Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR169C1851827521e-103
CAGL0I03740g35365641.7
AFL042C64146606.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR169C
         (182 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR169C [1216] [Homologous to NOHBY] (652865..653422) [558 bp, 1...   294   e-103
CAGL0I03740g complement(321853..322914) similar to tr|Q07589 Sac...    29   1.7  
AFL042C [3151] [Homologous to ScYGL099W (LSG1) - SH] (359599..36...    28   6.1  

>ACR169C [1216] [Homologous to NOHBY] (652865..653422) [558 bp, 185
           aa]
          Length = 185

 Score =  294 bits (752), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 152/182 (83%), Positives = 152/182 (83%)

Query: 1   MDIENSRLLEFLLTDEACGSPDKGHKVLRARQQVPSSYSRPPKRLSSLRIQNLKTPRKDT 60
           MDIENSRLLEFLLTDEACGSPDKGHKVLRARQQVPSSYSRPPKRLSSLRIQNLKTPRKDT
Sbjct: 1   MDIENSRLLEFLLTDEACGSPDKGHKVLRARQQVPSSYSRPPKRLSSLRIQNLKTPRKDT 60

Query: 61  RNDEYIKKDLESIILLRGTSNVGTLKVGKSPVEPVRKPRPSSGAEVNGGDAGHPSGPXXX 120
           RNDEYIKKDLESIILLRGTSNVGTLKVGKSPVEPVRKPRPSSGAEVNGGDAGHPSGP   
Sbjct: 61  RNDEYIKKDLESIILLRGTSNVGTLKVGKSPVEPVRKPRPSSGAEVNGGDAGHPSGPSSK 120

Query: 121 XXXXXXXXXXXXXXXAPELPQTTPKAAPEAAGXXXXXXXXXXXXTASKRAGDSGGQASTE 180
                          APELPQTTPKAAPEAAG            TASKRAGDSGGQASTE
Sbjct: 121 RKKSKQKGASKKDKSAPELPQTTPKAAPEAAGRKRPRPRMPRKRTASKRAGDSGGQASTE 180

Query: 181 AG 182
           AG
Sbjct: 181 AG 182

>CAGL0I03740g complement(321853..322914) similar to tr|Q07589
           Saccharomyces cerevisiae YDL144c, hypothetical start
          Length = 353

 Score = 29.3 bits (64), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 4/65 (6%)

Query: 42  PKRLSS-LRIQNLKTPRKDTRNDEYIK-KDLESIILLRGTSNVGTLKVGKSPVEPVRKPR 99
           P+RL+S L IQN     K   +   +K +D  + ++L G   VGT KVGK+ ++ + +  
Sbjct: 112 PERLTSVLLIQNGIDIEKHLVST--LKPEDYNNYVVLSGVEIVGTTKVGKAQIKHIGQDH 169

Query: 100 PSSGA 104
            S GA
Sbjct: 170 LSVGA 174

>AFL042C [3151] [Homologous to ScYGL099W (LSG1) - SH]
           (359599..361524) [1926 bp, 641 aa]
          Length = 641

 Score = 27.7 bits (60), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 70  LESIILLRGTSNVGTLKVGKSPVEPVRKPRPSSGAEVNGGDAGHPS 115
           LE I +L+    +  L + K+P EP+++PRP     +  G  G+P+
Sbjct: 306 LERIRILK-IEELEDLFLSKAPSEPLQEPRPGHEPLIQIGLVGYPN 350

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.307    0.128    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,141,521
Number of extensions: 197022
Number of successful extensions: 394
Number of sequences better than 10.0: 6
Number of HSP's gapped: 393
Number of HSP's successfully gapped: 6
Length of query: 182
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 87
Effective length of database: 13,307,399
Effective search space: 1157743713
Effective search space used: 1157743713
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 58 (26.9 bits)