Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR112C1541518011e-111
Kwal_26.86801581316423e-87
KLLA0D07161g1801296262e-84
YPL135W (ISU1)1651516233e-84
Sklu_2012.41501446162e-83
YOR226C (ISU2)1561315947e-80
Scas_700.391611275879e-79
CAGL0M02629g2131575902e-78
Scas_640.221601275817e-78
CAGL0J04048g1451445762e-77
Sklu_1641.1462159700.23
Scas_657.385674622.7
YOL076W (MDM20)79662622.7
YDR502C (SAM2)38476596.0
AFR018C150830588.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR112C
         (151 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR112C [1159] [Homologous to ScYPL135W (ISU1) - SH; ScYOR226C (...   313   e-111
Kwal_26.8680                                                          251   3e-87
KLLA0D07161g complement(612348..612890) some similarities with s...   245   2e-84
YPL135W (ISU1) [5310] chr16 (297552..298049) Protein with simila...   244   3e-84
Sklu_2012.4 YPL135W, Contig c2012 4922-5374 reverse complement        241   2e-83
YOR226C (ISU2) [5017] chr15 complement(761614..762084) Protein w...   233   7e-80
Scas_700.39                                                           230   9e-79
CAGL0M02629g 303016..303657 some similarities with tr|Q03020 Sac...   231   2e-78
Scas_640.22                                                           228   7e-78
CAGL0J04048g 381327..381764 highly similar to tr|Q12056 Saccharo...   226   2e-77
Sklu_1641.1 YBL098W, Contig c1641 1163-2551                            32   0.23 
Scas_657.3                                                             28   2.7  
YOL076W (MDM20) [4744] chr15 (187023..189413) Protein required f...    28   2.7  
YDR502C (SAM2) [1317] chr4 complement(1453298..1454452) S-adenos...    27   6.0  
AFR018C [3210] [Homologous to ScYBL017C (PEP1) - SH] (466218..47...    27   8.0  

>ACR112C [1159] [Homologous to ScYPL135W (ISU1) - SH; ScYOR226C
           (ISU2) - SH] (549554..550018) [465 bp, 154 aa]
          Length = 154

 Score =  313 bits (801), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 151/151 (100%), Positives = 151/151 (100%)

Query: 1   MLGFRQTATAIVRPVGTIGYARRCYHPKVIDHYTNPRNVGTLDKKLTNVGTGLVGAPACG 60
           MLGFRQTATAIVRPVGTIGYARRCYHPKVIDHYTNPRNVGTLDKKLTNVGTGLVGAPACG
Sbjct: 1   MLGFRQTATAIVRPVGTIGYARRCYHPKVIDHYTNPRNVGTLDKKLTNVGTGLVGAPACG 60

Query: 61  DVMRLQIQVDDSTGVIENVKFKTFGCGSAIASSSYMTELVRGKTLADAEKIKNTEIAREL 120
           DVMRLQIQVDDSTGVIENVKFKTFGCGSAIASSSYMTELVRGKTLADAEKIKNTEIAREL
Sbjct: 61  DVMRLQIQVDDSTGVIENVKFKTFGCGSAIASSSYMTELVRGKTLADAEKIKNTEIAREL 120

Query: 121 SLPPVKLHCSMLAEDAIKAAIKDYRSKRKAT 151
           SLPPVKLHCSMLAEDAIKAAIKDYRSKRKAT
Sbjct: 121 SLPPVKLHCSMLAEDAIKAAIKDYRSKRKAT 151

>Kwal_26.8680
          Length = 158

 Score =  251 bits (642), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 120/131 (91%), Positives = 125/131 (95%)

Query: 21  ARRCYHPKVIDHYTNPRNVGTLDKKLTNVGTGLVGAPACGDVMRLQIQVDDSTGVIENVK 80
           ARR YHPKVIDHYTNPRNVG+LDKKL NVGTGLVGAPACGDVM+LQIQV+D TGVIENVK
Sbjct: 25  ARRAYHPKVIDHYTNPRNVGSLDKKLENVGTGLVGAPACGDVMKLQIQVNDETGVIENVK 84

Query: 81  FKTFGCGSAIASSSYMTELVRGKTLADAEKIKNTEIARELSLPPVKLHCSMLAEDAIKAA 140
           FKTFGCGSAIASSSYMTELVRGKTL  A +IKNTEIA+ELSLPPVKLHCSMLAEDAIKAA
Sbjct: 85  FKTFGCGSAIASSSYMTELVRGKTLDVASQIKNTEIAKELSLPPVKLHCSMLAEDAIKAA 144

Query: 141 IKDYRSKRKAT 151
           IKDYRSKRKAT
Sbjct: 145 IKDYRSKRKAT 155

>KLLA0D07161g complement(612348..612890) some similarities with
           sgd|S0006056 Saccharomyces cerevisiae YPL135w ISU1,
           hypothetical start
          Length = 180

 Score =  245 bits (626), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 116/129 (89%), Positives = 121/129 (93%)

Query: 23  RCYHPKVIDHYTNPRNVGTLDKKLTNVGTGLVGAPACGDVMRLQIQVDDSTGVIENVKFK 82
           R YHPKVIDHYTNPRNVG+LDK L NVGTGLVGAPACGDVM+LQIQV+D TGVIENVKFK
Sbjct: 49  RFYHPKVIDHYTNPRNVGSLDKNLPNVGTGLVGAPACGDVMKLQIQVNDETGVIENVKFK 108

Query: 83  TFGCGSAIASSSYMTELVRGKTLADAEKIKNTEIARELSLPPVKLHCSMLAEDAIKAAIK 142
           TFGCGSAIASSSYMTELVRGKTL DA KIKNTEIARELSLPPVKLHCSMLAEDAIKAAIK
Sbjct: 109 TFGCGSAIASSSYMTELVRGKTLEDAAKIKNTEIARELSLPPVKLHCSMLAEDAIKAAIK 168

Query: 143 DYRSKRKAT 151
           DY++KR  T
Sbjct: 169 DYQAKRPTT 177

>YPL135W (ISU1) [5310] chr16 (297552..298049) Protein with
           similarity to iron-sulfur cluster nitrogen fixation
           proteins [498 bp, 165 aa]
          Length = 165

 Score =  244 bits (623), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 119/151 (78%), Positives = 131/151 (86%), Gaps = 6/151 (3%)

Query: 4   FRQTATAIVRPVGTIGYAR------RCYHPKVIDHYTNPRNVGTLDKKLTNVGTGLVGAP 57
           F + A   +RPV  +G  R      R YHPKVI+HYT+PRNVG+LDKKL NVGTGLVGAP
Sbjct: 8   FARPALMAIRPVNAMGVLRASSITKRLYHPKVIEHYTHPRNVGSLDKKLPNVGTGLVGAP 67

Query: 58  ACGDVMRLQIQVDDSTGVIENVKFKTFGCGSAIASSSYMTELVRGKTLADAEKIKNTEIA 117
           ACGDVMRLQI+V+DSTGVIE+VKFKTFGCGSAIASSSYMTELV+G TL DA KIKNTEIA
Sbjct: 68  ACGDVMRLQIKVNDSTGVIEDVKFKTFGCGSAIASSSYMTELVQGMTLDDAAKIKNTEIA 127

Query: 118 RELSLPPVKLHCSMLAEDAIKAAIKDYRSKR 148
           +ELSLPPVKLHCSMLAEDAIKAAIKDY+SKR
Sbjct: 128 KELSLPPVKLHCSMLAEDAIKAAIKDYKSKR 158

>Sklu_2012.4 YPL135W, Contig c2012 4922-5374 reverse complement
          Length = 150

 Score =  241 bits (616), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 119/144 (82%), Positives = 126/144 (87%), Gaps = 8/144 (5%)

Query: 4   FRQT---ATAIVRPVGTIGYARRCYHPKVIDHYTNPRNVGTLDKKLTNVGTGLVGAPACG 60
           FR T   +  + RP+      RR YHPKVIDHYTNPRNVG+LDK LTNVGTGLVGAPACG
Sbjct: 2   FRNTFRFSAPVTRPL-----TRRLYHPKVIDHYTNPRNVGSLDKNLTNVGTGLVGAPACG 56

Query: 61  DVMRLQIQVDDSTGVIENVKFKTFGCGSAIASSSYMTELVRGKTLADAEKIKNTEIAREL 120
           DVM+LQIQV+D TGVIENVKFKTFGCGSAIASSSYMTELVRGKTL DA KI+NTEIAREL
Sbjct: 57  DVMKLQIQVNDDTGVIENVKFKTFGCGSAIASSSYMTELVRGKTLDDAAKIRNTEIAREL 116

Query: 121 SLPPVKLHCSMLAEDAIKAAIKDY 144
           SLPPVKLHCSMLAEDAIKAAIKDY
Sbjct: 117 SLPPVKLHCSMLAEDAIKAAIKDY 140

>YOR226C (ISU2) [5017] chr15 complement(761614..762084) Protein with
           similarity to iron-sulfur cluster nitrogen fixation
           proteins [471 bp, 156 aa]
          Length = 156

 Score =  233 bits (594), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 107/131 (81%), Positives = 122/131 (93%)

Query: 21  ARRCYHPKVIDHYTNPRNVGTLDKKLTNVGTGLVGAPACGDVMRLQIQVDDSTGVIENVK 80
           A+R YHPKVIDHYTNPRNVG++DK L NVGTG+VGAPACGDV++LQIQV+D +G+IENVK
Sbjct: 23  AKRLYHPKVIDHYTNPRNVGSMDKSLANVGTGIVGAPACGDVIKLQIQVNDKSGIIENVK 82

Query: 81  FKTFGCGSAIASSSYMTELVRGKTLADAEKIKNTEIARELSLPPVKLHCSMLAEDAIKAA 140
           FKTFGCGSAIASSSYMTELVRG +L +A KIKNTEIA+ELSLPPVKLHCSMLAEDAIKAA
Sbjct: 83  FKTFGCGSAIASSSYMTELVRGMSLDEAVKIKNTEIAKELSLPPVKLHCSMLAEDAIKAA 142

Query: 141 IKDYRSKRKAT 151
           IKDY++KR  +
Sbjct: 143 IKDYKTKRNPS 153

>Scas_700.39
          Length = 161

 Score =  230 bits (587), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 118/127 (92%)

Query: 22  RRCYHPKVIDHYTNPRNVGTLDKKLTNVGTGLVGAPACGDVMRLQIQVDDSTGVIENVKF 81
           RR YHPKVIDHYT+PRNVG+LDKK  NVGTGLVGAPACGDVMRLQIQV+D TG+IENVKF
Sbjct: 28  RRLYHPKVIDHYTHPRNVGSLDKKALNVGTGLVGAPACGDVMRLQIQVNDDTGIIENVKF 87

Query: 82  KTFGCGSAIASSSYMTELVRGKTLADAEKIKNTEIARELSLPPVKLHCSMLAEDAIKAAI 141
           KTFGCGSAIASSSYMTE+V+G ++ DA  IKNT+IA+ELSLPPVKLHCSMLAEDAIKAAI
Sbjct: 88  KTFGCGSAIASSSYMTEMVKGMSVNDAFLIKNTQIAKELSLPPVKLHCSMLAEDAIKAAI 147

Query: 142 KDYRSKR 148
            DY+SKR
Sbjct: 148 NDYKSKR 154

>CAGL0M02629g 303016..303657 some similarities with tr|Q03020
           Saccharomyces cerevisiae YPL135w ISU1 or tr|Q12056
           Saccharomyces cerevisiae YOR226c ISU2, hypothetical
           start
          Length = 213

 Score =  231 bits (590), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 117/157 (74%), Positives = 130/157 (82%), Gaps = 8/157 (5%)

Query: 2   LGFRQTATAIVRPVGTIG-------YARRCYHPKVIDHYTNPRNVGTLDKKLTNVGTGLV 54
           +G R T  A+   +G IG         RR YHPKVI+HYT+PRNVG++DK L NVGTGLV
Sbjct: 54  IGARSTMGAM-GAIGAIGAKGTMNNIGRRMYHPKVIEHYTHPRNVGSMDKTLPNVGTGLV 112

Query: 55  GAPACGDVMRLQIQVDDSTGVIENVKFKTFGCGSAIASSSYMTELVRGKTLADAEKIKNT 114
           GAPACGDVMRLQI+V+D TGVIE+VKFKTFGCGSAIASSSYMTELV G TL DA KIKNT
Sbjct: 113 GAPACGDVMRLQIKVNDKTGVIEDVKFKTFGCGSAIASSSYMTELVHGMTLDDAAKIKNT 172

Query: 115 EIARELSLPPVKLHCSMLAEDAIKAAIKDYRSKRKAT 151
            IA+ELSLPPVKLHCSMLAEDAIKAAIKDY+SKR +T
Sbjct: 173 TIAKELSLPPVKLHCSMLAEDAIKAAIKDYKSKRTST 209

>Scas_640.22
          Length = 160

 Score =  228 bits (581), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 104/127 (81%), Positives = 118/127 (92%)

Query: 22  RRCYHPKVIDHYTNPRNVGTLDKKLTNVGTGLVGAPACGDVMRLQIQVDDSTGVIENVKF 81
           +R YH KVI+HYTNPRNVG+LDK L+NVGTG+VGAPACGDV++LQIQV+D TG+IENVKF
Sbjct: 27  KRLYHAKVIEHYTNPRNVGSLDKSLSNVGTGIVGAPACGDVIKLQIQVNDDTGIIENVKF 86

Query: 82  KTFGCGSAIASSSYMTELVRGKTLADAEKIKNTEIARELSLPPVKLHCSMLAEDAIKAAI 141
           KTFGCGSAIASSSYMTELV G ++ DA KIKN EIA+ELSLPPVKLHCSMLAEDAIKAAI
Sbjct: 87  KTFGCGSAIASSSYMTELVNGMSVDDAAKIKNIEIAKELSLPPVKLHCSMLAEDAIKAAI 146

Query: 142 KDYRSKR 148
           KDY++KR
Sbjct: 147 KDYKTKR 153

>CAGL0J04048g 381327..381764 highly similar to tr|Q12056
           Saccharomyces cerevisiae YOR226c ISU2 or tr|Q03020
           Saccharomyces cerevisiae YPL135w ISU1, hypothetical
           start
          Length = 145

 Score =  226 bits (576), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 106/144 (73%), Positives = 126/144 (87%), Gaps = 6/144 (4%)

Query: 8   ATAIVRPVGTIGYARRCYHPKVIDHYTNPRNVGTLDKKLTNVGTGLVGAPACGDVMRLQI 67
           +T ++RP        R YHPKVI+HYTNPRNVG++DK L NVGTG+VGAPACGDV++LQI
Sbjct: 5   STRLMRPF------TRMYHPKVIEHYTNPRNVGSMDKTLRNVGTGVVGAPACGDVIKLQI 58

Query: 68  QVDDSTGVIENVKFKTFGCGSAIASSSYMTELVRGKTLADAEKIKNTEIARELSLPPVKL 127
           QV+D+TGVIE  KFKTFGCGSAIASSSY+TELV+G T+ DAEKIKN EIA+ELSLPPVKL
Sbjct: 59  QVNDNTGVIEEAKFKTFGCGSAIASSSYLTELVQGITIEDAEKIKNIEIAKELSLPPVKL 118

Query: 128 HCSMLAEDAIKAAIKDYRSKRKAT 151
           HCSMLAEDAIKAA++DY++KR +T
Sbjct: 119 HCSMLAEDAIKAAVRDYKTKRSST 142

>Sklu_1641.1 YBL098W, Contig c1641 1163-2551
          Length = 462

 Score = 31.6 bits (70), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 30/159 (18%), Positives = 64/159 (40%), Gaps = 26/159 (16%)

Query: 7   TATAIVRPVGTIGYARRCYHPKVIDHYTNPRNVGTLDKKLTNVGTGL------------- 53
               +V  + +I  A+R Y   + D+  +PR   T D+ L ++   +             
Sbjct: 8   VGAGLVGCLASIALAKRGYQVSLFDYREDPRKASTTDRNLRSINLAISDRGITSLKYIDE 67

Query: 54  -VGAPACGDVMRLQIQ-VDDSTGVIENVKFKTFG-CGSAIASSSYMTELVRGKTLADAEK 110
            +G     D++ ++ + + D  G  E+  +  FG C ++I  +     ++    L + +K
Sbjct: 68  EIGERVLKDIIPMKGRMIHDLQGNQESQIYGLFGECINSIDRA-----VLNNSLLGEVDK 122

Query: 111 IKNTEIARELSLPPVKLH-----CSMLAEDAIKAAIKDY 144
           +KN ++     L  +K       C    ED ++    D+
Sbjct: 123 LKNVQVEYAHKLVRIKFSDSVQTCLFSTEDGVRELGFDF 161

>Scas_657.3
          Length = 856

 Score = 28.5 bits (62), Expect = 2.7,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 33/74 (44%), Gaps = 6/74 (8%)

Query: 8   ATAIVRPVGTIGYARRCYHPKVIDHYTNPRNVGTLDKKLTNVGTGLVGAPACGDVMRLQI 67
           +T I R + T  YA     P     YT P +VG+ +       T ++ AP   D+M    
Sbjct: 63  STCIGRKLTTCVYADDNLSPN-DSRYTGPHSVGSSNSSHGTESTTMMQAPPPNDLM---- 117

Query: 68  QVDDSTGVIENVKF 81
             D  + ++E VK+
Sbjct: 118 -YDSESELVERVKY 130

>YOL076W (MDM20) [4744] chr15 (187023..189413) Protein required for
           transport of mitochondria into growing buds and for
           organization of actin cables, interacts genetically with
           Cin8p [2391 bp, 796 aa]
          Length = 796

 Score = 28.5 bits (62), Expect = 2.7,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 90  IASSSYMTELVRGKTLADAEKIKNTEIAREL--SLPPVKLHCSMLAEDAIKAAIKDYRSK 147
           + S +Y+T++   KTL   ++IK+ EI + +  SL  ++  C  + +   KA ++ Y   
Sbjct: 701 MVSHTYLTKMATLKTLDSLKRIKDKEIQKLIKNSLKELRSCCDDVFKGYSKALVQAYEEL 760

Query: 148 RK 149
           +K
Sbjct: 761 KK 762

>YDR502C (SAM2) [1317] chr4 complement(1453298..1454452)
           S-adenosylmethionine synthetase 2 [1155 bp, 384 aa]
          Length = 384

 Score = 27.3 bits (59), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 4/76 (5%)

Query: 49  VGTGLVGAPACGDVMRLQIQVDDSTGVIENVKFKTFGCGSAIASSSYMTELVRGK-TLAD 107
           V   LV A  C    R+Q+Q   + G+ E +       G+A  S   + E+++    L  
Sbjct: 290 VAKSLVAAGLC---KRVQVQFSYAIGIAEPLSLHVDTYGTATKSDDEIIEIIKKNFDLRP 346

Query: 108 AEKIKNTEIARELSLP 123
              +K  ++AR + LP
Sbjct: 347 GVLVKELDLARPIYLP 362

>AFR018C [3210] [Homologous to ScYBL017C (PEP1) - SH]
           (466218..470744) [4527 bp, 1508 aa]
          Length = 1508

 Score = 26.9 bits (58), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 18/30 (60%)

Query: 103 KTLADAEKIKNTEIARELSLPPVKLHCSML 132
           + L    KIK  E  ++L++ PVK+ CS +
Sbjct: 646 RELMPMHKIKGNECTKDLNIEPVKVDCSAV 675

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,343,462
Number of extensions: 160305
Number of successful extensions: 397
Number of sequences better than 10.0: 19
Number of HSP's gapped: 397
Number of HSP's successfully gapped: 19
Length of query: 151
Length of database: 16,596,109
Length adjustment: 92
Effective length of query: 59
Effective length of database: 13,411,253
Effective search space: 791263927
Effective search space used: 791263927
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 57 (26.6 bits)