  ++   VV   LG + +++ +QE++   GE       D  
Sbjct: 8  RVVIITGAGGGLGRVYALEYAKRGGKVVVNDLGRSAADSVVQEIKKLGGEGDAVANYDSV 67

Query: 60 SEDAQDALVARATAYGRIDAVVANAGVL 87
          S++    +    + +GR+D ++ NAG+L
Sbjct: 68 SDNGAAIVETAISNFGRVDILINNAGIL 95

>KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7
           Enterobacter cloacae Putative oxidoreductase, start by
           similarity
          Length = 268

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 70/162 (43%), Gaps = 8/162 (4%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQFEYVVGDVASED 62
           ++I++TG S GIG S+ E + R     V G +R  +   +  +     F+ +  D+  E+
Sbjct: 4   QVILITGASTGIGLSIAETL-RSAGYEVFGTSRKGSIPGKEYS-----FKMIKLDITDEE 57

Query: 63  AQDALVARATAY-GRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGRALP 121
           +  + V       GRID +V NAG+      V        + ++E NFF V  +    LP
Sbjct: 58  SVKSAVNEVIEKAGRIDVLVNNAGIAFKWAAVEECSTDLAKTIFETNFFGVHRMTRAVLP 117

Query: 122 LLKKAXXXXXXXXXXASTKAYSAWGA-YGSSKAALNHFAMTL 162
            +++                   +GA Y SSK AL  +  +L
Sbjct: 118 HMREQRHGKIINISSMGGIMPIPYGALYCSSKHALEGYTESL 159

>AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH]
           (1327314..1328216) [903 bp, 300 aa]
          Length = 300

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 75/166 (45%), Gaps = 10/166 (6%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYG-EQFEYVVGDVASE 61
           ++++VTG S GIG  + +++  +   VV   ARS   ++ LR   G E+   V  DV  E
Sbjct: 15  KVVLVTGASSGIGYELTKELANR-GYVVYAAARSIEPIEALRDKCGPEKVIPVQLDVTDE 73

Query: 62  DAQDAL---VARATAYGRIDAVVANAG--VLEPVQDVNHIDVAAWRRLYEVNFFSVVGLV 116
           +    L   +++    G++ A+  NAG     P  DV    +    + + VN F+ + + 
Sbjct: 74  EQVTKLRRRMSKEIPGGKLHALFNNAGQSCTMPAVDVTPEMI---EKCFRVNVFAPMNIT 130

Query: 117 GRALPLLKKAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTL 162
               PLL +A          A    +     Y ++KAA++ +A  L
Sbjct: 131 REFAPLLIRAHGTIVFTGSLAGIIPFPFGSVYSATKAAVHQYARVL 176

>Sklu_1570.1 YKR009C, Contig c1570 100-2370
          Length = 756

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 58/132 (43%), Gaps = 18/132 (13%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVVLG-VARSEAALQELRATYGEQFEYVVGDVASE 61
           +++IVTG   G+GRS      +    VV+  +   E  + E+   YG       G  A  
Sbjct: 185 KIVIVTGAGGGLGRSHALWFAKYGAKVVVNDIKAPEPVVDEINKIYG-------GGSAIP 237

Query: 62  DAQDALVARAT--------AYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVV 113
           D  D +V + T        A+GR+D +V NAG+L     +   D   W  + +V+ FS  
Sbjct: 238 DKHD-VVTQPTEIVKTALEAFGRVDVLVNNAGILRDRSFLKMTD-EEWYAVLKVHLFSTY 295

Query: 114 GLVGRALPLLKK 125
           GL     P+  K
Sbjct: 296 GLSKAVWPVFLK 307

>Kwal_26.7950
          Length = 897

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 52/124 (41%), Gaps = 2/124 (1%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVVLG-VARSEAALQELRATYGEQFEYVVGDVASE 61
           +++I+TG   G+GRS      +    VV+  +      + E+   YG            +
Sbjct: 325 KVVIITGAGAGLGRSHALTFAKYGAKVVVNDIKDPHTVVSEIEKLYGRNSAVADKHDVVK 384

Query: 62  DAQDALVARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGRALP 121
           D  + + +    +GR+D +V NAGVL         D   W  + +V+ FS  GL     P
Sbjct: 385 DPGEIVKSAFQTFGRVDILVNNAGVLRDRSFAKMSD-EEWEIVLKVHLFSTFGLCKAVWP 443

Query: 122 LLKK 125
           +  K
Sbjct: 444 IFVK 447

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 60/134 (44%), Gaps = 14/134 (10%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVV---LGVA------RSEAA---LQELRATYGEQ 50
           R++++TG   G+G+    +  ++   VV   LG +       S AA   + E+R  Y  Q
Sbjct: 11  RVVVITGAGGGLGKVYALEFAKRGAKVVVNDLGGSLGGEGHNSRAADVVVSEIREKYKTQ 70

Query: 51  FEYVVGDVASEDAQDALVARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFF 110
                 D  +E+A   +      +GR+D ++ NAG+L      N  D +A+  + +V+  
Sbjct: 71  -AAANYDSVTENAAAIVQTAVDNFGRVDIIINNAGILRDSSFANMSD-SAFASVVDVHLT 128

Query: 111 SVVGLVGRALPLLK 124
               L   A P +K
Sbjct: 129 GAYNLTRAAWPHMK 142

>KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcina
           acetivorans Cyclohexanol dehydrogenase, start by
           similarity
          Length = 256

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 61/129 (47%), Gaps = 6/129 (4%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQFEYVVG---DVA 59
           ++ +VTG S G+G  +   +  +  TVV+  +R  + +QE           V+G   DV 
Sbjct: 9   KIALVTGASTGVGEGIARALFVRGATVVI-TSRHLSEVQETAGNIDPSGSRVIGKEVDVT 67

Query: 60  SEDAQDALVARA-TAYGRIDAVVANAGVLEPVQD-VNHIDVAAWRRLYEVNFFSVVGLVG 117
              A + L+      +G +  +V NAG+  P Q  +   D+ +WR++ + N       + 
Sbjct: 68  VAKAVEDLIQEIREEFGALHYLVNNAGITGPHQTGIEDYDIDSWRQVIDTNINGTFYTLK 127

Query: 118 RALPLLKKA 126
            ALPL++ +
Sbjct: 128 YALPLMESS 136

>AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH]
           complement(595270..597945) [2676 bp, 891 aa]
          Length = 891

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 71/163 (43%), Gaps = 5/163 (3%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVVLG-VARSEAALQELRATYGEQFEYVVGDVASE 61
           +++I+TG   G+GRS      +    VV+  +  ++  + E+ + YGE            
Sbjct: 320 KVVIITGAGAGLGRSHALWFAKYGARVVVNDLKGADGVVAEINSQYGEGRAVADSHNIVT 379

Query: 62  DAQDALVARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGRALP 121
           DA   +     A+ R+D +V NAG+L     V   D   W  + +V+  SV  L     P
Sbjct: 380 DAAAVVETAMKAFERVDVLVNNAGILRDRSFVKMTD-DEWNSVLQVHLLSVFALSKAVWP 438

Query: 122 LLKKAXXXXXXXXXXASTKAYSAWGA--YGSSKAALNHFAMTL 162
           +  +           +++  Y  +G   Y ++KAA+  F+ +L
Sbjct: 439 IFMQ-QRSGVIVNTTSTSGIYGNFGQANYSAAKAAVLGFSKSL 480

 Score = 32.0 bits (71), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 54/124 (43%), Gaps = 26/124 (20%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVVLG------------VARSEAALQELRATYGEQ 50
           R++I+TG   G+GR       ++   VV+                ++  ++E+R   G  
Sbjct: 8   RVVIITGAGGGLGREYALDYAKRGAKVVVNDLGGTLGGSGHDTRAADKVVEEIRKAGGT- 66

Query: 51  FEYVVGDVASEDAQDALVARAT-AYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNF 109
               V +  +    D +V  A  A+GR+D +V NAG+L            ++ ++ E NF
Sbjct: 67  ---AVANYDTVTDGDKIVKTAIDAFGRVDVIVNNAGILRD---------GSFAKMTEKNF 114

Query: 110 FSVV 113
            +VV
Sbjct: 115 SAVV 118

>Kwal_14.2444
          Length = 288

 Score = 40.8 bits (94), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 70/165 (42%), Gaps = 9/165 (5%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQFEYVVGDVASED 62
           ++ +VTG S GIG  +  ++  +    V   AR E  L+ L   + E    V  DV+  +
Sbjct: 5   KVAVVTGASSGIGYELTRQLASK-GYKVYAAARREQRLETLAKEFPELVVPVKLDVSEPE 63

Query: 63  AQDAL---VARATAYGRIDAVVANAG--VLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVG 117
               L   +A+     ++D +  NAG     P  DV + DV    + ++VN F  V L  
Sbjct: 64  QIIHLRERLAKELPSQKLDVLYNNAGQSCTFPASDVTN-DVL--EQAFKVNVFGPVNLCK 120

Query: 118 RALPLLKKAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTL 162
             LP + KA          A    +     Y ++K A++ +A  L
Sbjct: 121 ELLPFVIKAKGTVLFTGSVAGLMPFPFGSIYSATKGAIHSYARCL 165

>Kwal_47.17102
          Length = 285

 Score = 40.8 bits (94), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 67/153 (43%), Gaps = 7/153 (4%)

Query: 4   LIIVTGVSRGIGRSVVEK-VCRQPDTVVLGVARSEAALQELRATYGEQFEYVVGDVASED 62
           + +VTG S G+GR++V++ + + P+  ++ +      ++  + ++   + Y      S D
Sbjct: 34  VCVVTGGSNGLGRAIVQEFLLKLPNVTLISLD-----IEPPKKSFPNVYHYTCDLSNSSD 88

Query: 63  AQDALVARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGRALPL 122
               L      +G +  ++ NAG+    Q+   +      ++++VN F+ + LV    P 
Sbjct: 89  VDQTLKIVKRNHGDVTVLINNAGIRAKYQNFRELSKEVADKVFQVNVFTPMRLVQELSPK 148

Query: 123 LKKAXXXXXXXXXXASTKAYSAWGA-YGSSKAA 154
                         A      A G+ YG+SKAA
Sbjct: 149 AGDLRQFYAVTVASALGVCAPARGSCYGASKAA 181

>CAGL0L02167g 253055..255760 highly similar to sp|Q02207
           Saccharomyces cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase peroxisomal, start by
           similarity
          Length = 901

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 55/134 (41%), Gaps = 22/134 (16%)

Query: 3   RLIIVTGVSRGIGRS-----------VVEKVCRQPDTVVLGVARSEAALQELRATYGEQF 51
           +++I+TG   G+G+S           VV    + P+TVV           E+ + YGE  
Sbjct: 324 KVVIITGAGGGLGKSHALWFAKYGARVVVNDIKDPNTVV----------NEINSKYGEGR 373

Query: 52  EYVVGDVASEDAQDALVARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFS 111
                     +A   +     AYGR+D +V NAG+L     +   D   W  + +V+ +S
Sbjct: 374 AIPDTHNVVTEANQVIETAMKAYGRVDVLVNNAGILRDRSFLKMTD-QEWFAVVQVHLYS 432

Query: 112 VVGLVGRALPLLKK 125
              L     P+  K
Sbjct: 433 TFLLSKAVWPIFLK 446

>Scas_666.17*
          Length = 283

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 73/160 (45%), Gaps = 13/160 (8%)

Query: 5   IIVTGVSRGIGRSVVEKVCRQ-PDTVVLGVARSEAALQELRATYGEQFEYVVGDVASE-D 62
           +++TG S G+G ++V +   + P   ++ V +  +   + R         +  D++++ +
Sbjct: 28  VVITGGSHGLGHAIVVRFLNKVPKITIINVDKISSPQDDPRMVT------IQCDLSNQVE 81

Query: 63  AQDALVARATAYG-RIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGRALP 121
            +  L      YG RI  ++ NAG+    Q+  H+D     R++++N F+ V  +   +P
Sbjct: 82  MEKTLSLIKRKYGERIAVIINNAGMRMKYQNFQHLDQNECMRVFQLNTFNAVRFMQSLVP 141

Query: 122 LLKKAXXXXXXXXXXASTKAY---SAWGAYGSSKAALNHF 158
             + +          AST      +    YG+SK+AL  F
Sbjct: 142 -EENSNDRQCYIVNVASTLGTLTPAKVAGYGASKSALIAF 180

>Sklu_1578.3 YMR226C, Contig c1578 1774-2580
          Length = 268

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 68/170 (40%), Gaps = 11/170 (6%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPD---TVVLGVARSEAALQELR----ATYGEQFEYV- 54
           + + +TG S GIG++   + C   +    +VL   R E  LQEL+      Y E   Y+ 
Sbjct: 14  KTVFITGASAGIGQATALEYCDASNGKINLVLSARRLE-KLQELKDKITKEYPEAKVYIG 72

Query: 55  VGDVA-SEDAQDALVARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVV 113
           V DV  +E  +  L      +  ID ++ NAG       V  I       +   N  +++
Sbjct: 73  VLDVTETEKIKPFLDGLPEEFKDIDILINNAGKALGSDPVGTIKTEDIEGMINTNVLALI 132

Query: 114 GLVGRALPLLK-KAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTL 162
            +    LP+ K K           A   AY     Y +SK A+  F  +L
Sbjct: 133 NITQAVLPIFKAKNFGDIVNLGSVAGRDAYPTGAIYCASKHAVRAFTQSL 182

>YMR226C (YMR226C) [4182] chr13 complement(721592..722395)
           NADP+-dependent L-allo-threonine dehydrogenase, member
           of the short-chain dehydrogenase-reductase family, which
           are NAD- or NADP-dependent oxidoreductases [804 bp, 267
           aa]
          Length = 267

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 68/169 (40%), Gaps = 9/169 (5%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQP--DTVVLGVARSEAALQELRATYGEQFEYVVGDVAS 60
           + +++TG S GIG++   +       D  ++  AR    L+EL+ T  ++F      VA 
Sbjct: 14  KTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKKTIDQEFPNAKVHVAQ 73

Query: 61  EDAQDALVAR------ATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVG 114
            D   A   +         +  ID +V NAG       V  I     + +++ N  +++ 
Sbjct: 74  LDITQAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDIQDVFDTNVTALIN 133

Query: 115 LVGRALPLLK-KAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTL 162
           +    LP+ + K           A   AY     Y +SK A+  F  +L
Sbjct: 134 ITQAVLPIFQAKNSGDIVNLGSIAGRDAYPTGSIYCASKFAVGAFTDSL 182

>KLLA0F04455g complement(428010..428927) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 305

 Score = 37.0 bits (84), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 70/164 (42%), Gaps = 13/164 (7%)

Query: 6   IVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQFEYVVGDVASEDAQD 65
           +VTG S GIG  V +++ R+    V   AR    ++ELRA +G++      DV++++   
Sbjct: 8   LVTGASSGIGYEVTKELLRR-GWYVYACARRTHPMEELRAEFGDRCIPRKLDVSNQNDIT 66

Query: 66  AL---VARATAYGRIDAVVANAG--VLEPVQDVNH--IDVAAWRRLYEVNFFSVVGLVGR 118
            L   + +     ++  +  NAG     P  DV+   ID       + VN +  +     
Sbjct: 67  QLKLKLEQELPDQKLHLLYNNAGQSCSLPAIDVSEEIID-----NTFRVNVYGPINSCRE 121

Query: 119 ALPLLKKAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTL 162
             PL+  A          A    +     Y +SKAA++ +A  L
Sbjct: 122 FAPLIINAKGTIVFTGSLAGICPFPFGAVYSASKAAIHQYARVL 165

>AFR561W [3753] [Homologous to ScYMR226C - SH]
           complement(1438981..1439784) [804 bp, 267 aa]
          Length = 267

 Score = 36.6 bits (83), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 68/165 (41%), Gaps = 9/165 (5%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVV--LGVARSEAALQELRATYGEQF---EYVVG- 56
           ++++VTG S GIGR+         D  +  + VAR    L  L+     ++   +  VG 
Sbjct: 14  KIVLVTGASAGIGRATAINYADATDGAIKLILVARRAEKLTSLKQEIESKYPNAKIHVGQ 73

Query: 57  -DVASEDA-QDALVARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVG 114
            DV   D  +  L      +  ID ++ NAG     + V  I +   + ++  N   +V 
Sbjct: 74  LDVTQLDQIRPFLEGLPEEFRDIDILINNAGKALGTERVGEISMDDIQEVFNTNVIGLVH 133

Query: 115 LVGRALPLLK-KAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHF 158
           L    LP++K K           A  +AY     Y ++K A+  F
Sbjct: 134 LTQEVLPIMKAKNSGDIVNVGSIAGREAYPGGSIYCATKHAVKAF 178

>CAGL0G08690g complement(822798..823682) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 294

 Score = 36.2 bits (82), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 73/168 (43%), Gaps = 14/168 (8%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQFEYVVG---DVA 59
           ++ +VTG S GIG  V +++ R+    V   AR  A ++ L  ++G+  E +V    D++
Sbjct: 8   KVAVVTGASSGIGYEVTKELARK-GFKVFACARRTAPIEPLVNSFGK--ELIVPHHLDIS 64

Query: 60  SEDAQ---DALVARATAYGRIDAVVANAG--VLEPVQDVNHIDVAAWRRLYEVNFFSVVG 114
             D        +A      ++D +  NAG     P  DV++ DV    + ++VN F  + 
Sbjct: 65  ELDEVLKFKEFLASELPEQKLDILYNNAGQSCTFPALDVSN-DV--MEQCFKVNVFGHIN 121

Query: 115 LVGRALPLLKKAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTL 162
           +       L  A          A          Y ++KAA++ +A TL
Sbjct: 122 MTRELAQYLINAKGTVIFTGSIAGFSTLPFGSIYAATKAAIHEYARTL 169

>Kwal_26.9160
          Length = 267

 Score = 35.8 bits (81), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 71/169 (42%), Gaps = 9/169 (5%)

Query: 3   RLIIVTGVSRGIGRSVVEKV--CRQPDTVVLGVARSEAALQELRATYGEQF---EYVVG- 56
           + +++TG S GIG++   +       +  ++  AR    L+E+++ + + F   +  +G 
Sbjct: 14  KTVLITGASAGIGQATALEYLDASNGNIKLILAARRLEKLKEIKSQFEKDFPEAKVYIGQ 73

Query: 57  -DVASEDAQDALVAR-ATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVG 114
            DV   D     +      +  ID ++ NAG       V  ID +    + + N  +++ 
Sbjct: 74  LDVTHTDEIKPFIDNLPEEFKDIDILINNAGKALGSDPVGTIDASDIEGMIQTNVVALIN 133

Query: 115 LVGRALPLLK-KAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTL 162
           +    LP+ K K           A  +AY     Y ++K A+  F  +L
Sbjct: 134 MTQAVLPIFKAKNAGDIVNLGSVAGREAYPTGSIYCATKHAVRAFTQSL 182

>YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacetone
           phosphate reductase [894 bp, 297 aa]
          Length = 297

 Score = 35.4 bits (80), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 69/164 (42%), Gaps = 6/164 (3%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYG-EQFEYVVGDVASE 61
           ++ +VTG S GIG  V +++ R    +V   AR    + +L   +G +  +    D++  
Sbjct: 10  KIAVVTGASGGIGYEVTKELARN-GYLVYACARRLEPMAQLAIQFGNDSIKPYKLDISKP 68

Query: 62  D---AQDALVARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGR 118
           +        +      G++D +  NAG       ++  D AA  + ++VN F  + +   
Sbjct: 69  EEIVTFSGFLRANLPDGKLDLLYNNAGQSCTFPALDATD-AAVEQCFKVNVFGHINMCRE 127

Query: 119 ALPLLKKAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTL 162
               L KA          A   ++     Y +SKAA++ +A  L
Sbjct: 128 LSEFLIKAKGTIVFTGSLAGVVSFPFGSIYSASKAAIHQYARGL 171

>YKL071W (YKL071W) [3189] chr11 (304759..305529) Protein with
           similarity to proteins of the short-chain alcohol
           dehydrogenase family, expression is regulated by Yap1p
           transcription factor [771 bp, 256 aa]
          Length = 256

 Score = 35.0 bits (79), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 67/168 (39%), Gaps = 12/168 (7%)

Query: 7   VTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELR-----ATYGEQFEYVVGDVASE 61
           + G SRGIG ++V+ +       V+   R   +L + +     A   +    V  D+  +
Sbjct: 11  IIGGSRGIGFNLVKILSASTGNTVITSIRGSPSLPKNKQVEDLAKIRKNIHIVQLDLTKD 70

Query: 62  DAQDAL---VARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGR 118
           ++   +   + +   +  ID  +A + V +    V     + W   Y  N    +  + +
Sbjct: 71  ESIGNIADEIKKTPFFLGIDIFIACSAVSDSYYKVLETPKSVWLNHYSTNALGPILALQK 130

Query: 119 ALPLL--KKAXXXXXXXXXXASTKAYS--AWGAYGSSKAALNHFAMTL 162
             PLL  KK            S  A+   +  AYG SKAALN+   TL
Sbjct: 131 VYPLLLLKKTRKIFFISSVAGSINAFVPLSVSAYGQSKAALNYAVKTL 178

>Scas_594.12
          Length = 267

 Score = 34.7 bits (78), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 71/169 (42%), Gaps = 9/169 (5%)

Query: 3   RLIIVTGVSRGIGR-SVVEKVCRQPDTVVLG-VARSEAALQELR----ATYGEQFEYVVG 56
           +++ +TG S GIG+ + +E +     TV L  VAR    LQ+L+    A Y +   Y+  
Sbjct: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGK 73

Query: 57  -DVAS-EDAQDALVARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVG 114
            DV   E  Q  L      +  ID ++ NAG       V  ID+   + + + N   ++ 
Sbjct: 74  LDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLIN 133

Query: 115 LVGRALPLL-KKAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTL 162
           +    L +  KK           A   AY     Y +SK A+  F  +L
Sbjct: 134 VTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESL 182

>Sklu_268.1 , Contig c268 57-791 reverse complement
          Length = 244

 Score = 33.9 bits (76), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 4/87 (4%)

Query: 3  RLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQ--FEYVVGDVAS 60
          R +IVTG + GIG+++V + C Q    V+    +E AL  L+ +  +    +    DV  
Sbjct: 5  RKVIVTGAASGIGKAIVNQ-CLQEGASVIACDLNEQALLVLKESLNDSTVLDTYPMDVRK 63

Query: 61 EDAQDALVARA-TAYGRIDAVVANAGV 86
           +   A  A   T +  +D +V NAG+
Sbjct: 64 YEEVAAFFAYVETEHSDVDGLVNNAGI 90

>Scas_662.4
          Length = 307

 Score = 33.5 bits (75), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 67/171 (39%), Gaps = 18/171 (10%)

Query: 6   IVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQFEYVVG--------- 56
           IVTG S GIG  + +++ R    +V   AR    + +L      +    +          
Sbjct: 13  IVTGASSGIGYEITKELARN-GFIVYACARRLGPIDDLINDLAPELTTELAKAVIKPYQL 71

Query: 57  DVASEDAQD---ALVARATAYGRIDAVVANAG--VLEPVQDVNHIDVAAWRRLYEVNFFS 111
           D++ ED        + +    G++D +  NAG     P  DV + DV    + ++VN F 
Sbjct: 72  DISKEDEVKQFRVFLEKELPNGKLDLLYNNAGQSCTFPALDVTN-DV--MEQCFKVNVFG 128

Query: 112 VVGLVGRALPLLKKAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTL 162
            V +       L +A          A    +     Y ++KAA++ +A  L
Sbjct: 129 HVNMCRELASYLIQARGTIVFTGSLAGITPFPFGSIYSATKAAIHEYARVL 179

>Kwal_34.16024
          Length = 292

 Score = 33.5 bits (75), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 66/166 (39%), Gaps = 9/166 (5%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRA-TYG-EQFEYVVGDVAS 60
           +L+IVTG +  IGR++ E        V +   + +A L  L A  YG E   Y V     
Sbjct: 40  KLVIVTGAAGVIGRAICEGFASAGADVCVVDYKYDADLATLLAQKYGVEARAYQVDITND 99

Query: 61  EDAQDALVARATAYGR--IDAVVANAGVLEPVQDVNHIDVA--AWRRLYEVNFFSVVGLV 116
           ED +  + A    +    ID  +ANAGV      V +      AWRR+ +VN        
Sbjct: 100 EDVRACIQAVQKDFPSRDIDTFIANAGVAWTHGSVLNESATPEAWRRVMDVNVQGTFHCA 159

Query: 117 GRALPLLKKAXXXXXXXXXXASTKAYSA---WGAYGSSKAALNHFA 159
                + K+            S+   +       Y +SKAA+ H A
Sbjct: 160 QEVAHVFKRQGHGCLILTASMSSHIANVPNYQTCYNASKAAVRHMA 205

>Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement
          Length = 289

 Score = 32.7 bits (73), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 68/165 (41%), Gaps = 9/165 (5%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQFEYVVGDVAS-E 61
           ++ +VTG S GIG  + + +  +  T V   AR    ++ L   + E+   V  DV+  +
Sbjct: 5   KVALVTGASSGIGYEITKLLASKGYT-VYAAARRTTPIKPLEEEFPEKVIAVSLDVSDLQ 63

Query: 62  DAQD--ALVARATAYGRIDAVVANAG--VLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVG 117
             QD  A  +R     ++  +  NAG     P  DV +  +    + ++VN F  + L  
Sbjct: 64  QIQDLKARFSRDLPDSKLHILYNNAGQSCTFPAVDVGNDKI---EQCFKVNVFGPMNLCR 120

Query: 118 RALPLLKKAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTL 162
                +  A          A    +     Y S+KAA++ +A  L
Sbjct: 121 EMSDFVINARGTIVFTGSLAGIVPFPFGSIYSSTKAAIHQYARVL 165

>Scas_652.19d1
          Length = 344

 Score = 32.7 bits (73), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 51/117 (43%), Gaps = 14/117 (11%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQFEYVVGDVASED 62
           +  +VTG + GIG+ VVE +  Q +  V+GV R++A  +E +           G++    
Sbjct: 42  KTAVVTGCNTGIGKHVVE-LLYQKNCNVIGVVRTDAKGEEAKKEIIANNPKSKGNITIIG 100

Query: 63  AQDAL-----------VARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVN 108
             D L           +  A     ++ ++ NAG++ P  D     V  +  +++ N
Sbjct: 101 GCDYLDLEKVPAVGGKIKEALGDKPLNIIIHNAGLMAP--DNKGTSVQGYEAMFQTN 155

>AEL164C [2342] [Homologous to ScYBR265W (TSC10) - SH]
          (326834..327757) [924 bp, 307 aa]
          Length = 307

 Score = 32.7 bits (73), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 27/38 (71%)

Query: 3  RLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAAL 40
          ++++++G S+G+GR+  +K   + D+ V+ V+RSE  L
Sbjct: 8  QVVLISGGSQGLGRAFAQKYIEESDSTVVIVSRSEEKL 45

>KLLA0B09812g complement(856799..857839) similar to sp|P38286
           Saccharomyces cerevisiae YBR159w singleton, start by
           similarity
          Length = 346

 Score = 32.3 bits (72), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 61/125 (48%), Gaps = 7/125 (5%)

Query: 6   IVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQFEYVVG----DVASE 61
           +VTG S GIG+   +++ ++   ++L ++R+E+ L EL+     + +  V     DV+S+
Sbjct: 69  VVTGASDGIGKEYAKQLAKRGFNLIL-ISRTESKLVELKKEIETECKIDVKILAIDVSSD 127

Query: 62  DAQDALVARATAYGR-IDAVVANAGVLEPVQ-DVNHIDVAAWRRLYEVNFFSVVGLVGRA 119
             ++  + R  A G  +  ++ N G    +    +  + +  R +  +N  + + +    
Sbjct: 128 SKENYTLIREVASGLPVTVLINNVGKSHSIPVPFDQTEESELRDIITINNTATLMITQTL 187

Query: 120 LPLLK 124
           LP LK
Sbjct: 188 LPQLK 192

>CAGL0J04774g join(452094..452179,452259..453189) similar to
           tr|Q06417 Saccharomyces cerevisiae YLR426w
          Length = 338

 Score = 32.3 bits (72), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 69/165 (41%), Gaps = 14/165 (8%)

Query: 4   LIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQFEYVVG---DVAS 60
           ++++TG S G+GR ++ K+ R  + +       +    +L   Y  +   V+    D+ +
Sbjct: 71  IVLITGGSNGLGRCIIHKLLRSYNNI-------KVINLDLDVQYWSEEARVINIECDLVN 123

Query: 61  EDAQD-ALVARATAY-GRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGR 118
            D  + AL      Y  +I+ ++ NAGV           +   +R+  +N +S   ++  
Sbjct: 124 ADGLELALKKIKLEYEDKINLLICNAGVRSRFNWFEDTPIDEMQRIMNINTWSTARILQA 183

Query: 119 ALPLLKKAXXXXXXXXXXASTKAYSAWGAYGSSKAALN--HFAMT 161
            +P   +               A S   +Y +SKAA+   H +MT
Sbjct: 184 IIPRDNQRQLYIVTISSVLGILAPSKVASYAASKAAITALHNSMT 228

>Kwal_14.1511
          Length = 277

 Score = 32.0 bits (71), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 54/94 (57%), Gaps = 8/94 (8%)

Query: 1  MPRLIIVTGVSRGIGRSVVEKVCRQPDTVVLG-----VARSEAALQELRATYG--EQFEY 53
          MP+ I++TG ++GIG+++   + R+   + +        +++A L+E++      +   +
Sbjct: 1  MPKTILITGAAQGIGKAIAVDLARKGYQLAIADLPQQNEKAQAVLKEIKELQSGVKAPIF 60

Query: 54 VVGDVASEDAQDALVAR-ATAYGRIDAVVANAGV 86
          +  DV+++++   +V + A+ +G  D ++ NAG+
Sbjct: 61 LPIDVSNKESVFGVVDKVASHFGAFDVMINNAGI 94

>Scas_721.47
          Length = 344

 Score = 32.0 bits (71), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 4/66 (6%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVVL---GVARSEAALQELRATYGEQFEYVVGDVA 59
           +  +VTG S GIG+    ++  +   +VL    +++ EA  +E    YG + E +  D++
Sbjct: 63  KYCVVTGASDGIGKEFANQMAARGFNLVLISRTLSKLEALKEEFEKKYGIKVEILAIDIS 122

Query: 60  SEDAQD 65
           S D+QD
Sbjct: 123 S-DSQD 127

>Kwal_27.12155
          Length = 280

 Score = 31.2 bits (69), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 30/61 (49%), Gaps = 6/61 (9%)

Query: 58  VASEDAQDALVARA-TAYGRIDAVVANAGVLE---PVQDVNHIDVA--AWRRLYEVNFFS 111
           V  E    A +AR  T +GRID  VANAGV     P+ D     VA   W R+ + +F  
Sbjct: 89  VDDEQQVQATIARVITEFGRIDVFVANAGVAWHEGPLLDAQRRSVADQEWNRIIQTDFQG 148

Query: 112 V 112
           V
Sbjct: 149 V 149

>KLLA0E24046g complement(2136583..2137425) similar to
           ca|CA3771|CaSOU1 Candida albicans Sorbitol utilization
           protein Sou1p [Candida albicans], hypothetical start
          Length = 280

 Score = 31.2 bits (69), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 6/89 (6%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQFEYVVGDVASED 62
           ++ +VTG S GIG +V E + +   ++ +    S AAL E       ++   V       
Sbjct: 31  KVAVVTGASSGIGYAVAEGLAQAGASLAVWY-NSNAALVERAVELSAKYNVKVVAYQCPV 89

Query: 63  AQDALVARAT-----AYGRIDAVVANAGV 86
            ++A V +        +G+ID  +ANAGV
Sbjct: 90  TEEAKVKKTIEDVIQEFGKIDVFIANAGV 118

>Kwal_27.11910
          Length = 184

 Score = 30.4 bits (67), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 39/61 (63%), Gaps = 1/61 (1%)

Query: 6   IVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQFEYVVGDVASEDAQD 65
           +VTG S GIG+    ++ ++   +VL ++R+ + L+ L++ + ++++  V  +A + +QD
Sbjct: 66  VVTGASDGIGKEYARQMAKRGFNLVL-ISRTLSKLESLQSEFEKEYKVQVRILAIDISQD 124

Query: 66  A 66
           +
Sbjct: 125 S 125

>YBR159W (YBR159W) [344] chr2 (558641..559684) Major 3-ketoreductase
           of the fatty acid elongase system involved in synthesis
           of very long chain fatty acids [1044 bp, 347 aa]
          Length = 347

 Score = 30.8 bits (68), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 45/89 (50%), Gaps = 5/89 (5%)

Query: 7   VTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQFEYVVGDVASEDAQDA 66
           +TG S GIG+    ++ ++   +VL ++R+++ L+ L+    +Q   VV  +A + A+D 
Sbjct: 67  ITGASDGIGKEFARQMAKRGFNLVL-ISRTQSKLEALQKELEDQHHVVVKILAIDIAED- 124

Query: 67  LVARATAYGRIDAVVANAGVLEPVQDVNH 95
              + + Y  I  + A   +   V +V  
Sbjct: 125 ---KESNYESIKELCAQLPITVLVNNVGQ 150

>YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109)
           Member of the short chain alcohol dehydrogenase/ribitol
           dehydrogenase family [981 bp, 326 aa]
          Length = 326

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/121 (19%), Positives = 60/121 (49%), Gaps = 9/121 (7%)

Query: 4   LIIVTGVSRGIGRSVVEKVCRQ-PDTVVLGVARSEAALQELRATYGEQFEYVVGDVASED 62
           ++++TG S+G+GR++V ++ +   +  +L V    ++++  R       + ++ D++ ++
Sbjct: 72  IVLITGGSKGLGRAIVSQLLQDYSNLTILNVDICPSSVRNTRV------KDLICDLSDDE 125

Query: 63  AQDAL--VARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGRAL 120
              AL  + +      I  +V NAGV       N ++     +++++N F+ +  +    
Sbjct: 126 EVAALLNLLKRKYKNEIRLIVNNAGVRANFTGFNGMERDNLDKIFKINTFAPLQFIQELA 185

Query: 121 P 121
           P
Sbjct: 186 P 186

>Scas_478.2
          Length = 920

 Score = 30.4 bits (67), Expect = 1.4,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 44/93 (47%), Gaps = 15/93 (16%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVVLG-VARSEAALQELRATYGEQFEYVVGDVASE 61
           +++I+TG + G+G+S      +    V++  +   E  + E+ + +G        D A  
Sbjct: 326 KVVIITGANGGLGKSHAMWFAKYGAKVIINDITNPETTVNEINSKFG-------ADTAFP 378

Query: 62  DAQD-----ALVARATA--YGRIDAVVANAGVL 87
           D+ +      LV +     +G +D +V NAG+L
Sbjct: 379 DSHNIITESELVVKTAIDHFGHVDILVNNAGIL 411

>Scas_613.18
          Length = 286

 Score = 29.3 bits (64), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 69/160 (43%), Gaps = 12/160 (7%)

Query: 6   IVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQELRATYGEQFEYVVGDVASEDAQD 65
           +VTG S G+G  +V+++  +  TV++     +     ++    +   Y   DV S++  +
Sbjct: 39  LVTGGSSGLGLEIVKQLLSKRCTVII----LDIYPPNIQFGADKALTYYKCDVGSQEEIE 94

Query: 66  ALVARATA-YGRIDAVVANAGV--LEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGRALPL 122
               R +  +  I  ++ NAG+  L+P+ + +  +V    ++  VN+     L+   L  
Sbjct: 95  KTYKRISKDHASIHILINNAGITCLKPITEFSKEEV---NKVINVNYLGACKLMHLWLSA 151

Query: 123 LKKAXXXXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTL 162
             +             T A  A  AYG+SK  L  F  +L
Sbjct: 152 NNEGFIVNIASVLGLITPARLA--AYGASKGGLISFHQSL 189

>CAGL0M11242g complement(1105723..1106529) highly similar to
           sp|Q05016 Saccharomyces cerevisiae YMR226c, start by
           similarity
          Length = 268

 Score = 28.9 bits (63), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 38/103 (36%), Gaps = 1/103 (0%)

Query: 61  EDAQDALVARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGRAL 120
           E+ +  L      +  ID ++ NAG       V  ID      +   N  +++ L    L
Sbjct: 80  ENVKQFLADLPEEFKDIDILINNAGKALGSDKVGDIDPEDIAGMVNTNVLALINLTQLLL 139

Query: 121 PLLKKAXX-XXXXXXXXASTKAYSAWGAYGSSKAALNHFAMTL 162
           PL KK            A   AY     Y ++K A+  F  +L
Sbjct: 140 PLFKKKNSGDIVNLGSIAGRDAYPTGAIYCATKHAVRAFTQSL 182

>Kwal_55.19569
          Length = 288

 Score = 28.9 bits (63), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 53/119 (44%), Gaps = 9/119 (7%)

Query: 3   RLIIVTGVSRGIGRSVVEKVCRQPDTVVLGVARSEAALQ---ELRATYGEQFEYVVGDVA 59
           ++  ++G S GIG +V     +    + +    ++  +Q   EL  TYG + +     V 
Sbjct: 39  KVACISGASSGIGGAVAVAFAQAGADIAVWYNSNDKLIQTAKELSETYGVRAKAYKCPVT 98

Query: 60  SE-DAQDALVARATAYGRIDAVVANAGVL---EPVQDVNHIDVAA--WRRLYEVNFFSV 112
            E   ++ ++     + +ID  VANAGV     P+ +     VA   W +++  +F  V
Sbjct: 99  DEAKVKETILQVEKDFSKIDIFVANAGVPWSEGPLIEAEERGVATKEWEKVFNTDFQGV 157

>Kwal_26.8282
          Length = 298

 Score = 28.1 bits (61), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 10/17 (58%), Positives = 16/17 (94%)

Query: 6  IVTGVSRGIGRSVVEKV 22
          +VTG +RGIGR++V+K+
Sbjct: 39 LVTGATRGIGRAIVDKL 55

>Sklu_2404.13 YKL055C, Contig c2404 24100-25005
          Length = 301

 Score = 27.7 bits (60), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 18/26 (69%)

Query: 6  IVTGVSRGIGRSVVEKVCRQPDTVVL 31
          ++TG +RGIGRS+  K+ R+    V+
Sbjct: 8  VITGATRGIGRSIAAKLSREGMCCVI 33

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,375,885
Number of extensions: 211339
Number of successful extensions: 559
Number of sequences better than 10.0: 59
Number of HSP's gapped: 496
Number of HSP's successfully gapped: 65
Length of query: 247
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 148
Effective length of database: 13,168,927
Effective search space: 1949001196
Effective search space used: 1949001196
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)