Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR167C37236516400.0
Sklu_2380.737436712551e-173
Scas_628.537236512461e-172
CAGL0F06875g37236512391e-171
YIR034C (LYS1)37336612131e-167
KLLA0E07964g37236511971e-165
Kwal_14.88037336211671e-160
Sklu_2001.351534628.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR167C
         (365 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR167C [1214] [Homologous to ScYIR034C (LYS1) - SH] (649155..65...   636   0.0  
Sklu_2380.7 YIR034C, Contig c2380 16828-17952                         488   e-173
Scas_628.5                                                            484   e-172
CAGL0F06875g complement(673222..674340) highly similar to sp|P38...   481   e-171
YIR034C (LYS1) [2698] chr9 complement(419612..420733) Saccharopi...   471   e-167
KLLA0E07964g complement(718820..719938) similar to sp|P38998 Sac...   465   e-165
Kwal_14.880                                                           454   e-160
Sklu_2001.3 YGR229C, Contig c2001 4395-5942                            28   8.9  

>ACR167C [1214] [Homologous to ScYIR034C (LYS1) - SH]
           (649155..650273) [1119 bp, 372 aa]
          Length = 372

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/365 (86%), Positives = 315/365 (86%)

Query: 1   MSAILHLRAETKPMEARAALTPTTVRTLVSHGFKIYVEESXXXXXXXXXXXXXXXXXXXT 60
           MSAILHLRAETKPMEARAALTPTTVRTLVSHGFKIYVEES                   T
Sbjct: 1   MSAILHLRAETKPMEARAALTPTTVRTLVSHGFKIYVEESAQSVFEAAEYAAAGAEVVAT 60

Query: 61  GSWRGAPRERIIVGLKELPEEDTFPLEHTHIQFAHCYKNQSGWREVLGRFQSGGGLLYDL 120
           GSWRGAPRERIIVGLKELPEEDTFPLEHTHIQFAHCYKNQSGWREVLGRFQSGGGLLYDL
Sbjct: 61  GSWRGAPRERIIVGLKELPEEDTFPLEHTHIQFAHCYKNQSGWREVLGRFQSGGGLLYDL 120

Query: 121 EFLQDDRGRRVXXXXXXXXXXXXXXXXRDWAWKQTHTDAEDLPAVAPYENEQALVSEVAA 180
           EFLQDDRGRRV                RDWAWKQTHTDAEDLPAVAPYENEQALVSEVAA
Sbjct: 121 EFLQDDRGRRVAAFGYYAGFAGAALGLRDWAWKQTHTDAEDLPAVAPYENEQALVSEVAA 180

Query: 181 ACEEAYKKGARKPRVLVIGALGRCGSGAVELLRQCGLHDKHIIRWDIAETARGGPFPEIA 240
           ACEEAYKKGARKPRVLVIGALGRCGSGAVELLRQCGLHDKHIIRWDIAETARGGPFPEIA
Sbjct: 181 ACEEAYKKGARKPRVLVIGALGRCGSGAVELLRQCGLHDKHIIRWDIAETARGGPFPEIA 240

Query: 241 AADIFINCIYLSQPIAPFINMELLDRPDRKLRTIVDVSADTTNPHNPVPVYNXXXXXXXX 300
           AADIFINCIYLSQPIAPFINMELLDRPDRKLRTIVDVSADTTNPHNPVPVYN        
Sbjct: 241 AADIFINCIYLSQPIAPFINMELLDRPDRKLRTIVDVSADTTNPHNPVPVYNVATVFSSP 300

Query: 301 XXXXXXXQGPKLSVISIDHLPSLLPREASEAFASDLLPSLLQLPERDTAPVWLRAKELFQ 360
                  QGPKLSVISIDHLPSLLPREASEAFASDLLPSLLQLPERDTAPVWLRAKELFQ
Sbjct: 301 TVVVPTSQGPKLSVISIDHLPSLLPREASEAFASDLLPSLLQLPERDTAPVWLRAKELFQ 360

Query: 361 QHCER 365
           QHCER
Sbjct: 361 QHCER 365

>Sklu_2380.7 YIR034C, Contig c2380 16828-17952
          Length = 374

 Score =  488 bits (1255), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 235/367 (64%), Positives = 278/367 (75%), Gaps = 2/367 (0%)

Query: 1   MSA--ILHLRAETKPMEARAALTPTTVRTLVSHGFKIYVEESXXXXXXXXXXXXXXXXXX 58
           MSA   LHLRAETKPMEARAALTPTTV+ L+S GFKIYVEES                  
Sbjct: 1   MSAPVTLHLRAETKPMEARAALTPTTVKKLLSKGFKIYVEESEQSTFDINEYREAGAEIV 60

Query: 59  XTGSWRGAPRERIIVGLKELPEEDTFPLEHTHIQFAHCYKNQSGWREVLGRFQSGGGLLY 118
            TGSW  AP++RII+GLKE+PE DTFPL H HIQFAHCYKNQ+GW++VLGRF+ G G LY
Sbjct: 61  PTGSWVNAPKDRIIIGLKEMPETDTFPLVHEHIQFAHCYKNQAGWQDVLGRFKRGNGTLY 120

Query: 119 DLEFLQDDRGRRVXXXXXXXXXXXXXXXXRDWAWKQTHTDAEDLPAVAPYENEQALVSEV 178
           DLEFL++D+GRRV                RDW++KQ H+D +DLPAV+PY NE+AL+ +V
Sbjct: 121 DLEFLENDQGRRVAAFGFYAGFAGAALGLRDWSFKQLHSDNQDLPAVSPYPNEKALIKDV 180

Query: 179 AAACEEAYKKGARKPRVLVIGALGRCGSGAVELLRQCGLHDKHIIRWDIAETARGGPFPE 238
               + A KKGA+KPRVL+IGALGRCGSGAV+LL + G+ D++I++WDI ET+RGGPF E
Sbjct: 181 VNDYQAALKKGAKKPRVLIIGALGRCGSGAVDLLHKAGVSDENILKWDIKETSRGGPFEE 240

Query: 239 IAAADIFINCIYLSQPIAPFINMELLDRPDRKLRTIVDVSADTTNPHNPVPVYNXXXXXX 298
           IA ADIFINCIYLS+PIAPFIN ELL++ +RKLRT+VDVSADTTNPHNPVP+Y       
Sbjct: 241 IAQADIFINCIYLSKPIAPFINYELLNKKNRKLRTVVDVSADTTNPHNPVPIYEIATVFS 300

Query: 299 XXXXXXXXXQGPKLSVISIDHLPSLLPREASEAFASDLLPSLLQLPERDTAPVWLRAKEL 358
                     GPKLSVISIDHLPSLLPRE+SE FA DLLPSL QLPER TAPVW++AK+L
Sbjct: 301 SPTVLVPTTAGPKLSVISIDHLPSLLPRESSEFFAHDLLPSLEQLPERYTAPVWVKAKKL 360

Query: 359 FQQHCER 365
           F +HC R
Sbjct: 361 FDKHCAR 367

>Scas_628.5
          Length = 372

 Score =  484 bits (1246), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 230/365 (63%), Positives = 276/365 (75%)

Query: 1   MSAILHLRAETKPMEARAALTPTTVRTLVSHGFKIYVEESXXXXXXXXXXXXXXXXXXXT 60
           M+  LHLRAETKP+EARAALTPTTV+ L++ GFKIYVE+S                    
Sbjct: 1   MTVTLHLRAETKPLEARAALTPTTVKQLIAKGFKIYVEDSPQSIFHIDEYKKAGAIIVPA 60

Query: 61  GSWRGAPRERIIVGLKELPEEDTFPLEHTHIQFAHCYKNQSGWREVLGRFQSGGGLLYDL 120
           GSW  APR+RII+GLKE+PE D FPL H HIQFAHCYKNQ+GW++VL RF +G G LYDL
Sbjct: 61  GSWISAPRDRIIIGLKEMPETDKFPLVHEHIQFAHCYKNQAGWKDVLTRFINGNGTLYDL 120

Query: 121 EFLQDDRGRRVXXXXXXXXXXXXXXXXRDWAWKQTHTDAEDLPAVAPYENEQALVSEVAA 180
           EFL+DD GRRV                RDWA+KQTH+DAEDLPAV+PY NE+AL+ +++ 
Sbjct: 121 EFLEDDEGRRVAAFGFYAGFAGAALGLRDWAFKQTHSDAEDLPAVSPYPNEKALIKDISI 180

Query: 181 ACEEAYKKGARKPRVLVIGALGRCGSGAVELLRQCGLHDKHIIRWDIAETARGGPFPEIA 240
             + A KKGA+KP VL+IGALGRCGSGA++LLR+ GL +++II+WD+ ETARGGPFPEIA
Sbjct: 181 EYKNALKKGAKKPTVLIIGALGRCGSGAIDLLRKIGLPEENIIKWDMKETARGGPFPEIA 240

Query: 241 AADIFINCIYLSQPIAPFINMELLDRPDRKLRTIVDVSADTTNPHNPVPVYNXXXXXXXX 300
            ADIFINCIYLS+PI PFIN +LL++  R+LRT+VDVSADTTNPHNP+P+YN        
Sbjct: 241 QADIFINCIYLSKPIPPFINYDLLNKDTRRLRTVVDVSADTTNPHNPIPIYNIATVFNKP 300

Query: 301 XXXXXXXQGPKLSVISIDHLPSLLPREASEAFASDLLPSLLQLPERDTAPVWLRAKELFQ 360
                   GPKLSVISIDHLPSLLPREASE FA DLLPSL QLPER TAPVW++A++LF 
Sbjct: 301 TVLVPTTAGPKLSVISIDHLPSLLPREASEFFARDLLPSLEQLPERYTAPVWVKAEKLFN 360

Query: 361 QHCER 365
           +HC R
Sbjct: 361 RHCAR 365

>CAGL0F06875g complement(673222..674340) highly similar to sp|P38998
           Saccharomyces cerevisiae YIR034c LYS1 saccharopine
           dehydrogenase, hypothetical start
          Length = 372

 Score =  481 bits (1239), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 228/365 (62%), Positives = 272/365 (74%)

Query: 1   MSAILHLRAETKPMEARAALTPTTVRTLVSHGFKIYVEESXXXXXXXXXXXXXXXXXXXT 60
           MS  LHLR ETKP+E RAALTPTTV+ L+  GFKIYVEES                    
Sbjct: 1   MSVTLHLRGETKPLEHRAALTPTTVKHLIGKGFKIYVEESPQSIFKIDEYRRAGAIIVPF 60

Query: 61  GSWRGAPRERIIVGLKELPEEDTFPLEHTHIQFAHCYKNQSGWREVLGRFQSGGGLLYDL 120
           GSW  APR+RII+GLKE+PEED FPL H HIQFAHCYK+Q+GW++VL RF +G G LYDL
Sbjct: 61  GSWISAPRDRIIIGLKEMPEEDKFPLVHEHIQFAHCYKDQAGWKDVLRRFINGNGTLYDL 120

Query: 121 EFLQDDRGRRVXXXXXXXXXXXXXXXXRDWAWKQTHTDAEDLPAVAPYENEQALVSEVAA 180
           EFL+DD GRRV                 DWA+KQTH D+EDLPAV+PY NE+AL+ ++  
Sbjct: 121 EFLEDDNGRRVAAFGFYAGFAGAALGLADWAFKQTHKDSEDLPAVSPYPNEKALIKDIGK 180

Query: 181 ACEEAYKKGARKPRVLVIGALGRCGSGAVELLRQCGLHDKHIIRWDIAETARGGPFPEIA 240
           A + A K GA+KP+VL+IGALGRCGSGA++ L++ GL +++II+WDI ET+RGGPFPEIA
Sbjct: 181 AYKNALKTGAKKPKVLIIGALGRCGSGAIDFLKKVGLPEENIIKWDIQETSRGGPFPEIA 240

Query: 241 AADIFINCIYLSQPIAPFINMELLDRPDRKLRTIVDVSADTTNPHNPVPVYNXXXXXXXX 300
           A+DIFINCIYLS+PIAPFIN ELL++PDRKLRT+VDVSADTTNPHNP+P+YN        
Sbjct: 241 ASDIFINCIYLSKPIAPFINYELLNKPDRKLRTVVDVSADTTNPHNPIPIYNIATVFNKP 300

Query: 301 XXXXXXXQGPKLSVISIDHLPSLLPREASEAFASDLLPSLLQLPERDTAPVWLRAKELFQ 360
                   GPKLSVISIDHLPSLLPREASE FA DLLPSL QLP R  +PVW+RA++LF 
Sbjct: 301 TVKVNTSSGPKLSVISIDHLPSLLPREASEFFAHDLLPSLEQLPSRHVSPVWVRAEKLFN 360

Query: 361 QHCER 365
           +H  R
Sbjct: 361 RHSAR 365

>YIR034C (LYS1) [2698] chr9 complement(419612..420733) Saccharopine
           dehydrogenase (NAD+, L-lysine forming), catalyzes the
           eighth and final step in lysine biosynthesis pathway
           [1122 bp, 373 aa]
          Length = 373

 Score =  471 bits (1213), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 227/366 (62%), Positives = 271/366 (74%), Gaps = 1/366 (0%)

Query: 1   MSAI-LHLRAETKPMEARAALTPTTVRTLVSHGFKIYVEESXXXXXXXXXXXXXXXXXXX 59
           M+A+ LHLRAETKP+EARAALTPTTV+ L++ GFKIYVE+S                   
Sbjct: 1   MAAVTLHLRAETKPLEARAALTPTTVKKLIAKGFKIYVEDSPQSTFNINEYRQAGAIIVP 60

Query: 60  TGSWRGAPRERIIVGLKELPEEDTFPLEHTHIQFAHCYKNQSGWREVLGRFQSGGGLLYD 119
            GSW+ APR+RII+GLKE+PE DTFPL H HIQFAHCYK+Q+GW+ VL RF  G G LYD
Sbjct: 61  AGSWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKDQAGWQNVLMRFIKGHGTLYD 120

Query: 120 LEFLQDDRGRRVXXXXXXXXXXXXXXXXRDWAWKQTHTDAEDLPAVAPYENEQALVSEVA 179
           LEFL++D+GRRV                RDWA+KQTH+D EDLPAV+PY NE+ALV +V 
Sbjct: 121 LEFLENDQGRRVAAFGFYAGFAGAALGVRDWAFKQTHSDDEDLPAVSPYPNEKALVKDVT 180

Query: 180 AACEEAYKKGARKPRVLVIGALGRCGSGAVELLRQCGLHDKHIIRWDIAETARGGPFPEI 239
              +EA   GARKP VL+IGALGRCGSGA++LL + G+ D +I++WDI ET+RGGPF EI
Sbjct: 181 KDYKEALATGARKPTVLIIGALGRCGSGAIDLLHKVGIPDANILKWDIKETSRGGPFDEI 240

Query: 240 AAADIFINCIYLSQPIAPFINMELLDRPDRKLRTIVDVSADTTNPHNPVPVYNXXXXXXX 299
             ADIFINCIYLS+PIAPF NME L+ P+R+LRT+VDVSADTTNPHNP+P+Y        
Sbjct: 241 PQADIFINCIYLSKPIAPFTNMEKLNNPNRRLRTVVDVSADTTNPHNPIPIYTVATVFNK 300

Query: 300 XXXXXXXXQGPKLSVISIDHLPSLLPREASEAFASDLLPSLLQLPERDTAPVWLRAKELF 359
                    GPKLSVISIDHLPSLLPREASE F+ DLLPSL  LP+R TAPVW+RAK+LF
Sbjct: 301 PTVLVPTTAGPKLSVISIDHLPSLLPREASEFFSHDLLPSLELLPQRKTAPVWVRAKKLF 360

Query: 360 QQHCER 365
            +HC R
Sbjct: 361 DRHCAR 366

>KLLA0E07964g complement(718820..719938) similar to sp|P38998
           Saccharomyces cerevisiae YIR034c LYS1 saccharopine
           dehydrogenase singleton, start by similarity
          Length = 372

 Score =  465 bits (1197), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 218/365 (59%), Positives = 271/365 (74%)

Query: 1   MSAILHLRAETKPMEARAALTPTTVRTLVSHGFKIYVEESXXXXXXXXXXXXXXXXXXXT 60
           MS  LHLRAETKP+EAR ALTPTT + L+  GFKI+VEES                    
Sbjct: 1   MSVTLHLRAETKPLEARTALTPTTTKKLLDKGFKIFVEESSQSAFDIEEYKKVGATIVPE 60

Query: 61  GSWRGAPRERIIVGLKELPEEDTFPLEHTHIQFAHCYKNQSGWREVLGRFQSGGGLLYDL 120
           GSW+ APR+RII+GLKE+PE DTFPL H HIQFAHCYKNQ+GW +VL RF+ G G+LYDL
Sbjct: 61  GSWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKNQAGWEDVLSRFKRGNGVLYDL 120

Query: 121 EFLQDDRGRRVXXXXXXXXXXXXXXXXRDWAWKQTHTDAEDLPAVAPYENEQALVSEVAA 180
           EFL++D+GRRV                RDWA+KQTH+D+E+L A+ PYENE+A++ +V  
Sbjct: 121 EFLENDQGRRVAAFGFYAGFAGAAVGIRDWAFKQTHSDSENLGAIEPYENEEAMIKDVRR 180

Query: 181 ACEEAYKKGARKPRVLVIGALGRCGSGAVELLRQCGLHDKHIIRWDIAETARGGPFPEIA 240
             + A K+GARKP+VL+IGALGRCGSGA +LLR+CGL +++II+WD+ ETARGGPF EIA
Sbjct: 181 DYQLALKRGARKPKVLIIGALGRCGSGAADLLRKCGLPEENIIKWDMKETARGGPFQEIA 240

Query: 241 AADIFINCIYLSQPIAPFINMELLDRPDRKLRTIVDVSADTTNPHNPVPVYNXXXXXXXX 300
            AD+FINCIYLS+PI PFIN ELL++P R+LRT+VDVSADTTNPHNPVP+Y         
Sbjct: 241 DADVFINCIYLSKPIPPFINNELLNKPTRRLRTVVDVSADTTNPHNPVPIYTINTTFDAP 300

Query: 301 XXXXXXXQGPKLSVISIDHLPSLLPREASEAFASDLLPSLLQLPERDTAPVWLRAKELFQ 360
                   GPKLSV SIDHLPSLLP+EASE+F+ DLLPSL QLP+R TA VW++A+ L++
Sbjct: 301 TVQVPTTVGPKLSVCSIDHLPSLLPKEASESFSRDLLPSLEQLPQRATASVWVKARNLYE 360

Query: 361 QHCER 365
           +   +
Sbjct: 361 KFAAK 365

>Kwal_14.880
          Length = 373

 Score =  454 bits (1167), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 228/362 (62%), Positives = 265/362 (73%)

Query: 4   ILHLRAETKPMEARAALTPTTVRTLVSHGFKIYVEESXXXXXXXXXXXXXXXXXXXTGSW 63
           ILHLRAETK  EARAALTPTTV+ L++ GFKIYVEES                    GSW
Sbjct: 5   ILHLRAETKDQEARAALTPTTVQKLIAKGFKIYVEESEQSTFSIEEYKKAGAEIVPKGSW 64

Query: 64  RGAPRERIIVGLKELPEEDTFPLEHTHIQFAHCYKNQSGWREVLGRFQSGGGLLYDLEFL 123
             AP++RII+GLKELPEEDTFPL H HIQFAHCYKNQ+GW++VLGRF+ G G LYDLEFL
Sbjct: 65  VNAPKDRIIIGLKELPEEDTFPLVHEHIQFAHCYKNQAGWQDVLGRFKRGHGTLYDLEFL 124

Query: 124 QDDRGRRVXXXXXXXXXXXXXXXXRDWAWKQTHTDAEDLPAVAPYENEQALVSEVAAACE 183
           ++D+GRRV                +DWA+KQTH+D+EDLP V P+ NE  LV +V    +
Sbjct: 125 ENDQGRRVAAFGFYAGFAGAALGLKDWAFKQTHSDSEDLPGVTPFPNEHELVKDVVGDYK 184

Query: 184 EAYKKGARKPRVLVIGALGRCGSGAVELLRQCGLHDKHIIRWDIAETARGGPFPEIAAAD 243
            A KKGA+KP VL+IGALGRCGSGAV++LR+ G+ +K+II+WD+ ETARGGPF EIA AD
Sbjct: 185 AALKKGAKKPTVLIIGALGRCGSGAVDMLRKAGIPEKNIIKWDMKETARGGPFQEIAQAD 244

Query: 244 IFINCIYLSQPIAPFINMELLDRPDRKLRTIVDVSADTTNPHNPVPVYNXXXXXXXXXXX 303
           IFINCIYLS+PIAPFIN  LL+   R+LR+IVDVSADTTN HNPVPVY            
Sbjct: 245 IFINCIYLSKPIAPFINSTLLNSKSRRLRSIVDVSADTTNVHNPVPVYTIATVFSKPTVL 304

Query: 304 XXXXQGPKLSVISIDHLPSLLPREASEAFASDLLPSLLQLPERDTAPVWLRAKELFQQHC 363
                GPKLSVISIDHLPSLLPRE+SE FA DLLPSL QLP RD APVW RAK L+ +HC
Sbjct: 305 VPTTAGPKLSVISIDHLPSLLPRESSEFFAHDLLPSLEQLPYRDQAPVWARAKALYHKHC 364

Query: 364 ER 365
            R
Sbjct: 365 AR 366

>Sklu_2001.3 YGR229C, Contig c2001 4395-5942
          Length = 515

 Score = 28.5 bits (62), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%)

Query: 323 LLPREASEAFASDLLPSLLQLPERDTAPVWLRAK 356
           LL REASEA +S L  S + LP     P  L+ K
Sbjct: 183 LLQREASEAASSQLKGSTVDLPNASVTPQALKTK 216

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,167,472
Number of extensions: 365203
Number of successful extensions: 723
Number of sequences better than 10.0: 9
Number of HSP's gapped: 706
Number of HSP's successfully gapped: 9
Length of query: 365
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 262
Effective length of database: 13,030,455
Effective search space: 3413979210
Effective search space used: 3413979210
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)