Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR114C2342309961e-138
Kwal_26.86942882204392e-53
KLLA0D07238g2831914131e-49
YOR228C3021913707e-43
CAGL0J04004g2882153157e-35
Scas_640.203022302912e-31
Scas_692.3628226616.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR114C
         (230 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR114C [1161] [Homologous to ScYOR228C - SH] (553753..554457) [...   388   e-138
Kwal_26.8694                                                          173   2e-53
KLLA0D07238g complement(618435..619286) weakly similar to sgd|S0...   163   1e-49
YOR228C (YOR228C) [5019] chr15 complement(766869..767777) Protei...   147   7e-43
CAGL0J04004g 375642..376508 similar to tr|Q12106 Saccharomyces c...   125   7e-35
Scas_640.20                                                           116   2e-31
Scas_692.36                                                            28   6.3  

>ACR114C [1161] [Homologous to ScYOR228C - SH] (553753..554457) [705
           bp, 234 aa]
          Length = 234

 Score =  388 bits (996), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 200/230 (86%), Positives = 200/230 (86%)

Query: 1   MVFGYMPLHLTNTLFVPLIEPTYAPNDVLRMVRELLPAATDQVLVWTVGVHVAAGVALRA 60
           MVFGYMPLHLTNTLFVPLIEPTYAPNDVLRMVRELLPAATDQVLVWTVGVHVAAGVALRA
Sbjct: 1   MVFGYMPLHLTNTLFVPLIEPTYAPNDVLRMVRELLPAATDQVLVWTVGVHVAAGVALRA 60

Query: 61  MSXXXXXXXXXXXXXXXXESDTSPRRIGLIGGLSGYFLGLNKTVRHNPHAVSGYLLVPLL 120
           MS                ESDTSPRRIGLIGGLSGYFLGLNKTVRHNPHAVSGYLLVPLL
Sbjct: 61  MSWYRRWTRRGRRYVTRVESDTSPRRIGLIGGLSGYFLGLNKTVRHNPHAVSGYLLVPLL 120

Query: 121 AYHAALMKWLPARAGVDVDFDFVQWLLYGGTGSAWTRWGLGIMPLAGLVSVGAYHMFTGL 180
           AYHAALMKWLPARAGVDVDFDFVQWLLYGGTGSAWTRWGLGIMPLAGLVSVGAYHMFTGL
Sbjct: 121 AYHAALMKWLPARAGVDVDFDFVQWLLYGGTGSAWTRWGLGIMPLAGLVSVGAYHMFTGL 180

Query: 181 VQLLRWRSLALRRKXXXXXXXXXXXXXXSLWRLSTVRPIMNVQYHRILQQ 230
           VQLLRWRSLALRRK              SLWRLSTVRPIMNVQYHRILQQ
Sbjct: 181 VQLLRWRSLALRRKVFNVVVGINVVGLVSLWRLSTVRPIMNVQYHRILQQ 230

>Kwal_26.8694
          Length = 288

 Score =  173 bits (439), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 90/220 (40%), Positives = 124/220 (56%), Gaps = 5/220 (2%)

Query: 5   YMPLHLTNTLFVPLIEPTYAPNDVLRMVRELLPAATDQVLVWTVGVHVAAGVALRAMSXX 64
           Y PLH  NTL VP I    APND+L M+RE+LP  T ++L W++  HVA+G ALR  S  
Sbjct: 57  YFPLHALNTLVVPAISTESAPNDILMMIREVLPGFTSRLLTWSITAHVASGFALRIWSLA 116

Query: 65  XXXXXXXXXXXXXXESDT---SPRRIGLIGGLSGYFLGLNKTVRHNPHAVSGYLLVPLLA 121
                         +      S R+IGLIGGLSGYF+G++K + +NP  VSGY+L+P++ 
Sbjct: 117 SRWTKLKKRGRSIPQDQKERESQRQIGLIGGLSGYFIGVSKQLAYNPQVVSGYILLPIIW 176

Query: 122 YHAALMKWLPARAGVDVDFDFVQWLLYGGTGSAWTRWGLGIMPLAGLVSVGAYHMFTGLV 181
           YHA LMK +P    +D+DFDFV+W+L     S W +W  GI+PL+ L+   +YH+  G  
Sbjct: 177 YHARLMKKIPTAEDIDIDFDFVKWVL--QNDSVWIKWFGGIIPLSILIWTASYHIVAGFC 234

Query: 182 QLLRWRSLALRRKXXXXXXXXXXXXXXSLWRLSTVRPIMN 221
              + R L +R+               SLWRLS   P+  
Sbjct: 235 TYAKIRRLDVRKAMSTLVFSLTATGFFSLWRLSKSLPVFE 274

>KLLA0D07238g complement(618435..619286) weakly similar to
           sgd|S0005754 Saccharomyces cerevisiae YOR228c, start by
           similarity
          Length = 283

 Score =  163 bits (413), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 84/191 (43%), Positives = 115/191 (60%), Gaps = 3/191 (1%)

Query: 5   YMPLHLTNTLFVPLIEPTYAPNDVLRMVRELLPAATDQVLVWT-VGVHVAAGVALRAMSX 63
           Y PLH  N L +P +EP+  PND L MVREL      + L+WT + +H+ +G ALR M  
Sbjct: 54  YFPLHGINALIIPALEPSSFPNDALMMVRELTSGLGSK-LIWTGISIHILSGFALRIMRK 112

Query: 64  XXXXXXXXXXXXXXXESDTSPRRIGLIGGLSGYFLGLNKTVRHNPHAVSGYLLVPLLAYH 123
                              +  RIGL+GGLSGYF+G+ + +++NP  ++G+LL P+L +H
Sbjct: 113 LPTSSKTHNAESLLDTQSLAQSRIGLVGGLSGYFIGIKRNLQYNPQELTGWLLTPVLFFH 172

Query: 124 AALMKWLPARAGVDVDFDFVQWLLYGGTGSAWTRWGLGIMPLAGLVSVGAYHMFTGLVQL 183
            ALMKWLP  A VD+DFDFV+WLL    G A  R GLG  PL  L+ +G+YH+  G VQ 
Sbjct: 173 GALMKWLPNTAKVDIDFDFVKWLLDKDRG-ALVRIGLGYGPLVALIGLGSYHIIAGTVQY 231

Query: 184 LRWRSLALRRK 194
           +  RSL  R++
Sbjct: 232 MHVRSLKTRKR 242

>YOR228C (YOR228C) [5019] chr15 complement(766869..767777) Protein
           of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.5264p [909 bp, 302 aa]
          Length = 302

 Score =  147 bits (370), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 111/191 (58%), Gaps = 3/191 (1%)

Query: 5   YMPLHLTNTLFVPLIEPTYAPNDVLRMVRELLPAATDQVLVWTVGVHVAAGVALRAMSX- 63
           Y PLH  NTL  P + P  AP+DVL MVRE+LP+ T ++LV  + +HV+AGV LR ++  
Sbjct: 68  YFPLHAANTLITPAVSPDSAPDDVLMMVREILPSITTKLLVAGITLHVSAGVLLRIVNNW 127

Query: 64  XXXXXXXXXXXXXXXESDTSPRRIGLIGGLSGYFLGLNKTVRHNPHAVSGYLLVPLLAYH 123
                          E D S   IGL GG+SGY  GL KT R  P  +SGY+LVP+L YH
Sbjct: 128 NKPRRNRHRHLKISAEQDLSQDSIGLTGGISGYLFGLYKTFRIPPQVISGYILVPVLIYH 187

Query: 124 AALMKWLPARAGVDVDFDFVQWLLYGGTGSAWTRWGLGIMPLAGLVSVGAYHMFTGLVQL 183
             +MKW+P     +VDF  ++ LL   + + W +W  G++PLA L+  G YH+ +GL + 
Sbjct: 188 LLIMKWVPNSISTEVDFASIKQLL--SSKNRWWKWLGGLVPLAILLESGVYHIGSGLCRY 245

Query: 184 LRWRSLALRRK 194
              R +  R+K
Sbjct: 246 FGVRKMTSRKK 256

>CAGL0J04004g 375642..376508 similar to tr|Q12106 Saccharomyces
           cerevisiae YOR228c, hypothetical start
          Length = 288

 Score =  125 bits (315), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 107/215 (49%), Gaps = 4/215 (1%)

Query: 5   YMPLHLTNTLFVPLIEPTYAPNDVLRMVRELLPAATDQVLVWTVGVHVAAGVALRAMSXX 64
           Y P+H  NT+  PL+ P  AP+  L  V + +P A  ++L+ ++  H+A+GV LR     
Sbjct: 55  YFPVHAVNTMITPLVNPETAPDSFLTAVHKWVPQAASKILIASLLTHIASGVLLRGWKLY 114

Query: 65  XXXXXXXXXXXXXX-ESDTSPRRIGLIGGLSGYFLGLNKTVRHNPHAVSGYLLVPLLAYH 123
                          +  TS   IGL GG+SGY  G+ K    +P ++SGY+L PL+ YH
Sbjct: 115 KSHVLKEKYHLHHQHKHTTSQDDIGLTGGISGYLFGIYKQFTLSPLSMSGYVLTPLVLYH 174

Query: 124 AALMKWLPARAGVDVD-FDFVQWLLYGGTGSAWTRWGLGIMPLAGLVSVGAYHMFTGLVQ 182
             +MKW+P   G     FDFV+ LL       W RW  GI+PL+ L+S  +YH+  G  +
Sbjct: 175 LLIMKWVPESLGEPATGFDFVKQLLRASEW--WIRWFAGIIPLSALISAASYHIVAGACR 232

Query: 183 LLRWRSLALRRKXXXXXXXXXXXXXXSLWRLSTVR 217
           LL  + +  R+               S+ RLS  +
Sbjct: 233 LLDVKDMKKRKNASRIISGLSIAGFLSILRLSNAK 267

>Scas_640.20
          Length = 302

 Score =  116 bits (291), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/230 (32%), Positives = 106/230 (46%), Gaps = 23/230 (10%)

Query: 5   YMPLHLTNTLFVPLIEPTYAPNDVLRMVRELLPAATDQVLVWTVGVHVAAGVALR----- 59
           Y P+H  NT  +PLI+P   P  VL ++RE  P    ++L+ ++ +H+A+GV LR     
Sbjct: 57  YFPVHSINTFGIPLIQPNKLPGRVLTIIREKSPLFLSRILIGSLVIHIASGVLLRVSHWL 116

Query: 60  ---------AMSXXXXXXXXXXXXXXXXESDTSPRRIGLIGGLSGYFLGLNKTVRHNPHA 110
                                         D S   IGL GG+ GYFLG  K  +H+P  
Sbjct: 117 YHFQRRMGEGEESEADHHLNHDASQLLVSEDISQGSIGLTGGIVGYFLGWRKKFKHSPLI 176

Query: 111 VSGYLLVPLLAYHAALMKW---LPARAGVDVDFDFVQWLLYGGTGSAWTRWGLGIMPLAG 167
           VSGYLL P L YH  +M+W    P   G    F FV WLL       W R   GI+PL+ 
Sbjct: 177 VSGYLLTPFLLYHVIIMRWGLVNPESKG----FTFVDWLL--TNSDWWIRVVGGIIPLSV 230

Query: 168 LVSVGAYHMFTGLVQLLRWRSLALRRKXXXXXXXXXXXXXXSLWRLSTVR 217
           L+  G YH+  G+ + L+ + +  R+K              S++RLS + 
Sbjct: 231 LIVSGTYHIGAGICKYLKIKDVNKRKKWAGGITLLSITGLISIFRLSMIE 280

>Scas_692.36
          Length = 282

 Score = 28.1 bits (61), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 18/26 (69%)

Query: 9  HLTNTLFVPLIEPTYAPNDVLRMVRE 34
          H  + +F+PLIE T  PN+ L +++E
Sbjct: 42 HGYDAVFIPLIEHTNIPNEALTLLKE 67

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.141    0.452 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,320,417
Number of extensions: 224584
Number of successful extensions: 531
Number of sequences better than 10.0: 8
Number of HSP's gapped: 520
Number of HSP's successfully gapped: 8
Length of query: 230
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 132
Effective length of database: 13,203,545
Effective search space: 1742867940
Effective search space used: 1742867940
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 60 (27.7 bits)