Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR111C1441427591e-105
KLLA0D07139g1451435917e-80
Sklu_2012.31441425787e-78
Kwal_26.86781441435205e-69
YOR224C (RPB8)1461455111e-67
Scas_640.231471465051e-66
CAGL0J04070g1501494902e-64
YNL172W (APC1)174856613.2
ADL294C137229603.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR111C
         (142 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR111C [1158] [Homologous to ScYOR224C (RPB8) - SH] (548897..54...   296   e-105
KLLA0D07139g complement(611102..611539) similar to sp|P20436 Sac...   232   7e-80
Sklu_2012.3 YOR224C, Contig c2012 3508-3942 reverse complement        227   7e-78
Kwal_26.8678                                                          204   5e-69
YOR224C (RPB8) [5016] chr15 complement(760825..761265) Shared su...   201   1e-67
Scas_640.23                                                           199   1e-66
CAGL0J04070g 382116..382568 highly similar to sp|P20436 Saccharo...   193   2e-64
YNL172W (APC1) [4426] chr14 (310636..315882) Component of the an...    28   3.2  
ADL294C [1447] [Homologous to ScYDL112W (TRM3) - SH] (182882..18...    28   3.7  

>ACR111C [1158] [Homologous to ScYOR224C (RPB8) - SH]
           (548897..549331) [435 bp, 144 aa]
          Length = 144

 Score =  296 bits (759), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 142/142 (100%), Positives = 142/142 (100%)

Query: 1   MSSTLFDDIFTIQEVDQGRYNKVSRIEAISTSQDTCKLTLDVNTELFPLQPQQQLTVMLA 60
           MSSTLFDDIFTIQEVDQGRYNKVSRIEAISTSQDTCKLTLDVNTELFPLQPQQQLTVMLA
Sbjct: 1   MSSTLFDDIFTIQEVDQGRYNKVSRIEAISTSQDTCKLTLDVNTELFPLQPQQQLTVMLA 60

Query: 61  TTLNLDGTEDSHGSWRPPAPGARSLADDFDYVTYGTAYKFEEANGNKDMLAVYYSFGGLL 120
           TTLNLDGTEDSHGSWRPPAPGARSLADDFDYVTYGTAYKFEEANGNKDMLAVYYSFGGLL
Sbjct: 61  TTLNLDGTEDSHGSWRPPAPGARSLADDFDYVTYGTAYKFEEANGNKDMLAVYYSFGGLL 120

Query: 121 MRLEGNYRLLSNFKQENVYLLC 142
           MRLEGNYRLLSNFKQENVYLLC
Sbjct: 121 MRLEGNYRLLSNFKQENVYLLC 142

>KLLA0D07139g complement(611102..611539) similar to sp|P20436
           Saccharomyces cerevisiae YOR224c RPB8 DNA-directed RNA
           polymerase I, II, III 16 KD subunit singleton, start by
           similarity
          Length = 145

 Score =  232 bits (591), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 108/143 (75%), Positives = 123/143 (86%), Gaps = 1/143 (0%)

Query: 1   MSSTLFDDIFTIQEVDQGRYNKVSRIEAISTSQDTCKLTLDVNTELFPLQPQQQLTVMLA 60
           MSS LFDD+FT+QEVD GRYNKVSRIEA STSQ++CKLTLD+N+ELFP++ Q QL VM+ 
Sbjct: 1   MSSALFDDVFTVQEVDTGRYNKVSRIEAQSTSQESCKLTLDINSELFPIKTQDQLAVMIT 60

Query: 61  TTLNLDGTEDSHG-SWRPPAPGARSLADDFDYVTYGTAYKFEEANGNKDMLAVYYSFGGL 119
           T+L LDG+E+  G SWR P  G RSLADD+DYV YGTAYKFEE  GNKD+LAVYYSFGGL
Sbjct: 61  TSLQLDGSEEPQGTSWRAPPAGTRSLADDYDYVMYGTAYKFEEVKGNKDLLAVYYSFGGL 120

Query: 120 LMRLEGNYRLLSNFKQENVYLLC 142
           LMRLEGNYRLL+N KQEN YLLC
Sbjct: 121 LMRLEGNYRLLNNLKQENAYLLC 143

>Sklu_2012.3 YOR224C, Contig c2012 3508-3942 reverse complement
          Length = 144

 Score =  227 bits (578), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 106/142 (74%), Positives = 120/142 (84%)

Query: 1   MSSTLFDDIFTIQEVDQGRYNKVSRIEAISTSQDTCKLTLDVNTELFPLQPQQQLTVMLA 60
           MS+TLFDDIF +QEVDQGRYNKVSRIEA STS + CKLTLD+NT+LFP+     LTVML+
Sbjct: 1   MSTTLFDDIFQVQEVDQGRYNKVSRIEATSTSTEQCKLTLDINTDLFPVHVNDNLTVMLS 60

Query: 61  TTLNLDGTEDSHGSWRPPAPGARSLADDFDYVTYGTAYKFEEANGNKDMLAVYYSFGGLL 120
           +TLNLDG E+S  SWR P PG RSLADD+DYV YGTAY+FE+ N NKD++AVYYSFGGLL
Sbjct: 61  STLNLDGHEESSVSWRAPQPGQRSLADDYDYVMYGTAYRFEDVNNNKDVIAVYYSFGGLL 120

Query: 121 MRLEGNYRLLSNFKQENVYLLC 142
           MRLEGNYR LSN KQEN YLL 
Sbjct: 121 MRLEGNYRNLSNLKQENAYLLV 142

>Kwal_26.8678
          Length = 144

 Score =  204 bits (520), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 100/143 (69%), Positives = 118/143 (82%), Gaps = 2/143 (1%)

Query: 1   MSSTLFDDIFTIQEVDQGRYNKVSRIEAISTSQDTCKLTLDVNTELFPLQPQQQLTVMLA 60
           MS+TLFDD+F + EVD GRYNKVSRIEA STSQ+  +LT+D+NTELFP++    LTVML+
Sbjct: 1   MSTTLFDDVFQVTEVDLGRYNKVSRIEAHSTSQE-FQLTVDINTELFPVRVNDNLTVMLS 59

Query: 61  TTLNLDGTED-SHGSWRPPAPGARSLADDFDYVTYGTAYKFEEANGNKDMLAVYYSFGGL 119
           ++L+LD TE   +GSWR P PG RSLADD+DYV YGTAY+FEE  G KD++AVYYSFGGL
Sbjct: 60  SSLSLDETETVQNGSWRAPQPGERSLADDYDYVMYGTAYRFEEVAGKKDLIAVYYSFGGL 119

Query: 120 LMRLEGNYRLLSNFKQENVYLLC 142
           LMRLEGNYR LSN KQEN YLL 
Sbjct: 120 LMRLEGNYRGLSNLKQENAYLLV 142

>YOR224C (RPB8) [5016] chr15 complement(760825..761265) Shared
           subunit of RNA polymerases I, II, and III (ABC14.5) [441
           bp, 146 aa]
          Length = 146

 Score =  201 bits (511), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 101/145 (69%), Positives = 115/145 (79%), Gaps = 6/145 (4%)

Query: 1   MSSTLFDDIFTIQEVDQGRYNKVSRIEAISTSQDTCKLTLDVNTELFPLQPQQQLTVMLA 60
           MS+TLFDDIF + EVD GRYNKV RIEA ST+QD CKLTLD+N ELFP+  Q  LTV +A
Sbjct: 1   MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIA 60

Query: 61  TTLNLDGT--EDSHG--SWRPPAPGARSLADDFDYVTYGTAYKFEEANGNKDMLAVYYSF 116
           ++LNL+ T   DS    SWRPP  G RSLADD+DYV YGTAYKFEE   +KD++AVYYSF
Sbjct: 61  SSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEV--SKDLIAVYYSF 118

Query: 117 GGLLMRLEGNYRLLSNFKQENVYLL 141
           GGLLMRLEGNYR L+N KQEN YLL
Sbjct: 119 GGLLMRLEGNYRNLNNLKQENAYLL 143

>Scas_640.23
          Length = 147

 Score =  199 bits (505), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 116/146 (79%), Gaps = 7/146 (4%)

Query: 1   MSSTLFDDIFTIQEVDQGRYNKVSRIEAISTSQDTCKLTLDVNTELFPLQPQQQLTVMLA 60
           MS+TLFDDIFT+ EVD GRYNKV RIEA ST+Q+ CKLTLD+NTELFP+    QLT+ +A
Sbjct: 1   MSNTLFDDIFTVSEVDPGRYNKVCRIEATSTTQEQCKLTLDINTELFPVSNNDQLTITIA 60

Query: 61  TTLNLDGTEDSHG-----SWRPPAPGARSLADDFDYVTYGTAYKFEEANGNKDMLAVYYS 115
           ++L+++   +++      SWRPP P  RS+ADD+DYV YGTAYKFEE   NKD++AVYYS
Sbjct: 61  SSLSIESDSNANQDAAQRSWRPPQPDERSIADDYDYVMYGTAYKFEEV--NKDIIAVYYS 118

Query: 116 FGGLLMRLEGNYRLLSNFKQENVYLL 141
           FGGLLMRLEGNYR L+  KQEN YLL
Sbjct: 119 FGGLLMRLEGNYRNLNTLKQENAYLL 144

>CAGL0J04070g 382116..382568 highly similar to sp|P20436
           Saccharomyces cerevisiae YOR224c RPB8, start by
           similarity
          Length = 150

 Score =  193 bits (490), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 117/149 (78%), Gaps = 10/149 (6%)

Query: 1   MSSTLFDDIFTIQEVDQGRYNKVSRIEAISTSQDTCKLTLDVNTELFPLQPQQQLTVMLA 60
           MS+TLFDDIFTI EVD GRYN V RIEA ST+Q+ CKLTLD+NT LFP+Q  +QLTV +A
Sbjct: 1   MSTTLFDDIFTISEVDPGRYNNVCRIEAGSTTQEQCKLTLDINTNLFPVQVNEQLTVTVA 60

Query: 61  TTLNLD-----GTEDSHG---SWRPPAPGARSLADDFDYVTYGTAYKFEEANGNKDMLAV 112
           ++L++D        DS G   SWRPP PG RSLADD+DYV +GTAYKFEE   +KD++AV
Sbjct: 61  SSLDVDDDDKAKVNDSTGASRSWRPPQPGDRSLADDYDYVMHGTAYKFEEV--SKDVIAV 118

Query: 113 YYSFGGLLMRLEGNYRLLSNFKQENVYLL 141
           YYSFGGLLMRLEGNYR L+N KQE  YLL
Sbjct: 119 YYSFGGLLMRLEGNYRNLNNLKQETAYLL 147

>YNL172W (APC1) [4426] chr14 (310636..315882) Component of the
            anaphase-promoting complex (APC), required for Clb2p
            degradation and for the metaphase-anaphase transition
            [5247 bp, 1748 aa]
          Length = 1748

 Score = 28.1 bits (61), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 12/56 (21%), Positives = 25/56 (44%)

Query: 85   LADDFDYVTYGTAYKFEEANGNKDMLAVYYSFGGLLMRLEGNYRLLSNFKQENVYL 140
            + DD  ++        + +  N D+L +YY+  G ++ +   +    N K  N+ L
Sbjct: 1301 IGDDLSFIMKDVDIGVKFSELNTDLLPIYYTMAGRILAMGIRFASTGNLKIRNILL 1356

>ADL294C [1447] [Homologous to ScYDL112W (TRM3) - SH]
           (182882..187000) [4119 bp, 1372 aa]
          Length = 1372

 Score = 27.7 bits (60), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 3   STLFDDIFTIQEVDQGRYNKVSRIEAIST 31
           + LFD  FT+ E + G Y  +  IE IST
Sbjct: 874 AELFDKHFTLVEAENGLYQHIYGIEEIST 902

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,648,328
Number of extensions: 181272
Number of successful extensions: 444
Number of sequences better than 10.0: 12
Number of HSP's gapped: 435
Number of HSP's successfully gapped: 12
Length of query: 142
Length of database: 16,596,109
Length adjustment: 91
Effective length of query: 51
Effective length of database: 13,445,871
Effective search space: 685739421
Effective search space used: 685739421
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)