Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR168W70769436100.0
Sklu_2380.677471023030.0
Kwal_14.87472271421350.0
KLLA0E07986g72171020480.0
Scas_685.1076073818040.0
YKL022C (CDC16)84076817250.0
CAGL0L09823g74355214800.0
AGL294W6562571605e-11
Scas_599.58092641597e-11
Kwal_27.107406282601363e-08
KLLA0B09262g9412221321e-07
ADL344W9102221274e-07
Kwal_23.36708022401275e-07
YHR166C (CDC23)6261991257e-07
KLLA0E20933g7102601257e-07
Scas_705.559072191258e-07
YBR112C (SSN6)9662221241e-06
YBL084C (CDC27)7582441194e-06
Scas_680.356311981168e-06
KLLA0A05258g6321691151e-05
CAGL0I02288g6391791132e-05
CAGL0C01903g7692291113e-05
ABR206W6821751095e-05
CAGL0D01364g11482091089e-05
AEL281C139085920.007
ABR131W59495880.018
KLLA0F04191g885130830.076
Kwal_56.24750619167820.10
CAGL0L12936g600115820.10
Scas_672.2430043790.16
Scas_718.37d60148800.18
KLLA0F24046g60478790.19
CAGL0K11209g590200790.22
CAGL0E01573g90459790.23
Scas_697.3062571790.23
CAGL0M01914g67646780.26
Kwal_23.5408141065780.29
KLLA0C15455g56662770.41
Sklu_2021.2600234750.62
Scas_666.2359694750.65
Kwal_56.23065907142750.68
Scas_585.491861750.78
YNL121C (TOM70)61776740.84
Sklu_2077.432368721.1
ACR005W32766721.2
KLLA0B03520g140156721.6
YHR117W (TOM71)63959712.0
Kwal_33.14767594133712.0
CAGL0L04048g58795712.0
KLLA0B10912g512122712.1
CAGL0J09570g549111702.2
Sklu_1876.2109091712.2
YBR055C (PRP6)899225702.4
YOR007C (SGT2)34664692.7
YDR244W (PEX5)612204693.3
ADL177C90565684.3
Scas_589.51087105684.4
CAGL0G10087g141172675.7
CAGL0I09702g52119675.9
ACR173W28595666.4
CAGL0K05599g71032667.4
Scas_721.6457842667.8
Kwal_55.2203990489668.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR168W
         (694 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR168W [1215] [Homologous to ScYKL022C (CDC16) - SH] complement...  1395   0.0  
Sklu_2380.6 YKL022C, Contig c2380 14352-16676 reverse complement      891   0.0  
Kwal_14.874                                                           827   0.0  
KLLA0E07986g 720700..722865 similar to sp|P09798 Saccharomyces c...   793   0.0  
Scas_685.10                                                           699   0.0  
YKL022C (CDC16) [3233] chr11 complement(394369..396891) Componen...   669   0.0  
CAGL0L09823g 1050447..1052678 some similarities with sp|P09798 S...   574   0.0  
AGL294W [4018] [Homologous to ScYBL084C (CDC27) - SH] complement...    66   5e-11
Scas_599.5                                                             66   7e-11
Kwal_27.10740                                                          57   3e-08
KLLA0B09262g 814303..817128 some similarities with sp|P14922 Sac...    55   1e-07
ADL344W [1396] [Homologous to ScYBR112C (CYC8) - SH] complement(...    54   4e-07
Kwal_23.3670                                                           54   5e-07
YHR166C (CDC23) [2453] chr8 complement(437170..439050) Component...    53   7e-07
KLLA0E20933g 1860517..1862649 weakly similar to sp|P38042 Saccha...    53   7e-07
Scas_705.55                                                            53   8e-07
YBR112C (CYC8) [302] chr2 complement(462826..465726) General rep...    52   1e-06
YBL084C (CDC27) [117] chr2 complement(67166..69442) Component of...    50   4e-06
Scas_680.35                                                            49   8e-06
KLLA0A05258g 466776..468674 similar to sp|P16522 Saccharomyces c...    49   1e-05
CAGL0I02288g complement(203605..205524) similar to sp|P16522 Sac...    48   2e-05
CAGL0C01903g complement(199487..201796) similar to sp|P38042 Sac...    47   3e-05
ABR206W [800] [Homologous to ScYHR166C (CDC23) - SH] complement(...    47   5e-05
CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces c...    46   9e-05
AEL281C [2224] [Homologous to ScYPR189W (SKI3) - SH] (111535..11...    40   0.007
ABR131W [723] [Homologous to ScYNL121C (TOM70) - SH; ScYHR117W (...    39   0.018
KLLA0F04191g 397611..400268 weakly similar to sp|P19735 Saccharo...    37   0.076
Kwal_56.24750                                                          36   0.10 
CAGL0L12936g 1380327..1382129 similar to sp|P07213 Saccharomyces...    36   0.10 
Scas_672.24                                                            35   0.16 
Scas_718.37d                                                           35   0.18 
KLLA0F24046g 2240454..2242268 similar to sp|P07213 Saccharomyces...    35   0.19 
CAGL0K11209g 1088471..1090243 similar to sp|P35056 Saccharomyces...    35   0.22 
CAGL0E01573g complement(148847..151561) similar to sp|P42842 Sac...    35   0.23 
Scas_697.30                                                            35   0.23 
CAGL0M01914g 232780..234810 some similarities with sp|P14922 Sac...    35   0.26 
Kwal_23.5408                                                           35   0.29 
KLLA0C15455g 1341570..1343270 similar to sp|P35056 Saccharomyces...    34   0.41 
Sklu_2021.2 YHR117W, Contig c2021 1337-3139                            33   0.62 
Scas_666.23                                                            33   0.65 
Kwal_56.23065                                                          33   0.68 
Scas_585.4                                                             33   0.78 
YNL121C (TOM70) [4474] chr14 complement(398684..400537) Mitochon...    33   0.84 
Sklu_2077.4 YOR007C, Contig c2077 4462-5433 reverse complement         32   1.1  
ACR005W [1053] [Homologous to ScYOR007C (SGT2) - SH] complement(...    32   1.2  
KLLA0B03520g 317409..321614 similar to sp|P17883 Saccharomyces c...    32   1.6  
YHR117W (TOM71) [2405] chr8 (342351..344270) Minor import recept...    32   2.0  
Kwal_33.14767                                                          32   2.0  
CAGL0L04048g 474410..476173 similar to sp|P07213 Saccharomyces c...    32   2.0  
KLLA0B10912g 955948..957486 similar to sp|P53043 Saccharomyces c...    32   2.1  
CAGL0J09570g complement(939447..941096) some similarities with s...    32   2.2  
Sklu_1876.2 YOL145C, Contig c1876 732-4004                             32   2.2  
YBR055C (PRP6) [245] chr2 complement(344562..347261) U4/U6.U5 tr...    32   2.4  
YOR007C (SGT2) [4822] chr15 complement(338938..339978) Protein c...    31   2.7  
YDR244W (PEX5) [1078] chr4 (950555..952393) Peroxisomal protein ...    31   3.3  
ADL177C [1564] [Homologous to ScYNL313C - SH] (383369..386086) [...    31   4.3  
Scas_589.5                                                             31   4.4  
CAGL0G10087g 962823..967058 similar to sp|P17883 Saccharomyces c...    30   5.7  
CAGL0I09702g complement(925113..926678) similar to tr|Q08777 Sac...    30   5.9  
ACR173W [1220] [Homologous to ScYJR088C - SH] complement(657718....    30   6.4  
CAGL0K05599g 544932..547064 similar to tr|Q08496 Saccharomyces c...    30   7.4  
Scas_721.64                                                            30   7.8  
Kwal_55.22039                                                          30   8.9  

>ACR168W [1215] [Homologous to ScYKL022C (CDC16) - SH]
           complement(650615..652738) [2124 bp, 707 aa]
          Length = 707

 Score = 1395 bits (3610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 670/694 (96%), Positives = 670/694 (96%)

Query: 1   MSTGNTPSQHESTLAISPFVTNRGRSQQEQRRVMMPSTGEDSLGPSGMADSGTHTPRNSV 60
           MSTGNTPSQHESTLAISPFVTNRGRSQQEQRRVMMPSTGEDSLGPSGMADSGTHTPRNSV
Sbjct: 1   MSTGNTPSQHESTLAISPFVTNRGRSQQEQRRVMMPSTGEDSLGPSGMADSGTHTPRNSV 60

Query: 61  VHSPLVQKTQLGTPYMAEGAATGGLLGSMSKTALFGPAVPSTLRKVSNVREYRRPXXXXX 120
           VHSPLVQKTQLGTPYMAEGAATGGLLGSMSKTALFGPAVPSTLRKVSNVREYRRP     
Sbjct: 61  VHSPLVQKTQLGTPYMAEGAATGGLLGSMSKTALFGPAVPSTLRKVSNVREYRRPGDSDG 120

Query: 121 XXXXXXXVDLAELSAAEKLRLWRHDALMQHHYRTAEYIGDKVYSMTRDPNDAFWLAQVYY 180
                  VDLAELSAAEKLRLWRHDALMQHHYRTAEYIGDKVYSMTRDPNDAFWLAQVYY
Sbjct: 121 EGGEGYGVDLAELSAAEKLRLWRHDALMQHHYRTAEYIGDKVYSMTRDPNDAFWLAQVYY 180

Query: 181 NMGQYIRAVELLSRDGLDASSVMCRYLTALCLVKMEKYDDALDIVGEVNPFKDDSAEHVR 240
           NMGQYIRAVELLSRDGLDASSVMCRYLTALCLVKMEKYDDALDIVGEVNPFKDDSAEHVR
Sbjct: 181 NMGQYIRAVELLSRDGLDASSVMCRYLTALCLVKMEKYDDALDIVGEVNPFKDDSAEHVR 240

Query: 241 NLDGGIKLESSLCYLRGEIYSAQNNLDLAKECFKEAVCVDVKNFEAFDRLISNNMLTPDE 300
           NLDGGIKLESSLCYLRGEIYSAQNNLDLAKECFKEAVCVDVKNFEAFDRLISNNMLTPDE
Sbjct: 241 NLDGGIKLESSLCYLRGEIYSAQNNLDLAKECFKEAVCVDVKNFEAFDRLISNNMLTPDE 300

Query: 301 ETEFIARLDFTDLDDNQELIRCLYSTKLSKYGDLTKLKAAHRFLLDEYHLEDNKDVQTTE 360
           ETEFIARLDFTDLDDNQELIRCLYSTKLSKYGDLTKLKAAHRFLLDEYHLEDNKDVQTTE
Sbjct: 301 ETEFIARLDFTDLDDNQELIRCLYSTKLSKYGDLTKLKAAHRFLLDEYHLEDNKDVQTTE 360

Query: 361 IELLIFQGKYXXXXXXXXXXXXQDEFNFDVLPTYVQCLYELGGKNKLFLVSHKLAESFPK 420
           IELLIFQGKY            QDEFNFDVLPTYVQCLYELGGKNKLFLVSHKLAESFPK
Sbjct: 361 IELLIFQGKYLECLELCEKVLEQDEFNFDVLPTYVQCLYELGGKNKLFLVSHKLAESFPK 420

Query: 421 SSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYS 480
           SSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYS
Sbjct: 421 SSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYS 480

Query: 481 TAARFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDY 540
           TAARFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDY
Sbjct: 481 TAARFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDY 540

Query: 541 PRAKKFFKRACEAINMQQSDASSVAISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSA 600
           PRAKKFFKRACEAINMQQSDASSVAISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSA
Sbjct: 541 PRAKKFFKRACEAINMQQSDASSVAISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSA 600

Query: 601 NVWCALATVYLKMKKLQKAIDALHSVLAMEPNHQTGQQLLKIALDVNVHLPLDNGHPLMV 660
           NVWCALATVYLKMKKLQKAIDALHSVLAMEPNHQTGQQLLKIALDVNVHLPLDNGHPLMV
Sbjct: 601 NVWCALATVYLKMKKLQKAIDALHSVLAMEPNHQTGQQLLKIALDVNVHLPLDNGHPLMV 660

Query: 661 SAKISENMKMSSNDKKRSLGNIDPVVIAKRLKQG 694
           SAKISENMKMSSNDKKRSLGNIDPVVIAKRLKQG
Sbjct: 661 SAKISENMKMSSNDKKRSLGNIDPVVIAKRLKQG 694

>Sklu_2380.6 YKL022C, Contig c2380 14352-16676 reverse complement
          Length = 774

 Score =  891 bits (2303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/710 (62%), Positives = 528/710 (74%), Gaps = 21/710 (2%)

Query: 1   MSTGNTPSQHESTLAISPFVTNRGRSQQEQRRVMMPSTGEDSLGPSGMADSGTHTPRNSV 60
           MSTGNTPSQH STLAISP VT R     ++             G    A S   TP + V
Sbjct: 54  MSTGNTPSQHNSTLAISPLVTKRTSLHGQKNSQQQHQQLRRWCG----ATSTAQTPHHPV 109

Query: 61  VHSPLVQKTQ----LGTPYMAEG-AATGGLLGSMSKTALFGPAVPSTLRKVSNVREYRRP 115
            +SPL+QK Q    L TP    G  +T GLL SMSK+ LFGPAVPSTLRK+S  R +   
Sbjct: 110 TNSPLIQKIQNPTSLATPAPPAGDGSTAGLLASMSKSGLFGPAVPSTLRKISVTRSFDGQ 169

Query: 116 XXXXXXXXXX----------XXVDLAELSAAEKLRLWRHDALMQHHYRTAEYIGDKVYSM 165
                                 +D++ LS AEKLRLWRHDALMQHHYRTAEYIGDKVYS+
Sbjct: 170 TSAKDDSNSELDDNLEVISGATIDISTLSPAEKLRLWRHDALMQHHYRTAEYIGDKVYSI 229

Query: 166 TRDPNDAFWLAQVYYNMGQYIRAVELLSRDGLDASSVMCRYLTALCLVKMEKYDDALDIV 225
           TRDPNDAFWLAQVYYN G YIRAVELLSRDGLD SSVMCRYLTALCL+KMEKYDDALDIV
Sbjct: 230 TRDPNDAFWLAQVYYNNGSYIRAVELLSRDGLDTSSVMCRYLTALCLIKMEKYDDALDIV 289

Query: 226 GEVNPFKDDSAEHVRNLDGGIKLESSLCYLRGEIYSAQNNLDLAKECFKEAVCVDVKNFE 285
           GE NPFKD SA+HV+N DGGIKLESSLCYLRG+IYSAQNN + AK+ FKEAV VDVKNFE
Sbjct: 290 GESNPFKDVSAQHVKNQDGGIKLESSLCYLRGKIYSAQNNFEKAKQSFKEAVQVDVKNFE 349

Query: 286 AFDRLISNNMLTPDEETEFIARLDFTDLDDNQELIRCLYSTKLSKYGDLTKLKAAHRFLL 345
           AFD LISNN+LTP++E EF++ LDF+DLDDN+ELI+ LY+TKLSKY +L ++  A  +L+
Sbjct: 350 AFDELISNNLLTPNQEWEFLSTLDFSDLDDNEELIKSLYTTKLSKYLNLDQISEAREYLI 409

Query: 346 DEYHLEDNKDVQTTEIELLIFQGKYXXXXXXXXXXXXQDEFNFDVLPTYVQCLYELGGKN 405
           +EY+LEDN D+  +EI+    Q K+            +DEFNF VLPTY+ CLYELGGKN
Sbjct: 410 NEYNLEDNTDLIRSEIDTFFTQCKFSKCLCLCEQVLERDEFNFYVLPTYIACLYELGGKN 469

Query: 406 KLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHT 465
           KLFLVSHKLAE+FPKS VTW  VGTYY SIN + EARKYFSKAS+LDPNFG AW+GFAHT
Sbjct: 470 KLFLVSHKLAENFPKSPVTWLGVGTYYLSINKVAEARKYFSKASILDPNFGQAWIGFAHT 529

Query: 466 YAVEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICPTDPL 525
           YA EGEHEQA+SAYSTA+RFFPGTHLP+L+LGMQY  M+TL+LAEEY  +AYDICP DPL
Sbjct: 530 YAAEGEHEQAVSAYSTASRFFPGTHLPNLFLGMQYIVMNTLSLAEEYLTLAYDICPHDPL 589

Query: 526 LLNELGVVYFKKMDYPRAKKFFKRACEAINMQQSDASSVAISTYLNLGHTYRKLDEDERA 585
           LLNE+GV+YFKK DYP+AKK+FK+A EA     SD S   +S + NLGHTYRK+ + ERA
Sbjct: 590 LLNEMGVIYFKKSDYPKAKKYFKKAWEASKRLNSD-SKAWLSIHTNLGHTYRKMGDYERA 648

Query: 586 LHCFKTVLERWKPSANVWCALATVYLKMKKLQKAIDALHSVLAMEPNHQTGQQLLKIALD 645
           + CFK VLE      +V+CA+  +YLK++K++KAID+LH+ LA++P++Q  Q LLK AL+
Sbjct: 649 VACFKIVLETSNQDTSVYCAIGLIYLKLRKIEKAIDSLHNALALQPSNQIAQDLLKQALE 708

Query: 646 VNVHLPLDNGHPLMVSAKISENM-KMSSNDKKRSLGNIDPVVIAKRLKQG 694
           VN+   LD  HPL+VS+KI+E+      N KKR L N     IAKRL QG
Sbjct: 709 VNMCTVLDETHPLVVSSKINESASNYFPNSKKRDLVNQSAAKIAKRLIQG 758

>Kwal_14.874
          Length = 722

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/714 (58%), Positives = 510/714 (71%), Gaps = 27/714 (3%)

Query: 1   MSTGNTPSQHESTLAISPFVTNRGRSQQEQRRVMMPSTGEDSLGPSGMADSGTHTPRNSV 60
           MS GNTPSQH STLAISP V +R     + R     S+     G    A     TP +SV
Sbjct: 1   MSRGNTPSQHNSTLAISPLVGSRTLQGPQHRNQTNASSTRQWSGEHRTA----QTPHHSV 56

Query: 61  VHSPLVQKTQ----LGTPY-MAEGAATGGLLGSMSKTALFGPAVPSTLRKVSNVREYRR- 114
            +SPLVQK Q    L TP  + +  +T GLL SM+K  LFGP +PSTLRKVS V + RR 
Sbjct: 57  TYSPLVQKIQNNASLATPAPVQDHGSTAGLLASMTKNGLFGPQIPSTLRKVSIVGDSRRH 116

Query: 115 -------------PXXXXXXXXXXXXVDLAELSAAEKLRLWRHDALMQHHYRTAEYIGDK 161
                        P            +D+A+L AAEKLRLWRHD+LMQH YRTAE++GDK
Sbjct: 117 PGSSSGAGGDITDPNAQLDSDHVISAIDIAQLPAAEKLRLWRHDSLMQHQYRTAEFLGDK 176

Query: 162 VYSMTRDPNDAFWLAQVYYNMGQYIRAVELLSRDGLDASSVMCRYLTALCLVKMEKYDDA 221
           VY+MT DPNDAFWLAQVYYN G YIRAVELLSR+ LD SSVMCRYLTALCL++++KY+DA
Sbjct: 177 VYAMTGDPNDAFWLAQVYYNSGSYIRAVELLSRNNLDTSSVMCRYLTALCLIQLKKYEDA 236

Query: 222 LDIVGEVNPFKDDSAEHVRNLDGGIKLESSLCYLRGEIYSAQNNLDLAKECFKEAVCVDV 281
           LDIVGE NPF+D    HV+N DGGIKLESS+CYLRG+I+SA N+ D AK+  KEAV VDV
Sbjct: 237 LDIVGETNPFRDPLGSHVKNQDGGIKLESSMCYLRGKIFSALNDFDKAKDSLKEAVLVDV 296

Query: 282 KNFEAFDRLISNNMLTPDEETEFIARLDFTDLDDNQELIRCLYSTKLSKYGDLTKLKAAH 341
           KNFEAFD LIS N+LTP EE  FIA LDFTDLDDN++LIR LY ++LSKY +L ++  AH
Sbjct: 297 KNFEAFDELISKNLLTPSEEWAFIASLDFTDLDDNEDLIRSLYVSRLSKYLNLDQVFKAH 356

Query: 342 RFLLDEYHLEDNKDVQTTEIELLIFQGKYXXXXXXXXXXXXQDEFNFDVLPTYVQCLYEL 401
            FL +EY L  N D+  ++ + L  Q K+            +DEFNF +LP ++ CLYEL
Sbjct: 357 DFLNEEYKLSSNTDLIHSKADTLFTQCKFSDCLKLCEEALEKDEFNFSILPIFISCLYEL 416

Query: 402 GGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLG 461
           GGKNKLFL+SHK+AE+FPK  +TWF VG YY   N + EARKYFSKAS+LDP+F  AW+G
Sbjct: 417 GGKNKLFLISHKMAENFPKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIG 476

Query: 462 FAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICP 521
           FAHTYAVEGEHEQA+SAYSTA+RFFPGTHLP+L+LGMQY  M TL LAEEYF++AYD+CP
Sbjct: 477 FAHTYAVEGEHEQAISAYSTASRFFPGTHLPNLFLGMQYLIMGTLPLAEEYFVLAYDVCP 536

Query: 522 TDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINMQQSDASSVAISTYLNLGHTYRKLDE 581
            DPLLLNE+GV+YFKK DY +AKK+ K+A EAI    S++ S  +S + NL HTYRKL E
Sbjct: 537 YDPLLLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSW-VSIHTNLAHTYRKLGE 595

Query: 582 DERALHCFKTVLERWKPSANVWCALATVYLKMKKLQKAIDALHSVLAMEPNHQTGQQLLK 641
           +E+A+ CFK VLE      +  CAL  VYL+M +++KAIDALH  LA+ P++Q  Q LLK
Sbjct: 596 NEKAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRPSNQAAQDLLK 655

Query: 642 IALDVNVHLPLDNGHPLMVSAKIS-ENMKMSSNDKKRSLGNIDPVVIAKRLKQG 694
            ALDVN+   LD+ HPL++S+K+  +N  + S  +KR+   +D   IAKRLK G
Sbjct: 656 QALDVNMSTILDDSHPLVISSKLQDQNSDVVS--RKRAANRVDVRDIAKRLKHG 707

>KLLA0E07986g 720700..722865 similar to sp|P09798 Saccharomyces
           cerevisiae YKL022c CDC16 subunit of anaphase-promoting
           complex (cyclosome) singleton, start by similarity
          Length = 721

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/710 (55%), Positives = 502/710 (70%), Gaps = 21/710 (2%)

Query: 2   STGNTPSQHESTLAISPFVTNRG--RSQQEQRRVMMPSTGEDSLGPSGMADSGTHTPRNS 59
           S+ +TPS  +STLAISP V   G  R    +   +  S G +  G          TP   
Sbjct: 3   SSHDTPSHVQSTLAISPLVQRTGANRGSMNRNDPIGNSQGRNVEGGRSNIPQIAQTPHQD 62

Query: 60  VVHSPLVQK----TQLGTPYMAE--GAATGGLLGSMSKTALFGPAVPSTLRKVSN----V 109
              SPLVQK    + L TP +    G A   LL SM+K  LFGPA+PSTLRK S     V
Sbjct: 63  --RSPLVQKIRDVSHLATPAVMRHNGTAGSSLLASMTKNGLFGPALPSTLRKTSTSTDTV 120

Query: 110 REYRRPXXXXXXXXXXXXVDLAELSAAEKLRLWRHDALMQHHYRTAEYIGDKVYSMTRDP 169
                              D+++LS+ EKLRLWRHDALMQHHY+TAE+IGD +YSMT+DP
Sbjct: 121 ELNNSTNDEDIDHASDNVFDVSDLSSVEKLRLWRHDALMQHHYKTAEHIGDLIYSMTKDP 180

Query: 170 NDAFWLAQVYYNMGQYIRAVELLSRDGLDASSVMCRYLTALCLVKMEKYDDALDIVGEVN 229
           NDAFWLAQVYYN G Y+RAVEL+  D LD+ S+MCRYL ALCL K+ K ++ALDI+G+ N
Sbjct: 181 NDAFWLAQVYYNQGSYVRAVELIFTDQLDSESIMCRYLAALCLFKLNKLEEALDIIGDTN 240

Query: 230 PFKDDSAEHVRNLDGGIKLESSLCYLRGEIYSAQNNLDLAKECFKEAVCVDVKNFEAFDR 289
           PF+ + +    N DGG+KLESS+C LRG IY + +N++ AKECFKEAV VDVKN+EAFD 
Sbjct: 241 PFQSEPSS-PGNADGGVKLESSMCLLRGRIYVSLSNMEQAKECFKEAVQVDVKNYEAFDY 299

Query: 290 LISNNMLTPDEETEFIARLDFTDLDDNQELIRCLYSTKLSKYGDLTKLKAAHRFLLDEYH 349
           L+S +MLT  E+ + +  L F DLDDN+E++RCLY ++LSKY   T+++ A + L D+Y+
Sbjct: 300 LLSKHMLTTAEQWDLVRSLQFDDLDDNEEMMRCLYISRLSKYQHQTEIEHARKVLSDKYY 359

Query: 350 LEDNKDVQTTEIELLIFQGKYXXXXXXXXXXXXQDEFNFDVLPTYVQCLYELGGKNKLFL 409
           L+DN+ V   EIELL  Q K+             DE+N +VLP Y+QCL+    KNKLFL
Sbjct: 360 LKDNRTVLLAEIELLNNQSKFTQCMKLCEQVLEVDEYNLEVLPIYIQCLHSFAAKNKLFL 419

Query: 410 VSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVE 469
           +SHKLAE+FPKS VTWFAV TYY  +  ++EARKYFS++S++DP+FGY+WLGFAHTY  E
Sbjct: 420 LSHKLAENFPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAE 479

Query: 470 GEHEQALSAYSTAARFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNE 529
           GEHEQALSAYSTAARFFPGTHLPHLYLGMQY+RMD L+LAEEYFMMAYD+CPTDPLLLNE
Sbjct: 480 GEHEQALSAYSTAARFFPGTHLPHLYLGMQYNRMDDLSLAEEYFMMAYDMCPTDPLLLNE 539

Query: 530 LGVVYFKKMDYPRAKKFFKRACEAINMQQSDASSVAISTYLNLGHTYRKLDEDERALHCF 589
           LGV+YFK+ +Y +AKK+ KRA +AI   +S+ S   IS  +NLGHTYRKL EDERA+ CF
Sbjct: 540 LGVIYFKRQNYIKAKKYMKRAHDAIKNMKSE-SKAWISIVINLGHTYRKLGEDERAIKCF 598

Query: 590 KTVLERWKPSANVWCALATVYLKMKKLQKAIDALHSVLAMEPNHQTGQQLLKIALDVNVH 649
           KTVLE  KP+A +WC+L  +YL+MKK++KAID+ H  LA++  +Q   +LLK AL++N H
Sbjct: 599 KTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALDQGNQASNKLLKTALEINAH 658

Query: 650 LPLDNGHPLMVSAKISE--NMKMSSNDKKR-SLG--NIDPVVIAKRLKQG 694
           + +D  HP+++S+ I       +S NDKKR SLG  + DPV  AKRLKQG
Sbjct: 659 MIIDENHPMVISSNIQNIPTSHVSKNDKKRTSLGITSFDPVTEAKRLKQG 708

>Scas_685.10
          Length = 760

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/738 (49%), Positives = 484/738 (65%), Gaps = 51/738 (6%)

Query: 2   STGNTPSQHESTLAISPFVTNRGRSQQEQRRVMMPSTG-------EDSLGPSGMADSGTH 54
           S   TPSQH ST+AISPFV NR RS+    R+  P+T         + L  S        
Sbjct: 6   SPNQTPSQHNSTIAISPFVGNRTRSRLPTHRIH-PATNAQRENPLSNQLNQSWNRTVSGQ 64

Query: 55  TPRNSVVHSPLVQKTQ-------LGTPYMAEGAA---------TGGLLGSMSKTALFGPA 98
           +P  S+ +SPLVQKT        L TP+                  LL S+SK  +FG  
Sbjct: 65  SPYRSLANSPLVQKTNPSIITASLTTPHQKNTGTIPTNLNANPNSSLLASLSKGNVFGST 124

Query: 99  VPSTLRKVS-----NVREYRRPXXXXXXXXXXX--------------XVDLAELSAAEKL 139
           + S+LRKVS     N+ E                              +DL+EL++ E+L
Sbjct: 125 ISSSLRKVSIQPNSNIPETNTKDENMSNEINKATTTTLTTNTTIVSPEIDLSELTSIERL 184

Query: 140 RLWRHDALMQHHYRTAEYIGDKVYSMTRDPNDAFWLAQVYYNMGQYIRAVELLSRDGLDA 199
           RLWRHDALMQH YRTAEYIG+K+Y++T DPNDAFWLAQVYYN  ++IRA++LL++D L++
Sbjct: 185 RLWRHDALMQHMYRTAEYIGNKIYTITEDPNDAFWLAQVYYNNNEFIRAIDLLTKDNLES 244

Query: 200 SSVMCRYLTALCLVKMEKYDDALDIVGEVNPFKDDSAEHVRNL--DGGIKLESSLCYLRG 257
            +++CRYL  LCL K+++YDDALD+V E+NPF D   +    +  DGGIK+ESSLCYLRG
Sbjct: 245 LNIICRYLMGLCLFKLQRYDDALDVVDELNPFSDSKQDSDPTIAPDGGIKVESSLCYLRG 304

Query: 258 EIYSAQNNLDLAKECFKEAVCVDVKNFEAFDRLISNNMLTPDEETEFIARLDFTDLDDNQ 317
            I++AQNNL  AK  FKEAV VDVKN+EAF+ LIS N+++P+EE + +  LDF+ L DN+
Sbjct: 305 LIFAAQNNLKKAKTAFKEAVLVDVKNYEAFESLISKNLISPEEEWDLLLSLDFSTLGDNE 364

Query: 318 ELIRCLYSTKLSKYGDLTKLKAAHRFLLDEYHLEDNKDVQTTEIELLIFQGKYXXXXXXX 377
           E+IR LY+  +SKY      K A + L DEY L +N D+   +IE L  Q K+       
Sbjct: 365 EMIRYLYTLNVSKYIHQDVSKTAKQSLSDEYGLSNNIDILRYQIETLYSQCKFSECLEAC 424

Query: 378 XXXXXQDEFNFDVLPTYVQCLYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINN 437
                 DE+N  +LPTY+ CLYE  GKNKLFL+SH LAE FPKS++TWF+V TYY +I +
Sbjct: 425 EKALDGDEYNPTILPTYISCLYEQNGKNKLFLLSHNLAEKFPKSAITWFSVATYYMAIED 484

Query: 438 ITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLG 497
           + +ARKYFSKAS+LDP+F  AWLGFAHTY +EGEH+QALSAY+TAARFFPG H+P+L+LG
Sbjct: 485 VPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPNLFLG 544

Query: 498 MQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINMQ 557
           M+Y   +TL+LAEEYF +AYD C  DPLLLNE+GV+YFKK +  ++K++ K+A EA+   
Sbjct: 545 MEYMATNTLSLAEEYFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEAVR-N 603

Query: 558 QSDASSVAISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMKKLQ 617
            S  S++ IS  +NL HTYRKL E ERA+ CFK VLE     A V+CAL  +YLK K+L 
Sbjct: 604 SSGTSTIVISIQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTKRLG 663

Query: 618 KAIDALHSVLAMEPNHQTGQQLLKIALDVNVHLPLDNGHPLMVSAKISENMKMSSNDKKR 677
           KAID LH  LA++P++ + Q+LL  AL++N  + LD  HPL+++A++  N +     KKR
Sbjct: 664 KAIDYLHESLALKPSNTSAQELLLHALELNASIVLDENHPLVMNAELYSNNEDKLIQKKR 723

Query: 678 SLGNI---DPVVIAKRLK 692
             GNI   +   ++K++K
Sbjct: 724 --GNISSTEAASMSKKMK 739

>YKL022C (CDC16) [3233] chr11 complement(394369..396891) Component
           of anaphase-promoting complex (APC), required for Clb2p
           degradation and for the metaphase-anaphase transition
           [2523 bp, 840 aa]
          Length = 840

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/768 (46%), Positives = 488/768 (63%), Gaps = 84/768 (10%)

Query: 1   MSTGNTPSQHESTLAISPFVTNRGRSQQEQRRVMMPSTGEDSL--GPSGMADSGTHTPRN 58
           MS     SQH STLA SPFV+N   ++ +Q    +P+  ++     P    ++ T +P  
Sbjct: 43  MSPSEQHSQHNSTLAASPFVSNVSAARTQQS---LPTDAQNDRLQQPWNRTNTAT-SPYQ 98

Query: 59  SVVHSPLVQKTQ--LGTPYMAEGAA-------TGG------LLGSMSKTALFGPAVPSTL 103
           S+ +SPL+QK Q  + TP+     +       TG       LL SMSK ++FG  +PSTL
Sbjct: 99  SLANSPLIQKLQANIMTPHQPSANSNSNSNSITGNVVNDNNLLASMSKNSMFGSTIPSTL 158

Query: 104 RKVSNVREYRRPX---------------------------------------XXXXXXXX 124
           RKVS  REY+                                                  
Sbjct: 159 RKVSLQREYKDSVDGVVRDEDNDEDVHNNGDAAANANNDRESKLGHNGPLTTTTLTTTTT 218

Query: 125 XXXVDLAELSAAEKLRLWRHDALMQHHYRTAEYIGDKVYSMTRDPNDAFWLAQVYYNMGQ 184
              +D++ELSA E+LRLWR DALMQH YRTAEYI DKVY+++ DP+DAFWL QVYYN  Q
Sbjct: 219 ATQLDVSELSAIERLRLWRFDALMQHMYRTAEYIADKVYNISNDPDDAFWLGQVYYNNNQ 278

Query: 185 YIRAVELLSRDGLDASSVMCRYLTALCLVKMEKYDDALDIVGEVNPFKDDSAEHVRNL-- 242
           Y+RAVEL++R+ LD  +++CRYL  L  VK++++DDALD++GE NPF +D +    N   
Sbjct: 279 YVRAVELITRNNLDGVNILCRYLLGLSFVKLQRFDDALDVIGEYNPFSEDPSTTAANTMS 338

Query: 243 -------------DGGIKLESSLCYLRGEIYSAQNNLDLAKECFKEAVCVDVKNFEAFDR 289
                        DGGIK+ESSLC+LRG+IY AQNN + A++ F+EA+ VD+KNFEAF+ 
Sbjct: 339 NNGNNSNTSQPVTDGGIKMESSLCFLRGKIYFAQNNFNKARDAFREAILVDIKNFEAFEM 398

Query: 290 LISNNMLTPDEETEFIARLDFTDLDDNQELIRCLYSTKLSKYGDLTKLKAAHRFLLDEYH 349
           L+S N+LTP EE +    LDF +  +++E+++ LY   LSKY +   +  ++  L  +Y 
Sbjct: 399 LLSKNLLTPQEEWDLFDSLDFKEFGEDKEIMKNLYKINLSKYINTEDITKSNEILAKDYK 458

Query: 350 LEDNKDVQTTEIELLIFQGKYXXXXXXXXXXXXQDEFNFDVLPTYVQCLYELGGKNKLFL 409
           L DN DV  +++++   Q K+             DEFN ++LP Y+ CLYEL  KNKLFL
Sbjct: 459 LADNVDVVRSKVDICYTQCKFNECLELCETVLENDEFNTNILPAYIGCLYELSNKNKLFL 518

Query: 410 VSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVE 469
           +SH+LAE+FPKS++TWF+V TYY S++ I+EA+KY+SK+S+LDP+F  AWLGFAHTYA+E
Sbjct: 519 LSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALE 578

Query: 470 GEHEQALSAYSTAARFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNE 529
           GE +QAL+AYSTA+RFFPG HLP L+LGMQ+  M++L LAE YF++AYDICP DPL+LNE
Sbjct: 579 GEQDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNE 638

Query: 530 LGVVYFKKMDYPRAKKFFKRACEAINMQQSDASSVAISTYLNLGHTYRKLDEDERALHCF 589
           +GV+YFKK ++ +AKK+ K+A E +      +S   IS  LNLGHTYRKL+E+E A+ CF
Sbjct: 639 MGVMYFKKNEFVKAKKYLKKALEVVK-DLDPSSRTTISIQLNLGHTYRKLNENEIAIKCF 697

Query: 590 KTVLERWKPSANVWCALATVYLKMKKLQKAIDALHSVLAMEPNHQTGQQLLKIALDVNVH 649
           + VLE+   ++ + C+L  +YLK KKLQKAID LH  L ++PN+ +   LLK AL++NV 
Sbjct: 698 RCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKPNNSSATALLKNALELNVT 757

Query: 650 LPLDNGHPLMVSAKISENMKMSSND-----KKRSLGNIDPVVIAKRLK 692
           L LD  HPL+  + +   M  +S D     KKRS    DPV +AKRL+
Sbjct: 758 LSLDASHPLIDKSNL---MSQASKDKASLNKKRSSLTYDPVNMAKRLR 802

>CAGL0L09823g 1050447..1052678 some similarities with sp|P09798
           Saccharomyces cerevisiae YKL022c CDC16, hypothetical
           start
          Length = 743

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/552 (49%), Positives = 390/552 (70%), Gaps = 4/552 (0%)

Query: 128 VDLAELSAAEKLRLWRHDALMQHHYRTAEYIGDKVYSMTRDPNDAFWLAQVYYNMGQYIR 187
           +D+A++   E+L+LWRHDA +QH Y TAE++  K+Y+MT D NDAFWLA +YY+MG + R
Sbjct: 160 IDIAKIPLIERLQLWRHDAWIQHLYGTAEFVATKIYTMTGDANDAFWLALIYYSMGSHNR 219

Query: 188 AVELLSRDGLDASSVMCRYLTALCLVKMEKYDDALDIVGEVNPFKDDSAEHVR-NLDGGI 246
            +ELL++D + + S++CRYL A C + ++ YDDALDIVGE NPF D +    R   DGGI
Sbjct: 220 CIELLTKDDIISVSIVCRYLLARCYIDVKNYDDALDIVGETNPFADTAEASARIESDGGI 279

Query: 247 KLESSLCYLRGEIYSAQNNLDLAKECFKEAVCVDVKNFEAFDRLISNNMLTPDEETEFIA 306
           KLESS+C+LRG+IY AQN+   AKE FKEAV VD KNFEA+ +L+ +++LT +EE E + 
Sbjct: 280 KLESSMCFLRGKIYVAQNDFSRAKEAFKEAVLVDPKNFEAYRQLVDSHLLTTNEEWELLD 339

Query: 307 RLDFTDLDDNQELIRCLYSTKLSKYGDLTKLKAAHRFLLDEYHLEDNKDVQTTEIELLIF 366
            LDF  L D+  L++ LY+ +LSK  +  ++  A   L  +Y L D+ D+ T++I++L  
Sbjct: 340 SLDFDSLGDDSILVKSLYTLELSKNQNQDRITEAQDILRQDYDLADDIDIVTSDIDILFN 399

Query: 367 QGKYXXXXXXXXXXXXQDEFNFDVLPTYVQCLYELGGKNKLFLVSHKLAESFPKSSVTWF 426
           Q K+            +D+FN  +LPTY+ CLYE+   NKLFL++H+LAE  P++ +TW+
Sbjct: 400 QCKFSQCLNVCELMLKRDQFNNKILPTYISCLYEVKSSNKLFLLAHELAEKDPRNCITWY 459

Query: 427 AVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFF 486
            V TYY  ++ I EARKYFSK+S++DP F  AWLGFAHT+A+EGE +QA+SAYSTAARFF
Sbjct: 460 CVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQAISAYSTAARFF 519

Query: 487 PGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKF 546
           PG  LP+L+LGMQY   +TLTLAEEYF +AY+  P DP++LNE+GV+ FKK +  +AK++
Sbjct: 520 PGMSLPNLFLGMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRY 579

Query: 547 FKRACEAI-NMQQSDASSVAISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCA 605
            K+A E   +M++S  S   +S  +NL HTYR+L E+E+A+     +LE  + S+ ++C+
Sbjct: 580 LKKAAECCKDMERS--SKTVLSVQINLSHTYRRLGENEKAIKYLTNILEDTENSSEIYCS 637

Query: 606 LATVYLKMKKLQKAIDALHSVLAMEPNHQTGQQLLKIALDVNVHLPLDNGHPLMVSAKIS 665
           L  +YLK  +LQKAIDALH VLA+ P + + Q+LL  AL++NV L LD  HPL+V++ I 
Sbjct: 638 LGFLYLKTNQLQKAIDALHRVLAINPGNSSAQKLLNYALELNVTLELDENHPLVVNSNIL 697

Query: 666 ENMKMSSNDKKR 677
           +    +S   KR
Sbjct: 698 DEEHSASKIGKR 709

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 44/92 (47%), Gaps = 25/92 (27%)

Query: 30  QRRVMMPSTGEDSLGPSGMADSGTHTPRNSVVHSPLVQK---TQLGTP------YMAEGA 80
           QRRV+          P G A       R+ ++ SPLVQK     L TP        +   
Sbjct: 13  QRRVV---------SPVGAA-------RSPLLTSPLVQKYAGASLATPRKHLGASNSNNG 56

Query: 81  ATGGLLGSMSKTALFGPAVPSTLRKVSNVREY 112
             G LL SMSK ++ G  +PSTLRKVS  RE+
Sbjct: 57  NNGSLLASMSKNSMLGSTIPSTLRKVSLQREF 88

>AGL294W [4018] [Homologous to ScYBL084C (CDC27) - SH]
           complement(154711..156681) [1971 bp, 656 aa]
          Length = 656

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 71/257 (27%), Positives = 113/257 (43%), Gaps = 19/257 (7%)

Query: 393 TYVQCLYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSIN-NITEARKYFSKASVL 451
            Y   L+ L  K +L  + H+L     K+ +TW  +G   FS+N +  EA K   KA+ L
Sbjct: 409 VYSTLLWHLHDKIRLADLCHELMAQDDKNCITWCCLGNL-FSLNRDHDEAIKALKKATSL 467

Query: 452 DPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYSRMDTLTLAEE 511
           +P F YA+    H Y+     + A   Y  A    P  +  H  LGM   ++     A  
Sbjct: 468 NPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQYDEALL 527

Query: 512 YFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINMQQSDASSVAISTYL- 570
           +F  A  I P + +L    GV   +     +A  F++ ACE   +Q + + ++   + L 
Sbjct: 528 HFEKARSINPVNVILNCCCGVALERLGRREKALDFYQLACE---LQPNSSLALFKKSQLL 584

Query: 571 -NLGHTYRKLDEDERALHCFKTVLERWKPS-ANVWCALATVYLKMKKLQKAIDALHSVLA 628
            NLG     L   E+        LE+  P+ A V   L  +Y  + + + AI      + 
Sbjct: 585 FNLGQYSNALQNFEK--------LEQLTPNEAPVHFLLGQLYQIVGRKKDAITQFTIAMN 636

Query: 629 MEPNHQTGQQLLKIALD 645
           ++PN   G QL+K AL+
Sbjct: 637 LDPN---GIQLVKEALE 650

>Scas_599.5
          Length = 809

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 71/264 (26%), Positives = 113/264 (42%), Gaps = 31/264 (11%)

Query: 391 LPTYVQCLYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASV 450
           L T+   L+ L  K  L  +S+ L + F     TW AVG  +    +  EA + F KA+ 
Sbjct: 559 LETFSTLLWHLHDKTNLTDLSNILMDEFRDKPETWCAVGNLFSLQKDHDEAIRAFDKATK 618

Query: 451 LDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGT-----HLPHLYLGMQYSRMDT 505
           LDPNF YA       Y ++G    ++ +Y TA  F+        H  + Y GM    M +
Sbjct: 619 LDPNFVYA-------YTLQGHEYLSMDSYDTAKTFYRKAISNDLHHYNAYYGMG---MCS 668

Query: 506 LTLAE-----EYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINMQQSD 560
           + L E      YF  A  I P++ +L+   GV   K  +  +A  +++ AC     Q   
Sbjct: 669 MKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELAC-----QIQP 723

Query: 561 ASSVAISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMKKLQKAI 620
            SS+A        H    + +  +AL  F+ +++     A V   L  +Y  M + + AI
Sbjct: 724 TSSLA---KFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQFILGQLYQIMGRKKDAI 780

Query: 621 DALHSVLAMEPNHQTGQQLLKIAL 644
                 + ++P    G  L+  AL
Sbjct: 781 KRYTIAMNLDPK---GSNLISDAL 801

>Kwal_27.10740
          Length = 628

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 108/260 (41%), Gaps = 11/260 (4%)

Query: 386 FNFDVLPTYVQCLYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYF 445
           F    +  +   L+ L     L  + H+L E    +  TW  +G  +    +  E+ K F
Sbjct: 374 FRLPDMEIFSTLLWHLNDTTGLSHLCHELLEVNRLAPETWCCIGNLFSLKKDHEESIKAF 433

Query: 446 SKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYSRMDT 505
            +++ LDP+F YA+    H Y+     + A++ Y  A       +  +  LGM   ++  
Sbjct: 434 QRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALASNSQHYNAYYGLGMCSLKLGQ 493

Query: 506 LTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINMQQSDASSVA 565
                 +F  A  I P + +L+   GV   K     RA + +  ACE   M     SS+A
Sbjct: 494 YEECLLHFEKARSINPVNVILICCCGVALEKLSHQERALQNYDLACELQPM-----SSLA 548

Query: 566 ISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMKKLQKAIDALHS 625
           +     L     K +    AL  F+ +++     A +   L  +Y  + + Q A+  L  
Sbjct: 549 LFKRAQLLLAMGKYN---YALESFEKLVKIAPDEATIHFLLGQLYQIVGRKQDAVKELTI 605

Query: 626 VLAMEPNHQTGQQLLKIALD 645
            + ++P    G QL+K AL+
Sbjct: 606 AMNLDPK---GSQLIKSALE 622

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 225 VGEVNPFKDDSAEHVRNLDGGIKLESSLCY---LRGEIYSAQNNLDLAKECFKEAVCVDV 281
           +G +   K D  E ++      +L+ S  Y   L+G  YS+ +  D A  C+++A+  + 
Sbjct: 416 IGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALASNS 475

Query: 282 KNFEAF 287
           +++ A+
Sbjct: 476 QHYNAY 481

>KLLA0B09262g 814303..817128 some similarities with sp|P14922
           Saccharomyces cerevisiae YBR112c CYC8 general repressor
           of transcription singleton, hypothetical start
          Length = 941

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 84/222 (37%), Gaps = 48/222 (21%)

Query: 419 PKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSA 478
           P S+    ++   Y S +    A + + +A   +P  G  W    H Y +  E + A +A
Sbjct: 139 PSSTNALTSLAHLYRSRDMFQRAAELYQRALSANPELGDIWATLGHCYLMLDELQNAYAA 198

Query: 479 YSTAARFFPGTHLPHLY--LGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFK 536
           Y  A       ++P L+  +G+ Y R  +L  AEE F    ++ P               
Sbjct: 199 YQQALYHLSNPNIPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPQ-------------- 244

Query: 537 KMDYPRAKKFFKRACEAINMQQSDASSVAISTYLNLGHTYRKLDEDERALHCFKTVLERW 596
                     F++A E                Y  LG  Y+   +  +AL CF+ +L   
Sbjct: 245 ----------FEKANE---------------IYFRLGIIYKHQGKWNQALECFRYILP-- 277

Query: 597 KPSA-----NVWCALATVYLKMKKLQKAIDALHSVLAMEPNH 633
           +P A     +VW  L +V   M + Q A DA   +++    H
Sbjct: 278 QPPAPLQEWDVWFQLGSVLESMGEWQGARDAYEHIISQNDRH 319

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/248 (20%), Positives = 91/248 (36%), Gaps = 33/248 (13%)

Query: 394 YVQCLYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDP 453
           Y Q LY L   N             PK    W  +G  Y    ++  A + F+K   LDP
Sbjct: 199 YQQALYHLSNPN------------IPK---LWHGIGILYDRYGSLDYAEEAFAKVLELDP 243

Query: 454 NFGYA---WLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLP------HLYLGMQYSRMD 504
            F  A   +      Y  +G+  QAL  +       P    P         LG     M 
Sbjct: 244 QFEKANEIYFRLGIIYKHQGKWNQALECFR---YILPQPPAPLQEWDVWFQLGSVLESMG 300

Query: 505 TLTLAEEYFMMAYDICPTDPLLLNELGVVY-FKKMDYPRAKKFFKRACEAINMQQSDASS 563
               A + +            +L +LG +Y    + +   +K      +++ +  +DA+S
Sbjct: 301 EWQGARDAYEHIISQNDRHAKVLQQLGCLYGMNNVSFYDPQKALNLLLKSLEIDSTDATS 360

Query: 564 VAISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMKKLQKAIDAL 623
                + +LG  +   ++   A   F+  + R   +   WC++  +Y ++ + + A+DA 
Sbjct: 361 -----WYHLGRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGVLYYQIAQYRDALDAY 415

Query: 624 HSVLAMEP 631
              + + P
Sbjct: 416 TRAIRLNP 423

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 56/131 (42%), Gaps = 14/131 (10%)

Query: 515 MAYDIC----PTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINMQQSDASSVAISTYL 570
           MAYD      P+    L  L  +Y  +  + RA + ++RA  A N +  D        + 
Sbjct: 129 MAYDATLQHNPSSTNALTSLAHLYRSRDMFQRAAELYQRALSA-NPELGD-------IWA 180

Query: 571 NLGHTYRKLDEDERALHCFKTVLERW-KPS-ANVWCALATVYLKMKKLQKAIDALHSVLA 628
            LGH Y  LDE + A   ++  L     P+   +W  +  +Y +   L  A +A   VL 
Sbjct: 181 TLGHCYLMLDELQNAYAAYQQALYHLSNPNIPKLWHGIGILYDRYGSLDYAEEAFAKVLE 240

Query: 629 MEPNHQTGQQL 639
           ++P  +   ++
Sbjct: 241 LDPQFEKANEI 251

>ADL344W [1396] [Homologous to ScYBR112C (CYC8) - SH]
           complement(103567..106299) [2733 bp, 910 aa]
          Length = 910

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 87/222 (39%), Gaps = 48/222 (21%)

Query: 419 PKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSA 478
           P S+    ++   Y S +    A + + +A  ++P  G  W    H Y +  + ++A +A
Sbjct: 93  PSSTKALTSLAHLYRSRDVFQRAAELYQRALAVNPELGDVWATLGHCYLMLDDLQRAYAA 152

Query: 479 YSTAARFFPGTHLPHLY--LGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFK 536
           Y  A       ++P L+  +G+ Y R  +L  AEE F    ++ P            +F+
Sbjct: 153 YQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDP------------HFE 200

Query: 537 KMDYPRAKKFFKRACEAINMQQSDASSVAISTYLNLGHTYRKLDEDERALHCFKTVLERW 596
           K++                             Y  LG  Y+   +  +AL CF+ +L   
Sbjct: 201 KVN---------------------------EIYFRLGIIYKHQGKWNQALECFRYILP-- 231

Query: 597 KPSA-----NVWCALATVYLKMKKLQKAIDALHSVLAMEPNH 633
           +P A     +VW  L +V   M + Q A +A   VL+    H
Sbjct: 232 QPPAPLQEWDVWFQLGSVLESMGEWQGAREAYEHVLSQNDRH 273

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/251 (21%), Positives = 91/251 (36%), Gaps = 39/251 (15%)

Query: 394 YVQCLYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDP 453
           Y Q LY L   N             PK    W  +G  Y    ++  A + F+K   LDP
Sbjct: 153 YQQALYHLSNPN------------VPK---LWHGIGILYDRYGSLDYAEEAFAKVLELDP 197

Query: 454 NFG-----YAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLP------HLYLGMQYSR 502
           +F      Y  LG    Y  +G+  QAL  +       P    P         LG     
Sbjct: 198 HFEKVNEIYFRLGI--IYKHQGKWNQALECFR---YILPQPPAPLQEWDVWFQLGSVLES 252

Query: 503 MDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINM--QQSD 560
           M     A E +            +L +LG +Y            F     A+N+  +  +
Sbjct: 253 MGEWQGAREAYEHVLSQNDRHAKVLQQLGCLYGMN------NVQFYDPQTALNLLLKSLE 306

Query: 561 ASSVAISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMKKLQKAI 620
           A S   +T+ +LG  +   ++   A   F+  + R   +   WC++  +Y ++ + + A+
Sbjct: 307 ADSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDAL 366

Query: 621 DALHSVLAMEP 631
           DA    + + P
Sbjct: 367 DAYTRAIRLNP 377

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 3/72 (4%)

Query: 556 MQQSDASSVAISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMKK 615
           +Q + +S+ A+++   L H YR  D  +RA   ++  L       +VW  L   YL +  
Sbjct: 89  LQYNPSSTKALTS---LAHLYRSRDVFQRAAELYQRALAVNPELGDVWATLGHCYLMLDD 145

Query: 616 LQKAIDALHSVL 627
           LQ+A  A    L
Sbjct: 146 LQRAYAAYQQAL 157

>Kwal_23.3670
          Length = 802

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/240 (22%), Positives = 91/240 (37%), Gaps = 48/240 (20%)

Query: 401 LGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWL 460
           LG  ++  +      +  P S+    ++   Y S +    A + + +A  ++P  G  W 
Sbjct: 79  LGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDMFQRAAELYQRALTVNPELGDIWA 138

Query: 461 GFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLY--LGMQYSRMDTLTLAEEYFMMAYD 518
              H Y +  + ++A +AY  A       ++P L+  +G+ Y R  +L  AEE F    +
Sbjct: 139 TLGHCYLMLDDLQRAYAAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLE 198

Query: 519 ICPTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINMQQSDASSVAISTYLNLGHTYRK 578
           + P                         F++A E                Y  LG  Y+ 
Sbjct: 199 LDPQ------------------------FEKANE---------------IYFRLGIIYKH 219

Query: 579 LDEDERALHCFKTVLERWKPSA-----NVWCALATVYLKMKKLQKAIDALHSVLAMEPNH 633
             +  +AL CF+ +L   +P A     +VW  L +V   M + Q A +A   VL     H
Sbjct: 220 QGKWNQALECFRYILT--QPPAPLQEWDVWFQLGSVLESMSEWQGAREAYEHVLLQNERH 277

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 51/249 (20%), Positives = 93/249 (37%), Gaps = 35/249 (14%)

Query: 394 YVQCLYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDP 453
           Y Q LY L   N             PK    W  +G  Y    ++  A + F+K   LDP
Sbjct: 157 YQQALYHLSNPN------------VPK---LWHGIGILYDRYGSLDYAEEAFAKVLELDP 201

Query: 454 NFGYA---WLGFAHTYAVEGEHEQALSAYSTAARFF---PGTHLPH----LYLGMQYSRM 503
            F  A   +      Y  +G+  QAL  +    R+    P   L        LG     M
Sbjct: 202 QFEKANEIYFRLGIIYKHQGKWNQALECF----RYILTQPPAPLQEWDVWFQLGSVLESM 257

Query: 504 DTLTLAEEYFMMAYDICPTDPLLLNELGVVY-FKKMDYPRAKKFFKRACEAINMQQSDAS 562
                A E +            +L +LG +Y  + + +   +       +++ +  +DA+
Sbjct: 258 SEWQGAREAYEHVLLQNERHAKVLQQLGCLYGMQNVQFYNTQTALNLLLKSLEVDSTDAT 317

Query: 563 SVAISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMKKLQKAIDA 622
                T+ +LG  +   ++   A   F+  + R   +   WC++  +Y ++ + + A+DA
Sbjct: 318 -----TWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDA 372

Query: 623 LHSVLAMEP 631
               + + P
Sbjct: 373 YTRAIRLNP 381

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 57/132 (43%), Gaps = 16/132 (12%)

Query: 515 MAYDIC----PTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINMQQSDASSVAISTYL 570
           MAYD      P+    L  L  +Y  +  + RA + ++RA   +N +  D        + 
Sbjct: 87  MAYDATLQYNPSSTKALTSLAHLYRSRDMFQRAAELYQRAL-TVNPELGD-------IWA 138

Query: 571 NLGHTYRKLDEDERALHCFKTVLERWKPSANV---WCALATVYLKMKKLQKAIDALHSVL 627
            LGH Y  LD+ +RA   ++  L     + NV   W  +  +Y +   L  A +A   VL
Sbjct: 139 TLGHCYLMLDDLQRAYAAYQQALYHLS-NPNVPKLWHGIGILYDRYGSLDYAEEAFAKVL 197

Query: 628 AMEPNHQTGQQL 639
            ++P  +   ++
Sbjct: 198 ELDPQFEKANEI 209

>YHR166C (CDC23) [2453] chr8 complement(437170..439050) Component of
           anaphase-promoting complex (APC), required for Clb2p
           degradation and for the metaphase-anaphase transition
           [1881 bp, 626 aa]
          Length = 626

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 76/199 (38%), Gaps = 5/199 (2%)

Query: 383 QDEFNFDVLPTYVQCLYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEAR 442
           QD +  + L TY   LY +   +KL  ++  +++       T   +  YY +     ++ 
Sbjct: 358 QDPYRLNDLETYSNILYVMQKNSKLAYLAQFVSQIDRFRPETCCIIANYYSARQEHEKSI 417

Query: 443 KYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYSR 502
            YF +A  LD     AW    H +        A+  Y  A    P        LG  Y+ 
Sbjct: 418 MYFRRALTLDKKTTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAYAL 477

Query: 503 MDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINMQQSDAS 562
           +D    +  YF  A  + P D  +   LG  Y K  +   A K +KR+ +A     S   
Sbjct: 478 LDMHLYSLYYFQKACTLKPWDRRIWQVLGECYSKTGNKVEAIKCYKRSIKA-----SQTV 532

Query: 563 SVAISTYLNLGHTYRKLDE 581
               S Y  L   Y +L++
Sbjct: 533 DQNTSIYYRLAQLYEELED 551

>KLLA0E20933g 1860517..1862649 weakly similar to sp|P38042
           Saccharomyces cerevisiae YBL084c CDC27 subunit of
           anaphase-promoting complex (cyclosome), start by
           similarity
          Length = 710

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 67/260 (25%), Positives = 110/260 (42%), Gaps = 15/260 (5%)

Query: 388 FDVLPTYVQCLYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSK 447
           F  + T+   L+ L  K  L  +  +L      + + W ++G  +    +  EA   F K
Sbjct: 458 FQDMDTFSTVLWHLQDKTHLSALCAELLTLDKYNPIAWCSMGNLHSLNKDHDEAITAFGK 517

Query: 448 ASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLY-LGMQYSRMDTL 506
           A  LDP F YA+    H Y+     + A S +  A      TH   LY LGM   ++   
Sbjct: 518 AIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALT-IEKTHYNALYGLGMCCVKLGKF 576

Query: 507 TLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYP-RAKKFFKRACEAINMQQSDASSVA 565
             A  +F  A  + P + ++LN    V  +++  P RA  F++ A E +    S A    
Sbjct: 577 EEALLFFEKARALNPVN-VILNCCCGVALERLQQPERALNFYELATE-LQPNSSLALFKK 634

Query: 566 ISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMKKLQKAIDALHS 625
               LN+G       +   ALH F+ +       A+V   L  +Y  + K Q A++    
Sbjct: 635 SQLLLNMG-------QYSSALHNFERLESLTPDEAHVHFLLGNLYQIVGKKQDAMNQYTI 687

Query: 626 VLAMEPNHQTGQQLLKIALD 645
            + ++P    G QL+K A++
Sbjct: 688 AMNLDPK---GSQLIKEAME 704

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/246 (21%), Positives = 100/246 (40%), Gaps = 21/246 (8%)

Query: 397 CLYELGGKNKLFLVSHKLAESF--------PKSSVTWFAVGTYYFSINNITEARKYFSKA 448
           CL  LG K    LV++++A+S+        P          T  + + + T      ++ 
Sbjct: 426 CLSTLG-KLHFELVNYEMAKSYFTKLRTLQPTRFQDMDTFSTVLWHLQDKTHLSALCAEL 484

Query: 449 SVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYSRMDTLTL 508
             LD     AW    + +++  +H++A++A+  A +  P     +   G +YS  D    
Sbjct: 485 LTLDKYNPIAWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDN 544

Query: 509 AEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINMQQSDASSVAIST 568
           A+  F  A  I  T    L  LG+   K   +  A  FF++A  A+N          ++ 
Sbjct: 545 AKSCFRKALTIEKTHYNALYGLGMCCVKLGKFEEALLFFEKA-RALN---------PVNV 594

Query: 569 YLN--LGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMKKLQKAIDALHSV 626
            LN   G    +L + ERAL+ ++   E    S+      + + L M +   A+     +
Sbjct: 595 ILNCCCGVALERLQQPERALNFYELATELQPNSSLALFKKSQLLLNMGQYSSALHNFERL 654

Query: 627 LAMEPN 632
            ++ P+
Sbjct: 655 ESLTPD 660

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 46/88 (52%), Gaps = 6/88 (6%)

Query: 206 YLTALC--LVKMEKYDD-ALDIVGEVNPFKDDSAEHVRNLDGGIKLESSLCY---LRGEI 259
           +L+ALC  L+ ++KY+  A   +G ++    D  E +      I+L+    Y   L+G  
Sbjct: 476 HLSALCAELLTLDKYNPIAWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHE 535

Query: 260 YSAQNNLDLAKECFKEAVCVDVKNFEAF 287
           YS  +  D AK CF++A+ ++  ++ A 
Sbjct: 536 YSNNDAFDNAKSCFRKALTIEKTHYNAL 563

>Scas_705.55
          Length = 907

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 91/219 (41%), Gaps = 18/219 (8%)

Query: 424 TWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAA 483
           TW ++ +   ++ +   A   +      +P    A    AH Y      ++A   Y  A 
Sbjct: 58  TWLSIASLAETVGDADRAAMAYDATLQFNPQSTKALTSLAHLYRSRDMFQRAAELYERAL 117

Query: 484 RFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMA-YDIC-PTDPLLLNELGVVY--FKKMD 539
              P        LG  Y  +D L  A   +  A Y +  P  P L + +G++Y  +  +D
Sbjct: 118 SINPELSDVWATLGHCYLMLDDLQRAYNSYQQALYHLSNPNVPKLWHGIGILYDRYGSLD 177

Query: 540 YPRAKKFFKRACEAINMQQSDASSVAISTYLNLGHTYRKLDEDERALHCFKTVLERWKPS 599
           Y  A++ F +  E ++ Q   A+ +    Y  LG  Y+   +  +AL CF+ +L   +P 
Sbjct: 178 Y--AEEAFAKVLE-LDPQFEKANEI----YFRLGIIYKHQGKWTQALECFRYILN--QPP 228

Query: 600 A-----NVWCALATVYLKMKKLQKAIDALHSVLAMEPNH 633
           A     ++W  L +V   M + Q A +A   VL    NH
Sbjct: 229 APLQEWDIWFQLGSVLESMNEWQGAREAYEHVLLQNENH 267

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/250 (20%), Positives = 95/250 (38%), Gaps = 35/250 (14%)

Query: 393 TYVQCLYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLD 452
           +Y Q LY L   N             PK    W  +G  Y    ++  A + F+K   LD
Sbjct: 146 SYQQALYHLSNPN------------VPK---LWHGIGILYDRYGSLDYAEEAFAKVLELD 190

Query: 453 PNFGYA---WLGFAHTYAVEGEHEQALSAYSTAARFF---PGTHLPH----LYLGMQYSR 502
           P F  A   +      Y  +G+  QAL  +    R+    P   L        LG     
Sbjct: 191 PQFEKANEIYFRLGIIYKHQGKWTQALECF----RYILNQPPAPLQEWDIWFQLGSVLES 246

Query: 503 MDTLTLAEEYFMMAYDICPTDPLLLNELGVVY-FKKMDYPRAKKFFKRACEAINMQQSDA 561
           M+    A E +            +L +LG +Y    + +   +K      +++ +  +D+
Sbjct: 247 MNEWQGAREAYEHVLLQNENHAKVLQQLGCLYGMNNVSFYDPQKALNYLLKSLEVDPNDS 306

Query: 562 SSVAISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMKKLQKAID 621
           +     T+ +LG  +   ++   A   F+  + R   +   WC++  +Y ++ + + A+D
Sbjct: 307 T-----TWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALD 361

Query: 622 ALHSVLAMEP 631
           A    + + P
Sbjct: 362 AYTRAIRLNP 371

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 1/69 (1%)

Query: 420 KSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAV-EGEHEQALSA 478
           ++ + W ++G  Y+ I+   +A   +++A  L+P     W      Y     +   AL A
Sbjct: 338 RNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDA 397

Query: 479 YSTAARFFP 487
           Y  AAR  P
Sbjct: 398 YKQAARLDP 406

>YBR112C (CYC8) [302] chr2 complement(462826..465726) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by sequence-specific
           DNA-binding proteins, Sko1p-Ssn6p-Tup1p complex
           undergoes Hog1p-dependent conversion to a
           transcriptional activator [2901 bp, 966 aa]
          Length = 966

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 87/222 (39%), Gaps = 48/222 (21%)

Query: 419 PKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSA 478
           P S+    ++   Y S +    A + + +A +++P     W    H Y +  + ++A +A
Sbjct: 77  PSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNA 136

Query: 479 YSTAARFFPGTHLPHLY--LGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFK 536
           Y  A       ++P L+  +G+ Y R  +L  AEE F    ++ P               
Sbjct: 137 YQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDP--------------- 181

Query: 537 KMDYPRAKKFFKRACEAINMQQSDASSVAISTYLNLGHTYRKLDEDERALHCFKTVLERW 596
                     F++A E                Y  LG  Y+   +  +AL CF+ +L   
Sbjct: 182 ---------HFEKANE---------------IYFRLGIIYKHQGKWSQALECFRYILP-- 215

Query: 597 KPSA-----NVWCALATVYLKMKKLQKAIDALHSVLAMEPNH 633
           +P A     ++W  L +V   M + Q A +A   VLA   +H
Sbjct: 216 QPPAPLQEWDIWFQLGSVLESMGEWQGAKEAYEHVLAQNQHH 257

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 52/248 (20%), Positives = 91/248 (36%), Gaps = 33/248 (13%)

Query: 394 YVQCLYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDP 453
           Y Q LY L   N             PK    W  +G  Y    ++  A + F+K   LDP
Sbjct: 137 YQQALYHLSNPN------------VPK---LWHGIGILYDRYGSLDYAEEAFAKVLELDP 181

Query: 454 NFGYA---WLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLP------HLYLGMQYSRMD 504
           +F  A   +      Y  +G+  QAL  +       P    P         LG     M 
Sbjct: 182 HFEKANEIYFRLGIIYKHQGKWSQALECFR---YILPQPPAPLQEWDIWFQLGSVLESMG 238

Query: 505 TLTLAEEYFMMAYDICPTDPLLLNELGVVY-FKKMDYPRAKKFFKRACEAINMQQSDASS 563
               A+E +            +L +LG +Y    + +   +K      +++    SDA+ 
Sbjct: 239 EWQGAKEAYEHVLAQNQHHAKVLQQLGCLYGMSNVQFYDPQKALDYLLKSLEADPSDAT- 297

Query: 564 VAISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMKKLQKAIDAL 623
               T+ +LG  +    +   A   F+  + R   +   WC++  +Y ++ + + A+DA 
Sbjct: 298 ----TWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAY 353

Query: 624 HSVLAMEP 631
              + + P
Sbjct: 354 TRAIRLNP 361

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 60/132 (45%), Gaps = 16/132 (12%)

Query: 515 MAYDIC----PTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINMQQSDASSVAISTYL 570
           MAYD      P+    L  L  +Y  +  + RA + ++RA   +N + SD        + 
Sbjct: 67  MAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERAL-LVNPELSD-------VWA 118

Query: 571 NLGHTYRKLDEDERALHCFKTVLERWKPSANV---WCALATVYLKMKKLQKAIDALHSVL 627
            LGH Y  LD+ +RA + ++  L     + NV   W  +  +Y +   L  A +A   VL
Sbjct: 119 TLGHCYLMLDDLQRAYNAYQQALYHLS-NPNVPKLWHGIGILYDRYGSLDYAEEAFAKVL 177

Query: 628 AMEPNHQTGQQL 639
            ++P+ +   ++
Sbjct: 178 ELDPHFEKANEI 189

 Score = 33.1 bits (74), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 1/67 (1%)

Query: 420 KSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAV-EGEHEQALSA 478
           ++ + W ++G  Y+ I+   +A   +++A  L+P     W      Y     +   AL A
Sbjct: 328 RNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDA 387

Query: 479 YSTAARF 485
           Y  AAR 
Sbjct: 388 YKQAARL 394

>YBL084C (CDC27) [117] chr2 complement(67166..69442) Component of
           anaphase-promoting complex (APC), required for the
           metaphase-anaphase transition and for Clb2p degradation
           [2277 bp, 758 aa]
          Length = 758

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 104/244 (42%), Gaps = 13/244 (5%)

Query: 398 LYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGY 457
           L+ L  K K   +++ L ++ P    TW  +G       +   A K F KA+ LDPNF Y
Sbjct: 516 LWHLHDKVKSSNLANGLMDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAY 575

Query: 458 AWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMAY 517
           A+    H ++     + A + Y  A    P  +  +  LG    ++     A  YF  A 
Sbjct: 576 AYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKAR 635

Query: 518 DICPTDPLLLNELGVVYFKKMDYP-RAKKFFKRACEAINMQQSDASSVAISTYLNLGHTY 576
            I P + +L+   G    +K+ Y  +A ++++ AC   ++Q +     ++S Y  +G   
Sbjct: 636 SINPVNVVLICCCGGS-LEKLGYKEKALQYYELAC---HLQPTS----SLSKY-KMGQLL 686

Query: 577 RKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMKKLQKAIDALHSVLAMEPNHQTG 636
             +     AL  F+ +++     A     L   Y  + + + AI  L   + ++P    G
Sbjct: 687 YSMTRYNVALQTFEELVKLVPDDATAHYLLGQTYRIVGRKKDAIKELTVAMNLDPK---G 743

Query: 637 QQLL 640
            Q++
Sbjct: 744 NQVI 747

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/66 (21%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 225 VGEVNPFKDDSAEHVRNLDGGIKLESSLCY---LRGEIYSAQNNLDLAKECFKEAVCVDV 281
           +G +   + D    ++  +   +L+ +  Y   L+G  +S+ ++ D AK C+++A+  D 
Sbjct: 546 IGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDP 605

Query: 282 KNFEAF 287
           +++ A+
Sbjct: 606 QHYNAY 611

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 55/134 (41%), Gaps = 10/134 (7%)

Query: 499 QYSRMDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINMQQ 558
           QY+    + L E    +   I  T P  L +LG ++F+ ++Y  + K+F R  +   +Q 
Sbjct: 449 QYNSFKAIRLFES--QIPSHIKDTMPWCLVQLGKLHFEIINYDMSLKYFNRLKD---LQP 503

Query: 559 SDASSVAISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMKKLQK 618
           +    + I + L L H + K+     A      +++        WC +  +    K    
Sbjct: 504 ARVKDMEIFSTL-LWHLHDKVKSSNLA----NGLMDTMPNKPETWCCIGNLLSLQKDHDA 558

Query: 619 AIDALHSVLAMEPN 632
           AI A      ++PN
Sbjct: 559 AIKAFEKATQLDPN 572

>Scas_680.35
          Length = 631

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 75/198 (37%), Gaps = 5/198 (2%)

Query: 384 DEFNFDVLPTYVQCLYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARK 443
           D +  D L TY   LY +   +KL  ++  +A+     S T   +  YY +     ++  
Sbjct: 364 DPYRLDDLDTYSNILYVMQKHSKLAYLAQFVAQIDKFRSETCCIMANYYSARQEHEKSIM 423

Query: 444 YFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYSRM 503
           YF +A  L+     AW    H +        A+  Y  A             LG  Y  +
Sbjct: 424 YFRRALTLNKKCTSAWTLMGHEFVELKNSHAAIECYRRAVDINVRDFKAWYGLGQAYEVL 483

Query: 504 DTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINMQQSDASS 563
           D    +  YF  A  + P D  +   LG  Y K  +   A K F+RA     +Q S  + 
Sbjct: 484 DMHLYSLYYFQKACTLKPLDRRMWQALGTCYTKIGNKTEAIKCFERA-----IQLSGNAD 538

Query: 564 VAISTYLNLGHTYRKLDE 581
              +   NL   Y +L++
Sbjct: 539 QDTTLMYNLAKLYDQLND 556

>KLLA0A05258g 466776..468674 similar to sp|P16522 Saccharomyces
           cerevisiae YHR166c CDC23 subunit of anaphase-promoting
           complex (cyclosome), start by similarity
          Length = 632

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 66/169 (39%)

Query: 384 DEFNFDVLPTYVQCLYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARK 443
           D +  D L TY   LY L    KL  ++   A        T   +  Y+ S     ++  
Sbjct: 365 DPYRLDDLDTYSNVLYVLQKPYKLAYLAQYAANVDIYRPETCCIIANYFSSKQQHEKSIL 424

Query: 444 YFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYSRM 503
           YF +A +LD ++ +AW+   H +        A+  Y  A+   P        LG  Y  +
Sbjct: 425 YFRRALMLDKSYTHAWILMGHEFIEMKNSHAAIECYRRASDVNPRDFQAWYGLGQAYEVL 484

Query: 504 DTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFFKRACE 552
           D  + A  YF  A  + P D  +       Y K     +A K F+R+ +
Sbjct: 485 DKHSFALYYFQKACALKPLDKRMWFASASCYEKLDKTVQAIKCFQRSSQ 533

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 31/77 (40%)

Query: 419 PKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSA 478
           P+    W+ +G  Y  ++  + A  YF KA  L P     W   A  Y    +  QA+  
Sbjct: 468 PRDFQAWYGLGQAYEVLDKHSFALYYFQKACALKPLDKRMWFASASCYEKLDKTVQAIKC 527

Query: 479 YSTAARFFPGTHLPHLY 495
           +  +++      +  LY
Sbjct: 528 FQRSSQLSGEQDISILY 544

>CAGL0I02288g complement(203605..205524) similar to sp|P16522
           Saccharomyces cerevisiae YHR166c CDC23, hypothetical
           start
          Length = 639

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 68/179 (37%)

Query: 384 DEFNFDVLPTYVQCLYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARK 443
           D +  D + T+   LY +    KL  ++  +++       T   +  YY +     ++  
Sbjct: 372 DPYRLDDMDTFSNILYVMQKNAKLAYLAQFVSQIDRFRPETCCVIANYYSARQEHEKSIM 431

Query: 444 YFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYSRM 503
           YF +A  LD     AW    H +        A+ +Y  A    P        LG  Y  +
Sbjct: 432 YFRRALTLDKKTTSAWTLMGHEFVELKNSNAAIESYRRAVDIDPRDFRAWYGLGQAYEVL 491

Query: 504 DTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINMQQSDAS 562
           D    +  YF  A  + P D  +   LG  Y K  ++  A K ++RA +     + D +
Sbjct: 492 DMHLYSLYYFQRACILKPLDKRMWQALGSCYAKVGNHAEAIKCYERALQLTTQSEQDTA 550

>CAGL0C01903g complement(199487..201796) similar to sp|P38042
           Saccharomyces cerevisiae YBL084c CDC27 subunit of
           anaphase-promoting complex, hypothetical start
          Length = 769

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 99/229 (43%), Gaps = 13/229 (5%)

Query: 418 FPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALS 477
           +P    TW  VG Y     +  +A + F KA+ +DP F YA+    H  +     + A  
Sbjct: 547 YPNKPETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKK 606

Query: 478 AYSTAARFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKK 537
            +  A    P  +  +  +G+   ++     A  YF  A  I P + +L+   GV   +K
Sbjct: 607 CFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYPINAVLICCCGVA-LEK 665

Query: 538 MDYP-RAKKFFKRACEAINMQQSDASSVAISTYLNLGHTYRKLDEDERALHCFKTVLERW 596
           ++Y  +A ++++ AC    +Q +  S++A     NL +   + +    AL  F+ + +  
Sbjct: 666 LEYQDKALEYYELAC---TLQPN--SNLARFKRANLLYAMGRYN---LALQSFEELSKLT 717

Query: 597 KPSANVWCALATVYLKMKKLQKAIDALHSVLAMEPNHQTGQQLLKIALD 645
                V   L  +Y  M +  +AI      + ++P    G QL+  AL+
Sbjct: 718 PEEPTVHFVLGQLYQIMGRKNEAIREFTVAMNLDPK---GNQLILDALE 763

 Score = 36.2 bits (82), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 225 VGEVNPFKDDSAEHVRNLDGGIKLESSLCY---LRGEIYSAQNNLDLAKECFKEAVCVDV 281
           VG     K D  + +   +   K++    Y   L+G   S+ ++ D AK+CF++A+  D 
Sbjct: 557 VGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRKAIACDP 616

Query: 282 KNFEAF 287
           +++ A+
Sbjct: 617 RHYNAY 622

>ABR206W [800] [Homologous to ScYHR166C (CDC23) - SH]
           complement(787181..789229) [2049 bp, 682 aa]
          Length = 682

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 65/175 (37%), Gaps = 2/175 (1%)

Query: 384 DEFNFDVLPTYVQCLYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARK 443
           D +  D L  Y   LY +   +KL  +S   A+       T   +  Y+ +     +A  
Sbjct: 414 DPYRLDDLDIYSNILYVIQKPHKLAYLSQFAADLDAYRPETCCIIANYFSAKQQHEKAIM 473

Query: 444 YFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYSRM 503
           YF +A  L+     AW    H +        A+  Y  A    P        LG  Y  +
Sbjct: 474 YFRRALTLNKTCTNAWTLMGHEFVEMKNSHAAIECYRRAVDINPCDFKAWYGLGQAYEVL 533

Query: 504 DTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYP-RAKKFFKRACEAINMQ 557
           D    A  Y   A  + P D  +   L   Y  K+D P +A K F+RA +  N Q
Sbjct: 534 DRHLYALYYLQKACSLKPLDKRMWQALANCY-DKLDRPNQAIKCFQRASQLSNDQ 587

>CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces
           cerevisiae YBR112c CYC8 general repressor of
           transcription, hypothetical start
          Length = 1148

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 77/209 (36%), Gaps = 59/209 (28%)

Query: 441 ARKYFSKASVL-------DPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPH 493
           +R  F KA+ L       +P     W    H Y +  + ++A +AY  A       ++P 
Sbjct: 94  SRDMFQKAAELYECALQVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPK 153

Query: 494 LY--LGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFFKRAC 551
           L+  +G+ Y R  +L  AEE F    ++ P                         F++A 
Sbjct: 154 LWHGIGILYDRYGSLDYAEEAFAKVLELDP------------------------HFEKAN 189

Query: 552 EAINMQQSDASSVAISTYLNLGHTYRKLDEDERALHCFK-------TVLERWKPSANVWC 604
           E                Y  LG  Y+   +  +AL CF+       T L+ W    ++W 
Sbjct: 190 E---------------IYFRLGIIYKHQGKWSQALECFRYILAQPPTPLQEW----DIWF 230

Query: 605 ALATVYLKMKKLQKAIDALHSVLAMEPNH 633
            L +V   M + Q A +A   VL    +H
Sbjct: 231 QLGSVLESMGEWQGAREAYEHVLLQNDHH 259

 Score = 37.4 bits (85), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 53/249 (21%), Positives = 93/249 (37%), Gaps = 35/249 (14%)

Query: 394 YVQCLYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDP 453
           Y Q LY L   N             PK    W  +G  Y    ++  A + F+K   LDP
Sbjct: 139 YQQALYHLSNPN------------VPK---LWHGIGILYDRYGSLDYAEEAFAKVLELDP 183

Query: 454 NFGYA---WLGFAHTYAVEGEHEQALSAYSTAARFF---PGTHLPH----LYLGMQYSRM 503
           +F  A   +      Y  +G+  QAL  +    R+    P T L        LG     M
Sbjct: 184 HFEKANEIYFRLGIIYKHQGKWSQALECF----RYILAQPPTPLQEWDIWFQLGSVLESM 239

Query: 504 DTLTLAEEYFMMAYDICPTDPLLLNELGVVY-FKKMDYPRAKKFFKRACEAINMQQSDAS 562
                A E +            +  +LG +Y    + +   +K      +++ +  SDA+
Sbjct: 240 GEWQGAREAYEHVLLQNDHHAKVFQQLGCLYGMNNVQFYDPQKALSYLLKSLEVDPSDAT 299

Query: 563 SVAISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMKKLQKAIDA 622
                T+ +LG  +    +   A   F+  + R   +   WC++  +Y ++ + + A+DA
Sbjct: 300 -----TWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDA 354

Query: 623 LHSVLAMEP 631
               + + P
Sbjct: 355 YTRAIRLNP 363

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 39/90 (43%), Gaps = 10/90 (11%)

Query: 420 KSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAV-EGEHEQALSA 478
           ++ + W ++G  Y+ I+   +A   +++A  L+P     W      Y     +   AL A
Sbjct: 330 RNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDA 389

Query: 479 YSTAARFFP-GTHLPHLYLGMQYSRMDTLT 507
           Y  AAR  P   H+          R++TLT
Sbjct: 390 YKQAARLDPENIHI--------RKRLETLT 411

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 27/56 (48%)

Query: 572 LGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMKKLQKAIDALHSVL 627
           L H YR  D  ++A   ++  L+     ++VW  L   YL +  LQ+A +A    L
Sbjct: 88  LAHLYRSRDMFQKAAELYECALQVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 143

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 49/107 (45%), Gaps = 17/107 (15%)

Query: 542 RAKKFFKRACE------AINMQQSDASSVAISTYLNLGHTYRKLDEDERALHCFKTVLER 595
           R++  F++A E       +N + SD        +  LGH Y  LD+ +RA + ++  L  
Sbjct: 93  RSRDMFQKAAELYECALQVNPELSDV-------WATLGHCYLMLDDLQRAYNAYQQALYH 145

Query: 596 WKPSANV---WCALATVYLKMKKLQKAIDALHSVLAMEPNHQTGQQL 639
              + NV   W  +  +Y +   L  A +A   VL ++P+ +   ++
Sbjct: 146 LS-NPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKANEI 191

>AEL281C [2224] [Homologous to ScYPR189W (SKI3) - SH]
           (111535..115707) [4173 bp, 1390 aa]
          Length = 1390

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 37/85 (43%), Gaps = 2/85 (2%)

Query: 421 SSVTW--FAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSA 478
           +SV W    +G YY  +    E+ ++F  A  +D +   AW+G    YA  G  E ++  
Sbjct: 657 NSVNWPYRVLGVYYLELQQEAESIEWFQSALRIDSSDVEAWIGLGQAYAACGRIEASIKV 716

Query: 479 YSTAARFFPGTHLPHLYLGMQYSRM 503
           +  A    P      L+L +   ++
Sbjct: 717 FERALELSPEHKYAGLFLAISLCQL 741

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 17/76 (22%), Positives = 31/76 (40%)

Query: 569 YLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMKKLQKAIDALHSVLA 628
           Y  LG  Y +L ++  ++  F++ L         W  L   Y    +++ +I      L 
Sbjct: 663 YRVLGVYYLELQQEAESIEWFQSALRIDSSDVEAWIGLGQAYAACGRIEASIKVFERALE 722

Query: 629 MEPNHQTGQQLLKIAL 644
           + P H+     L I+L
Sbjct: 723 LSPEHKYAGLFLAISL 738

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 26/64 (40%)

Query: 424 TWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAA 483
            W  +G  Y +   I  + K F +A  L P   YA L  A +     E E++L A     
Sbjct: 696 AWIGLGQAYAACGRIEASIKVFERALELSPEHKYAGLFLAISLCQLSEFEKSLEALRKLV 755

Query: 484 RFFP 487
             +P
Sbjct: 756 NKYP 759

>ABR131W [723] [Homologous to ScYNL121C (TOM70) - SH; ScYHR117W
           (TOM71) - SH] complement(641630..643414) [1785 bp, 594
           aa]
          Length = 594

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 41/95 (43%), Gaps = 1/95 (1%)

Query: 419 PKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSA 478
           PKSS  ++      F I    +A K F KA   DP+  Y ++  A     E + +   + 
Sbjct: 370 PKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETL 429

Query: 479 YSTAARFFP-GTHLPHLYLGMQYSRMDTLTLAEEY 512
           +S A R FP    +P+ Y  +   + D     +EY
Sbjct: 430 FSEARRRFPTAPEVPNFYAEILSDKGDFENALKEY 464

>KLLA0F04191g 397611..400268 weakly similar to sp|P19735
           Saccharomyces cerevisiae YBR055c PRP6
           snRNP(U4/U6)-associated splicing factor singleton, start
           by similarity
          Length = 885

 Score = 36.6 bits (83), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 56/130 (43%), Gaps = 25/130 (19%)

Query: 507 TLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINMQQSD------ 560
           +L +  F  A +     P+++ E+G V+ K+  Y +A K+F RA E  N+Q  D      
Sbjct: 767 SLRKTTFQDALEATKEHPMVITEIGKVFQKEHQYAKAYKWFIRASEN-NLQFGDPWVWLY 825

Query: 561 ---ASSVAISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMKKLQ 617
              +    +   +N   T +KL E+E            W+P+ N +  ++          
Sbjct: 826 ICESCMNPVDLQINEEKTLKKLKENEPRYGIL------WEPAVNSYLHISN--------- 870

Query: 618 KAIDALHSVL 627
             ID LHS++
Sbjct: 871 SPIDILHSII 880

>Kwal_56.24750
          Length = 619

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 35/167 (20%), Positives = 60/167 (35%)

Query: 384 DEFNFDVLPTYVQCLYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARK 443
           D +  + + TY   LY +   +KL  ++   +      + T   +  YY +     ++  
Sbjct: 351 DPYRLEDMDTYSNILYVMQKPSKLAYLAQFASGVDRFRAETCCIIANYYSAKQEHEKSIM 410

Query: 444 YFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYSRM 503
           YF +A  L+     AW    H +        A+  Y  A    P        LG  Y  +
Sbjct: 411 YFRRALTLNKKCTSAWTLMGHEFVELKNSHAAIECYRRAVDINPRDFKAWYGLGQAYEVL 470

Query: 504 DTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFFKRA 550
           D    +  YF  +  + P D  +   L   Y K  +   + K + RA
Sbjct: 471 DMHLYSLYYFQKSCALKPLDKRMWQALASCYEKVGNAAESIKCYTRA 517

>CAGL0L12936g 1380327..1382129 similar to sp|P07213 Saccharomyces
           cerevisiae YNL121c TOM70 or sp|P38825 Saccharomyces
           cerevisiae YHR117w TOM7, hypothetical start
          Length = 600

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 45/115 (39%)

Query: 444 YFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYSRM 503
           YF KA  LDPN    +      Y +   +E+A   +  +    P    P++ L     R 
Sbjct: 368 YFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRE 427

Query: 504 DTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINMQQ 558
           + +   E+ F  A    PT P + N    +   K D   A K +  A    ++Q+
Sbjct: 428 NKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQK 482

>Scas_672.24
          Length = 300

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%)

Query: 248 LESSLCYLRGEIYSAQNNLDLAKECFKEAVCVDVKNFEAFDRL 290
           LE  L ++ GEIY    + D A  CF+E +C+   N+ AF +L
Sbjct: 162 LEPELWWMLGEIYMNLKDFDRAIYCFEEILCIMPFNYVAFAQL 204

>Scas_718.37d
          Length = 601

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%)

Query: 435 INNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTA 482
           INNI  +  Y+ +A   DP   + W+  A  Y   G+ E A+++Y  A
Sbjct: 308 INNIPLSYDYYQRAISSDPALSFIWVSIASLYLRLGQIEDAIASYWEA 355

>KLLA0F24046g 2240454..2242268 similar to sp|P07213 Saccharomyces
           cerevisiae YNL121c TOM70 mitochondrial outer membrane
           specialized import receptor, start by similarity
          Length = 604

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 1/78 (1%)

Query: 419 PKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSA 478
           P  S  ++  G  +F + N  EA   F KA  L+P   +A++  A     +   +   + 
Sbjct: 381 PNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCETL 440

Query: 479 YSTAARFFP-GTHLPHLY 495
           +S A R FP    +P+ Y
Sbjct: 441 FSEARRKFPTAPEVPNFY 458

>CAGL0K11209g 1088471..1090243 similar to sp|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor, hypothetical start
          Length = 590

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 72/200 (36%), Gaps = 18/200 (9%)

Query: 438 ITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHE-QALSAYSTAARFFPGTHLPHLYL 496
           ++EA   F  A   DP    AWL       ++ E E   +SA  T  +  P        L
Sbjct: 302 LSEAALAFEAAIKQDPKHVDAWLKLG-IVQIQNEKELNGMSALETCLKLDPNNLEAMKNL 360

Query: 497 GMQYSRMDTLTLAEEYFMMAYDIC-----PTDPLLLNELGVVYFKKMDYPRAKKFFKRAC 551
            + Y       + E Y M AY++         P   N   +   +        K  +R  
Sbjct: 361 AISY-------INEGYDMSAYNMLNRWADTKYPGFYNSAELEGKRDEHENIHSKMTRRFL 413

Query: 552 EAINMQQSDASSVAISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYL 611
             +N      +SV     L LG  +   DE +R + CF+  L+       +W  L     
Sbjct: 414 SLVNR----INSVDPDIQLCLGLLFYANDEFDRTIDCFQAALKVNPNDELMWNRLGASLA 469

Query: 612 KMKKLQKAIDALHSVLAMEP 631
              + ++AI A H  L ++P
Sbjct: 470 NSNRSEEAIQAYHRALQLKP 489

>CAGL0E01573g complement(148847..151561) similar to sp|P42842
           Saccharomyces cerevisiae YNL313c, start by similarity
          Length = 904

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 27/59 (45%)

Query: 424 TWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTA 482
           TW+  G      N +  A + F++ + LDP    +W   +  Y  +G+ ++A S    A
Sbjct: 635 TWYFYGCIALECNKMEIAAEAFTRCTALDPTHAMSWSNLSAAYVQQGKLKEAHSCLKQA 693

>Scas_697.30
          Length = 625

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 482 AARFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYP 541
           A  FFP  +  +LYL +  +   T     +YF  A ++ P    +    G +YF   DYP
Sbjct: 364 AIGFFPRVN-SYLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYP 422

Query: 542 RAKKFFKRACE 552
           +AK  F++A E
Sbjct: 423 KAKVEFEKAKE 433

>CAGL0M01914g 232780..234810 some similarities with sp|P14922
           Saccharomyces cerevisiae YBR112c CYC8, general repressor
           of transcription, hypothetical start
          Length = 676

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%)

Query: 437 NITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTA 482
           N   A +YF  +  L PN  + W+  A  Y   G+ E +L+ YS A
Sbjct: 316 NAQVAYEYFQNSLSLTPNLPFIWISVASLYLTLGQLEDSLATYSQA 361

>Kwal_23.5408
          Length = 1410

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 30/65 (46%)

Query: 439 TEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLGM 498
           +E+ ++F  A  +DP+   +W+G    Y   G  E ++  +  A    P +   H +  +
Sbjct: 697 SESIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALEVEPTSAYAHYFKAL 756

Query: 499 QYSRM 503
             SRM
Sbjct: 757 SLSRM 761

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 24/57 (42%)

Query: 419  PKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQA 475
            P+ +  W+ +       N+I  AR    K+  + P     WLG A     EG  E++
Sbjct: 994  PRETSVWYDMAVLALKYNDIDFARSVLMKSQTIAPQDSSPWLGLALASEKEGLVEES 1050

>KLLA0C15455g 1341570..1343270 similar to sp|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor, start by similarity
          Length = 566

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 29/62 (46%)

Query: 570 LNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMKKLQKAIDALHSVLAM 629
           L LG  +   +E  + + CF+T LE       +W  L        + ++AI A H  LA+
Sbjct: 420 LGLGTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALAL 479

Query: 630 EP 631
           +P
Sbjct: 480 KP 481

>Sklu_2021.2 YHR117W, Contig c2021 1337-3139
          Length = 600

 Score = 33.5 bits (75), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 86/234 (36%), Gaps = 9/234 (3%)

Query: 439 TEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLGM 498
           TE  + F KA  LDPN    +      Y +  ++E A   +  A         P++ L  
Sbjct: 363 TEYFENFDKALELDPNCAAVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFPYIQLAC 422

Query: 499 QYSRMDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFF---KRACEAIN 555
              R +     E  F  A    PT P + N    +   K D   AKK +   ++  +A++
Sbjct: 423 LAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLANAKKQYEIARKLEDALD 482

Query: 556 -MQQSDASSVAISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMK 614
            +    A  V  +T L    T     E   A   F+   E+   S      LA + L+ +
Sbjct: 483 GIHVGIAPLVGKATLLAREPTVENFVE---ATQNFEEACEKDPRSEQAKIGLAQLKLQQE 539

Query: 615 KLQKAIDALHSVLAMEPNHQTGQQLLKIALDVNVHLPLDNGHPLMVSAKISENM 668
           ++ +AI        +  +     Q    A    +   +    P+ +SAKI E +
Sbjct: 540 EVDEAITLFEEAADLARSFDEKLQATTFAEATKIQKKI-RADPI-ISAKIEETL 591

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 38/95 (40%), Gaps = 1/95 (1%)

Query: 419 PKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSA 478
           P  +  ++  G  YF       A K F KA   + N  + ++  A     E + E   + 
Sbjct: 377 PNCAAVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFPYIQLACLAYRENKFEDCETL 436

Query: 479 YSTAARFFP-GTHLPHLYLGMQYSRMDTLTLAEEY 512
           +S A R FP    +P+ Y  +   + D     ++Y
Sbjct: 437 FSEARRKFPTAPEVPNFYAEILSDKGDLANAKKQY 471

>Scas_666.23
          Length = 596

 Score = 33.5 bits (75), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 42/94 (44%), Gaps = 1/94 (1%)

Query: 420 KSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAY 479
           K++  ++  G  YF      +A + F KA  LDP   + ++  A     E + +   + +
Sbjct: 372 KNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYRENKFDDCETLF 431

Query: 480 STAARFFPG-THLPHLYLGMQYSRMDTLTLAEEY 512
           S A R FP  + +P+ Y  +   + D     +EY
Sbjct: 432 SEARRKFPNSSEVPNFYAEILADKGDFDAALKEY 465

>Kwal_56.23065
          Length = 907

 Score = 33.5 bits (75), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 59/142 (41%), Gaps = 12/142 (8%)

Query: 418 FPKSSVTWFAVGTYYFSI-NNITEARKYFSKASVLDPNFGYAWLGFAHTYAVE--GEHEQ 474
            P+++  W A+     S+ N  T AR  F  A +  P      +  A     +  G  +Q
Sbjct: 706 LPENANLWIALAHADESLLNQPTRARSDFEIALLKVPKENSEPILVAQVQMEKKLGNTDQ 765

Query: 475 ALSAYSTAARFFPGTHL---PHLYLGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELG 531
           A    + A + FP + L    HL L  + S      L    +  A     +DP +L E+G
Sbjct: 766 ARLLVTRALKQFPSSALLWVEHLKLITKKS------LKRTAYQDALKNANSDPNVLLEIG 819

Query: 532 VVYFKKMDYPRAKKFFKRACEA 553
              +   +Y +A K+F+RA  A
Sbjct: 820 SSLYSDANYEKALKWFERATNA 841

>Scas_585.4
          Length = 918

 Score = 33.5 bits (75), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 26/61 (42%)

Query: 418 FPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALS 477
           +P +  TW+  G      N +  A + FS+   LDP    AW   +  Y    + ++A S
Sbjct: 640 YPLNFETWYFYGCVALECNKMEVAAEAFSRCVSLDPTHAMAWSNLSAAYVELNKLKEAFS 699

Query: 478 A 478
            
Sbjct: 700 C 700

>YNL121C (TOM70) [4474] chr14 complement(398684..400537)
           Mitochondrial specialized import receptor of the outer
           membrane, has tetratricopeptide (TPR) repeats [1854 bp,
           617 aa]
          Length = 617

 Score = 33.1 bits (74), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 35/76 (46%), Gaps = 1/76 (1%)

Query: 421 SSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYS 480
           +S  ++  G   F + N  +A K F KA  LDP   + ++  A     E + +   + +S
Sbjct: 396 NSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFS 455

Query: 481 TAARFFP-GTHLPHLY 495
            A R FP    +P+ +
Sbjct: 456 EAKRKFPEAPEVPNFF 471

 Score = 33.1 bits (74), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 53/144 (36%), Gaps = 1/144 (0%)

Query: 412 HKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGE 471
            K  E FP+ + ++  +       N+ TE   YF KA  LD N    +        +   
Sbjct: 354 KKAIELFPRVN-SYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQN 412

Query: 472 HEQALSAYSTAARFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELG 531
           ++QA   +  A    P    P++ L     R +     E  F  A    P  P + N   
Sbjct: 413 YDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFA 472

Query: 532 VVYFKKMDYPRAKKFFKRACEAIN 555
            +   K D+ +A K +  A E  N
Sbjct: 473 EILTDKNDFDKALKQYDLAIELEN 496

>Sklu_2077.4 YOR007C, Contig c2077 4462-5433 reverse complement
          Length = 323

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 4/68 (5%)

Query: 416 ESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNF--GYAWLGFAHTYAVEGEHE 473
           E  P ++V +      Y S+    E+ +    A  ++P++  GY+ LGFA  YA+ G+ E
Sbjct: 125 EVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAK-YAL-GKPE 182

Query: 474 QALSAYST 481
           +AL AY T
Sbjct: 183 EALEAYKT 190

>ACR005W [1053] [Homologous to ScYOR007C (SGT2) - SH]
           complement(363355..364338) [984 bp, 327 aa]
          Length = 327

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 4/66 (6%)

Query: 416 ESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNF--GYAWLGFAHTYAVEGEHE 473
           E  P  +V +      Y S+    +A +   KA+ +D ++  G++ LG+A  YA+ G HE
Sbjct: 118 EVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAK-YAL-GRHE 175

Query: 474 QALSAY 479
           +AL AY
Sbjct: 176 EALEAY 181

>KLLA0B03520g 317409..321614 similar to sp|P17883 Saccharomyces
           cerevisiae YPR189w SKI3 antiviral protein singleton,
           start by similarity
          Length = 1401

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 26/56 (46%)

Query: 424 TWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAY 479
           +W  +G  Y +   +  + K F K   LD N  +AW   A   +  GE ++++  +
Sbjct: 705 SWVGLGQAYLNCGRVEASIKVFKKVLELDENHHFAWYFLAIALSALGEFDRSIEIF 760

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 21/47 (44%)

Query: 424  TWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEG 470
            +W+ +     S N+   AR    KA  + P    +WLG A  Y  EG
Sbjct: 988  SWYCMAMLALSNNDTDLARDILMKAQSIAPEDSQSWLGLALIYEKEG 1034

>YHR117W (TOM71) [2405] chr8 (342351..344270) Minor import receptor
           of the mitochondrial outer membrane, similar to Tom70p
           in sequence and in function, has tetratricopeptide (TPR)
           repeats [1920 bp, 639 aa]
          Length = 639

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 27/59 (45%)

Query: 429 GTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFP 487
           G ++F+  N  EA KY+  A  LDPN    +   +  Y   G+ E+ +   + A    P
Sbjct: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKP 192

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 23/108 (21%), Positives = 47/108 (43%), Gaps = 1/108 (0%)

Query: 406 KLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHT 465
           + F    K  +  P+   T++  G  YF + +   A++ F KA  L+P   Y ++  A  
Sbjct: 396 EFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACL 455

Query: 466 YAVEGEHEQALSAYSTAARFFPG-THLPHLYLGMQYSRMDTLTLAEEY 512
              +G+  ++ + ++     FP    +P  +  +   R D  T  ++Y
Sbjct: 456 LYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQY 503

>Kwal_33.14767
          Length = 594

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 47/133 (35%), Gaps = 1/133 (0%)

Query: 413 KLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEH 472
           K  E FP+ + T+  +          TE    F KA  LDPN    +      + +  + 
Sbjct: 332 KAVEYFPRPN-TYIYMALIMADKGQATEYFDNFEKALELDPNCAAVYYHRGQMHFITQQF 390

Query: 473 EQALSAYSTAARFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELGV 532
           EQA   +  A         P++ L     R    + +E  F  A    PT P + N    
Sbjct: 391 EQAGKDFEKAKELNESNIFPYIQLACLTYREGKFSDSETLFSEARRKFPTSPEVPNFYAE 450

Query: 533 VYFKKMDYPRAKK 545
               K D   AKK
Sbjct: 451 TLSDKGDIAGAKK 463

>CAGL0L04048g 474410..476173 similar to sp|P07213 Saccharomyces
           cerevisiae YNL121c TOM70 or sp|P38825 Saccharomyces
           cerevisiae YHR117w TOM7, hypothetical start
          Length = 587

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 39/95 (41%), Gaps = 1/95 (1%)

Query: 419 PKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSA 478
           P  +  ++  G   F I    +A + F KA   DP   + ++  A     EG  +   + 
Sbjct: 362 PNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETL 421

Query: 479 YSTAARFFP-GTHLPHLYLGMQYSRMDTLTLAEEY 512
           +S A R FP    +P+ +  +   + +    A EY
Sbjct: 422 FSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEY 456

>KLLA0B10912g 955948..957486 similar to sp|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase,
           start by similarity
          Length = 512

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 51/122 (41%), Gaps = 8/122 (6%)

Query: 521 PTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINMQQSDASSVAISTYLNLGHTYRKLD 580
           P   L L   G  + K+  Y +A +++ +A E       D  +  +  Y N   T  KLD
Sbjct: 10  PEKALELKNEGNKFVKEKLYAKAAEYYTKAIE------HDPENTIL--YSNRAFTNLKLD 61

Query: 581 EDERALHCFKTVLERWKPSANVWCALATVYLKMKKLQKAIDALHSVLAMEPNHQTGQQLL 640
             + +L   K  +E    +   +   A  Y+ + + +KA   L  VL  +PN  T +  L
Sbjct: 62  NFQSSLDDAKRAIELDNNNLKAYHRRAMSYIGLLEFRKARKDLIIVLKFKPNELTAKNAL 121

Query: 641 KI 642
            I
Sbjct: 122 AI 123

>CAGL0J09570g complement(939447..941096) some similarities with
           sp|P35056 Saccharomyces cerevisiae YDR244w PAS10
           peroxisomal targeting signal receptor, hypothetical
           start
          Length = 549

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 42/111 (37%), Gaps = 1/111 (0%)

Query: 389 DVLPTYVQCLYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKA 448
           D+L       Y LG  +       KL E  PK  +TW  +G    +      A + +   
Sbjct: 392 DILTVLALFNYLLGRSDNAIKCFEKLLEQDPKDEITWNHLGATLANSKRYDTAIQVYMNT 451

Query: 449 SVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLGMQ 499
             L P+F  A      T    GE ++ + +  TA     G+ +P +   ++
Sbjct: 452 IELKPSFVRARYNLGSTLVKNGELQRGIESLLTAL-VMQGSPIPPIATNLE 501

>Sklu_1876.2 YOL145C, Contig c1876 732-4004
          Length = 1090

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 8/91 (8%)

Query: 524 PL-LLNELGVVYFKKMDYPRAKKFFKRACEAINMQQSDASSVAISTYLNLGHTYRKLDED 582
           PL +LN LG  +F   D   A  FF++A +A      D S V+I+   N+  T    D+ 
Sbjct: 501 PLEILNNLGCFHFITGDLKNADNFFEKALQAT----PDTSDVSITVKYNVARTLEPQDK- 555

Query: 583 ERALHCFKTVLERWKPSANVWCALATVYLKM 613
            +A   ++ +L      A +   + +V+LK 
Sbjct: 556 RKAEEIYEEILS--SHPAYIHAKIRSVFLKF 584

>YBR055C (PRP6) [245] chr2 complement(344562..347261) U4/U6.U5
           tri-snRNP-associated splicing factor, contains
           tetratricopeptide (TPR) repeats [2700 bp, 899 aa]
          Length = 899

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 43/225 (19%), Positives = 82/225 (36%), Gaps = 44/225 (19%)

Query: 394 YVQCL-YELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLD 452
           YV  L Y+   +  +  ++ +  +SFP     +  +G  Y S+ NI  +R+ +   + L 
Sbjct: 639 YVNFLRYQDLNEEAIKFLNERCLKSFPICHKFFLQLGQIYHSMGNIEMSRETYLSGTRLV 698

Query: 453 PNFGYAWLGFAHTYAVE-----------------------------------GEHEQALS 477
           PN    W+  +    ++                                   G  +QA  
Sbjct: 699 PNCPLLWVSLSKIDEIDLKNPVRARSILDRGLLKNPDDVLFYIAKIQMEIRLGNLDQAEL 758

Query: 478 AYSTAARFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKK 537
             + A + FP   L  +     +   +  +L +  F  A      D  +L E+GV ++ +
Sbjct: 759 LVTQALQKFPSNALLWVEQIKLFKHGNKSSLKKTIFQDALRRTQNDHRVLLEIGVSFYAE 818

Query: 538 MDYPRAKKFFKRACEAINMQQSDASSVAISTYLNLGHTYRKLDED 582
             Y  + K+ +RA +          S    T++ L  TY +L +D
Sbjct: 819 AQYETSLKWLERALK--------KCSRYGDTWVWLFRTYARLGKD 855

>YOR007C (SGT2) [4822] chr15 complement(338938..339978) Protein
           containing three TPR (tetratrico peptide repeat)
           domains, which may mediate protein-protein interactions,
           has low similarity to small glutamine-rich
           tetratricopeptide repeat-containing protein (human SGT)
           [1041 bp, 346 aa]
          Length = 346

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 418 FPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNF--GYAWLGFAHTYAVEGEHEQA 475
            P +++ +      + S+    +A K    A  +DP++  GY+ LGFA  YA +G+ E+A
Sbjct: 132 LPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK-YA-QGKPEEA 189

Query: 476 LSAY 479
           L AY
Sbjct: 190 LEAY 193

>YDR244W (PEX5) [1078] chr4 (950555..952393) Peroxisomal protein
           (peroxin), receptor for proteins carrying peroxisomal
           targeting signal 1 (PTS1) sequence, contains
           tetratricopeptide (TPR) repeats [1839 bp, 612 aa]
          Length = 612

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 42/204 (20%), Positives = 75/204 (36%), Gaps = 20/204 (9%)

Query: 438 ITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLG 497
           ++EA   F  A    P+   AWL          +    +SA     +  P        L 
Sbjct: 329 LSEAALAFEAAVKEKPDHVDAWLRLGLVQTQNEKELNGISALEECLKLDPKNLEAMKTLA 388

Query: 498 MQYSR----MDTLTLAEEYFMMAYD-----ICPTDPLLLNELGVVYFKKMDYPRAKKFFK 548
           + Y      M   T+ +++    Y      I   D     E G  +   M+    K+F +
Sbjct: 389 ISYINEGYDMSAFTMLDKWAETKYPEIWSRIKQQDDKFQKEKGFTHID-MNAHITKQFLQ 447

Query: 549 RACEAINMQQSDASSVAISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSANV-WCALA 607
            A        ++ S++     L LG  +   D+ ++ + CF++ L R  P+  + W  L 
Sbjct: 448 LA--------NNLSTIDPEIQLCLGLLFYTKDDFDKTIDCFESAL-RVNPNDELMWNRLG 498

Query: 608 TVYLKMKKLQKAIDALHSVLAMEP 631
                  + ++AI A H  L ++P
Sbjct: 499 ASLANSNRSEEAIQAYHRALQLKP 522

>ADL177C [1564] [Homologous to ScYNL313C - SH] (383369..386086)
           [2718 bp, 905 aa]
          Length = 905

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 27/65 (41%)

Query: 418 FPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALS 477
           +P S  TW+  G        +  A + FS+   LD     +W   +  Y  +G+ ++A S
Sbjct: 634 YPLSFDTWYFYGCIGLECGKVDLAAEAFSRCVALDDTHALSWSNLSAAYTEQGKIKEAHS 693

Query: 478 AYSTA 482
               A
Sbjct: 694 CLKRA 698

>Scas_589.5
          Length = 1087

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 50/105 (47%), Gaps = 16/105 (15%)

Query: 478 AYSTAARFFPGTHLPHLYLGMQYSR-MDTLTLA-EEYFMMAYDICPTDPLLLNELGVVYF 535
           AY T ++ +  T+        QY + +D LT A EE   +  D  P +  LLN +G  YF
Sbjct: 480 AYLTISQLYEKTN--------QYKQSLDYLTKALEEIQFINKDNVPLE--LLNNIGSFYF 529

Query: 536 KKMDYPRAKKFFKRACEAINMQQSDASSVAISTYLNLGHTYRKLD 580
              D  +AK++F  A   ++   +D+SS+    Y N+  T    D
Sbjct: 530 INGDADKAKEYFDLAKSKLS---NDSSSLTTINY-NIARTLETKD 570

>CAGL0G10087g 962823..967058 similar to sp|P17883 Saccharomyces
           cerevisiae YPR189w SKI3 antiviral protein, start by
           similarity
          Length = 1411

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 31/72 (43%)

Query: 411 SHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEG 470
           S K  ++  K S  +  +G  Y       E+ ++F  A  +DP    +W+G   +Y   G
Sbjct: 668 SEKSKKALRKVSWPYRILGVAYLEKQQDAESIQWFQLALRIDPTDVESWIGLGQSYLNCG 727

Query: 471 EHEQALSAYSTA 482
             E +L  +  A
Sbjct: 728 RVEASLKVFERA 739

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 28/58 (48%)

Query: 419 PKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQAL 476
           P    +W  +G  Y +   +  + K F +A  LD +  YA    A  ++  GE+E++L
Sbjct: 710 PTDVESWIGLGQSYLNCGRVEASLKVFERALDLDEHHSYALYYKAVCHSQLGEYEESL 767

>CAGL0I09702g complement(925113..926678) similar to tr|Q08777
           Saccharomyces cerevisiae YOR306c, hypothetical start
          Length = 521

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 14/19 (73%)

Query: 441 ARKYFSKASVLDPNFGYAW 459
            RK+++  S  DPNFGYAW
Sbjct: 253 VRKFYALKSDTDPNFGYAW 271

>ACR173W [1220] [Homologous to ScYJR088C - SH]
           complement(657718..658575) [858 bp, 285 aa]
          Length = 285

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 40/95 (42%), Gaps = 9/95 (9%)

Query: 541 PRAKKFFKRACEAINMQQSDASSVAISTYLNLGHTYRKLDE----DERALHCFKTVLERW 596
           P A K+ K   E     + D  SV    YL +G     L+      E  +    ++LE++
Sbjct: 101 PAAAKYLKNLLE--KQLEYDTDSV---DYLQVGKKLIALERPALSTELWMKKLLSLLEKF 155

Query: 597 KPSANVWCALATVYLKMKKLQKAIDALHSVLAMEP 631
              A +W  LA  Y K+ +  +AI     VL + P
Sbjct: 156 PLDAELWWTLAMEYYKLGQFDQAIYCFEEVLLISP 190

>CAGL0K05599g 544932..547064 similar to tr|Q08496 Saccharomyces
           cerevisiae YOR080w, hypothetical start
          Length = 710

 Score = 30.0 bits (66), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 529 ELGVVYFKKMDYPRAKKFFKRACEAINMQQSD 560
           ELG  YFK  DY +A+  F++A + ++    D
Sbjct: 12  ELGTTYFKSEDYRKARSLFEKALKLVDSYSKD 43

>Scas_721.64
          Length = 578

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 27/42 (64%)

Query: 249 ESSLCYLRGEIYSAQNNLDLAKECFKEAVCVDVKNFEAFDRL 290
           ++ L  +RG +Y A+++ D   ECFKE++ ++  +   ++RL
Sbjct: 430 DAKLELIRGLLYYAEDDFDKTIECFKESLKINPNDEVMWNRL 471

>Kwal_55.22039
          Length = 904

 Score = 30.0 bits (66), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 34/89 (38%), Gaps = 10/89 (11%)

Query: 394 YVQCLYELGGKNKLFLVSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDP 453
           YV CL  L     L+          P +  TW+  G        +  A + F++   LD 
Sbjct: 618 YVACLKHLNESLSLY----------PLAFDTWYFYGCVGLECGKMELAAEAFTRCVSLDS 667

Query: 454 NFGYAWLGFAHTYAVEGEHEQALSAYSTA 482
               +W   +  Y  +G+ ++A S  S A
Sbjct: 668 THSLSWSNLSAAYIEQGKLKEAHSCLSKA 696

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.133    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,041,748
Number of extensions: 931594
Number of successful extensions: 3019
Number of sequences better than 10.0: 80
Number of HSP's gapped: 2944
Number of HSP's successfully gapped: 131
Length of query: 694
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 585
Effective length of database: 12,822,747
Effective search space: 7501306995
Effective search space used: 7501306995
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)