Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR110W25222511931e-168
Kwal_26.86732762257034e-93
Sklu_2012.22532276493e-85
YOR223W2922555821e-74
KLLA0D07095g2462265251e-66
Scas_640.24*2892625264e-66
CAGL0J04092g3012665101e-63
Scas_666.3692066730.27
CAGL0K09614g105381710.46
YDR238C (SEC26)97354710.54
Sklu_2316.11310100690.98
Kwal_33.14707105581681.3
YNL132W (KRE33)105666681.3
CAGL0K11088g97254671.4
Kwal_56.2431358624661.7
KLLA0F24398g105567643.3
ADR313W57866633.9
Kwal_27.1170797454634.2
YDR217C (RAD9)130998625.8
AGR346C105860626.1
KLLA0C15279g971526010.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR110W
         (248 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR110W [1157] [Homologous to ScYOR223W - SH] complement(548056....   464   e-168
Kwal_26.8673                                                          275   4e-93
Sklu_2012.2 YOR223W, Contig c2012 1288-2049                           254   3e-85
YOR223W (YOR223W) [5015] chr15 (759782..760660) Protein of unkno...   228   1e-74
KLLA0D07095g 608975..609715 similar to sgd|S0005749 Saccharomyce...   206   1e-66
Scas_640.24*                                                          207   4e-66
CAGL0J04092g complement(382821..383726) similar to tr|Q12015 Sac...   201   1e-63
Scas_666.36                                                            33   0.27 
CAGL0K09614g complement(944619..947780) highly similar to sp|P53...    32   0.46 
YDR238C (SEC26) [1073] chr4 complement(937887..940808) Coatomer ...    32   0.54 
Sklu_2316.1 YKL209C, Contig c2316 84-4016 reverse complement           31   0.98 
Kwal_33.14707                                                          31   1.3  
YNL132W (KRE33) [4463] chr14 (375321..378491) Protein of unknown...    31   1.3  
CAGL0K11088g complement(1078328..1081246) highly similar to sp|P...    30   1.4  
Kwal_56.24313                                                          30   1.7  
KLLA0F24398g complement(2271709..2274876) highly similar to sp|P...    29   3.3  
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    29   3.9  
Kwal_27.11707                                                          29   4.2  
YDR217C (RAD9) [1054] chr4 complement(899543..903472) DNA repair...    28   5.8  
AGR346C [4657] [Homologous to ScYNL132W (KRE33) - SH] (1370371.....    28   6.1  
KLLA0C15279g complement(1329012..1331927) highly similar to sp|P...    28   10.0 

>ACR110W [1157] [Homologous to ScYOR223W - SH]
           complement(548056..548814) [759 bp, 252 aa]
          Length = 252

 Score =  464 bits (1193), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 225/225 (100%), Positives = 225/225 (100%)

Query: 24  DPTLQDLTLEVSSIPYADVTTRWLRAMVRQIRPAKTVRHRLKFIRNGQPLNAMSNLRLEQ 83
           DPTLQDLTLEVSSIPYADVTTRWLRAMVRQIRPAKTVRHRLKFIRNGQPLNAMSNLRLEQ
Sbjct: 24  DPTLQDLTLEVSSIPYADVTTRWLRAMVRQIRPAKTVRHRLKFIRNGQPLNAMSNLRLEQ 83

Query: 84  FFESAEENDKYYIHCIVGPELTTEQLQDEDALDNVGQQVDGTTPEVIGFDRLRSVGFSDE 143
           FFESAEENDKYYIHCIVGPELTTEQLQDEDALDNVGQQVDGTTPEVIGFDRLRSVGFSDE
Sbjct: 84  FFESAEENDKYYIHCIVGPELTTEQLQDEDALDNVGQQVDGTTPEVIGFDRLRSVGFSDE 143

Query: 144 EIELLRQQFRATYGDLDTSQQPDGERADLRQLEEQWIETGATEQGAQLSSIPTANYRYNM 203
           EIELLRQQFRATYGDLDTSQQPDGERADLRQLEEQWIETGATEQGAQLSSIPTANYRYNM
Sbjct: 144 EIELLRQQFRATYGDLDTSQQPDGERADLRQLEEQWIETGATEQGAQLSSIPTANYRYNM 203

Query: 204 DLLIGLMVGCLFGVFSILLLKQGELFTKRQKMAVFAGIVANVIFG 248
           DLLIGLMVGCLFGVFSILLLKQGELFTKRQKMAVFAGIVANVIFG
Sbjct: 204 DLLIGLMVGCLFGVFSILLLKQGELFTKRQKMAVFAGIVANVIFG 248

>Kwal_26.8673
          Length = 276

 Score =  275 bits (703), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 130/225 (57%), Positives = 172/225 (76%), Gaps = 2/225 (0%)

Query: 24  DPTLQDLTLEVSSIPYADVTTRWLRAMVRQIRPAKTVRHRLKFIRNGQPLNAMSNLRLEQ 83
           D  L+DL L VS++P  ++ TRWLR M RQ+R   T   RL+FIRNG+ L+  S+L+L+Q
Sbjct: 46  DEQLEDLPLNVSNVPLNEINTRWLRRMCRQLRGRFTGNKRLRFIRNGRFLDINSDLQLQQ 105

Query: 84  FFESAEENDKYYIHCIVGPELTTEQLQDEDALDNVGQQVDGTTPEVIGFDRLRSVGFSDE 143
           +FE +  NDK+Y+HCIVG ELT E+L++ED LD   Q  +GTT + IGFDRLRSVGFS+E
Sbjct: 106 YFEGS--NDKFYVHCIVGQELTPEELENEDVLDEAQQNTEGTTAQAIGFDRLRSVGFSEE 163

Query: 144 EIELLRQQFRATYGDLDTSQQPDGERADLRQLEEQWIETGATEQGAQLSSIPTANYRYNM 203
           EIELLRQ+FR+TYGDL+   + + E  D+RQLEEQW+ETGA E+  QL S+  ANY++N 
Sbjct: 164 EIELLRQRFRSTYGDLEELSRGNDEARDIRQLEEQWMETGANEENDQLGSVGIANYKHNT 223

Query: 204 DLLIGLMVGCLFGVFSILLLKQGELFTKRQKMAVFAGIVANVIFG 248
           DLL+GL+VGC+ GVFS+LL+KQ  LF KRQKMA+  G++ N+ FG
Sbjct: 224 DLLVGLVVGCVLGVFSLLLMKQDGLFNKRQKMAMVGGLLMNLCFG 268

>Sklu_2012.2 YOR223W, Contig c2012 1288-2049
          Length = 253

 Score =  254 bits (649), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 172/227 (75%), Gaps = 3/227 (1%)

Query: 24  DPTLQDLTLEVSSIPYADVTTRWLRAMVRQIRPAKTVRHRLKFIRNGQPLNAMSNL--RL 81
           D  + DLTL++S++P+  + T WLR M RQ+R   T   RLKFIR+G+PLN+ +N    L
Sbjct: 23  DVAIHDLTLDISNLPWDSINTNWLRRMCRQLRKEATTNKRLKFIRSGRPLNSNTNFASEL 82

Query: 82  EQFFESAEENDKYYIHCIVGPELTTEQLQDEDALDNVGQQVDGTTPEVIGFDRLRSVGFS 141
           +QFF+   EN KYY+HCIVG +LT E+L +ED LD++G   +GTT + +GFDRLRSVGFS
Sbjct: 83  QQFFQQDTENTKYYVHCIVGQDLTEEELANEDVLDDIGPSNEGTTTQAVGFDRLRSVGFS 142

Query: 142 DEEIELLRQQFRATYGDLDTSQQPDGERADLRQLEEQWIETGATEQGAQLSSIPTANYRY 201
           DEEIELLR+QFR+TYGDL+   Q      D+RQLEEQW+E+G +++  Q +S+P A+Y+ 
Sbjct: 143 DEEIELLREQFRSTYGDLENVVQESQGGRDIRQLEEQWMESGVSDED-QFNSVPIADYKR 201

Query: 202 NMDLLIGLMVGCLFGVFSILLLKQGELFTKRQKMAVFAGIVANVIFG 248
           N DLLIGL++GCL G+FS+LLLKQ  LF+KRQKMAV AG++ N+ FG
Sbjct: 202 NRDLLIGLIIGCLLGIFSLLLLKQEGLFSKRQKMAVVAGLLVNLFFG 248

>YOR223W (YOR223W) [5015] chr15 (759782..760660) Protein of unknown
           function, has low similarity to uncharacterized C.
           albicans Orf6.1950p [879 bp, 292 aa]
          Length = 292

 Score =  228 bits (582), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 117/255 (45%), Positives = 164/255 (64%), Gaps = 31/255 (12%)

Query: 24  DPTLQDLTLEVSSIPYADVTTRWLRAMVRQIRPAKTVRHRLKFIRNGQPLNAMSNL--RL 81
           D +++DL L +S++P++++ T WLR M R++RP +T + RLKFIRNG  LN  S +   L
Sbjct: 32  DVSVRDLQLNISNVPFSNINTHWLRRMCRELRPQQTQKRRLKFIRNGSILNTHSKIAEEL 91

Query: 82  EQFFESAE------------ENDKYYIHCIVGPE-LTTEQLQDEDALDNVGQQVDGTTPE 128
             +F++A             E + YYIHCI+G E LT  +L +ED  D+     D  T +
Sbjct: 92  THYFDTANNSNVATGTSVAPEQNNYYIHCIIGTEELTQAELANEDLKDDATPSNDSMTTQ 151

Query: 129 VIGFDRLRSVGFSDEEIELLRQQFRATYGDLDTSQQ-------PDGERADLRQLEEQWIE 181
            IGFDRLRSVGF+++EIELLRQQFRATYGDL+  ++        D E  D+RQLEEQW+E
Sbjct: 152 AIGFDRLRSVGFTEQEIELLRQQFRATYGDLEEEEERLAQNGNRDDEGHDIRQLEEQWME 211

Query: 182 TGATEQGA---------QLSSIPTANYRYNMDLLIGLMVGCLFGVFSILLLKQGELFTKR 232
           +G+              + +S+P AN ++N DLL+G+ VG  FGVF ILL+K   LF +R
Sbjct: 212 SGSGTAQGNGAGGGNEDRFNSVPIANIKHNKDLLLGICVGFFFGVFGILLMKFDGLFNRR 271

Query: 233 QKMAVFAGIVANVIF 247
           QKMA+FAG++ NV+F
Sbjct: 272 QKMAIFAGVIVNVMF 286

>KLLA0D07095g 608975..609715 similar to sgd|S0005749 Saccharomyces
           cerevisiae YOR223w hypothetical protein, start by
           similarity
          Length = 246

 Score =  206 bits (525), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 117/226 (51%), Positives = 164/226 (72%), Gaps = 5/226 (2%)

Query: 24  DPTLQDLTLEVSSIPYADVTTRWLRAMVRQIRPAKTVRHRLKFIRNGQPLNAMSNLRLEQ 83
           + T+ DL L++++I    VTT WLR M RQ++P +T   RL+FI+NG+PLN+ S+L +E 
Sbjct: 19  NDTIADLQLDITNIDPTLVTTSWLRRMCRQLKPTETRGKRLRFIKNGRPLNSHSDLGIES 78

Query: 84  FFESAEENDKYYIHCIVGPELTTEQLQDEDALDN-VGQQVDGTTPEVIGFDRLRSVGFSD 142
           F ++    +  YIH I+G  LT E+L +ED LD+      +  T + IGFDRLRSVGFS+
Sbjct: 79  FKDNPNITE-MYIHGIIGAGLTAEELINEDNLDDDFSNTNENGTTQAIGFDRLRSVGFSE 137

Query: 143 EEIELLRQQFRATYGDLDTSQQPDGERADLRQLEEQWIETGATE-QGAQLSSIPTANYRY 201
           +EI+LLRQQF ATYGDL+T   P+ ++ D+RQLEEQW+ETG  + QG Q +SI  AN++ 
Sbjct: 138 QEIDLLRQQFLATYGDLET--MPNQQQRDIRQLEEQWMETGVNDPQGQQFNSIGIANWKS 195

Query: 202 NMDLLIGLMVGCLFGVFSILLLKQGELFTKRQKMAVFAGIVANVIF 247
           NMDLLIGL +G L GVFS+LLLKQ  LF++RQKM++ AG++ N+ +
Sbjct: 196 NMDLLIGLSIGSLLGVFSLLLLKQQGLFSQRQKMSIVAGLIFNIAW 241

>Scas_640.24*
          Length = 289

 Score =  207 bits (526), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 111/262 (42%), Positives = 162/262 (61%), Gaps = 38/262 (14%)

Query: 24  DPTLQDLTLEVSSIPYADVTTRWLRAMVRQIRPAKTVRHRLKFIRNGQPLNAMSNLRL-- 81
           D T+ DL + ++ +P +++ T WLR M R +RP +T  HRLKFIR+G  LN+ S+L L  
Sbjct: 22  DVTIADLQINITQVPISNINTHWLRQMCRDLRPRETQSHRLKFIRSGALLNSRSSLALQI 81

Query: 82  -EQFFESAEEN-----------DKYYIHCIVGPELTTE-QLQDEDALDNVGQQVDGTTPE 128
            + F  SA ++           +K+YIHCI+G +L +E +L  EDA+D++G   +G T +
Sbjct: 82  QDYFRTSASDHTPQQEEEEEEANKFYIHCIIGSDLLSEDELAREDAMDDLGPNEEGRTTQ 141

Query: 129 VIGFDRLRSVGFSDEEIELLRQQFRATYGDLDTSQQPDGE---------RADLRQLEEQW 179
            IGFDRLR+VGFS+ EIELLRQQFR+TYGDL+   Q + E           D+RQLEEQW
Sbjct: 142 AIGFDRLRAVGFSEREIELLRQQFRSTYGDLEERLQGNDEFEEEGNNNSTTDIRQLEEQW 201

Query: 180 I-----ETGATEQGA---------QLSSIPTANYRYNMDLLIGLMVGCLFGVFSILLLKQ 225
           +      T   + G          + +SIP  N ++N DLLIG+ +G  FG+F+ +L+  
Sbjct: 202 MGKWWTWTHEMKMGWLIIMSFDDDRFNSIPITNLKHNKDLLIGIFIGFCFGIFAFILMNI 261

Query: 226 GELFTKRQKMAVFAGIVANVIF 247
             L  KRQ+M++FAGI+ N++F
Sbjct: 262 DGLLNKRQRMSMFAGIIVNILF 283

>CAGL0J04092g complement(382821..383726) similar to tr|Q12015
           Saccharomyces cerevisiae YOR223w, hypothetical start
          Length = 301

 Score =  201 bits (510), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 116/266 (43%), Positives = 157/266 (59%), Gaps = 42/266 (15%)

Query: 24  DPTLQDLTLEVSSIPYADVTTRWLRAMVRQIRPAKTVRHRLKFIRNGQPLNAMSNLRLE- 82
           D T+ DL L ++ +    + T+WLR + R++R  +T R RL+FIRNG  LN+ +NL  E 
Sbjct: 30  DDTIPDLKLNITHVSMDTINTQWLRRLCRELRGEQTHRRRLRFIRNGNILNSRANLGSEI 89

Query: 83  -QFFESAE-ENDK-------YYIHCIVGPE-LTTEQLQDEDALDNVGQQVDGTTPEVIGF 132
            Q+FE  + EN +       +Y+HCI+G E LT EQL  ED +D +G   D  T + IGF
Sbjct: 90  LQYFERLQAENTEGTLNELLFYVHCIIGTEDLTDEQLASEDVMDTMGPSADSVTTQAIGF 149

Query: 133 DRLRSVGFSDEEIELLRQQFRATYGDL---------DTSQQPDGERA-----DLRQLEEQ 178
           DRL SVGFS+EEIELLRQQFR+TYGD          D SQ   G R      D+RQLEE 
Sbjct: 150 DRLASVGFSEEEIELLRQQFRSTYGDPEEEDDLLNGDESQSNIGSRGGNARRDIRQLEEM 209

Query: 179 WIETG----AT-------------EQGAQLSSIPTANYRYNMDLLIGLMVGCLFGVFSIL 221
           W+E+G    AT             E   + +SIP  + R+N DLLIG+  G   G+F++L
Sbjct: 210 WMESGNDPMATAGDGLQPGRDRNGEVEDRFNSIPVTDIRHNKDLLIGITTGFCLGIFALL 269

Query: 222 LLKQGELFTKRQKMAVFAGIVANVIF 247
           L+K   LF KRQ+M++  G+  NV+F
Sbjct: 270 LMKNEGLFNKRQRMSIIVGVATNVLF 295

>Scas_666.36
          Length = 920

 Score = 32.7 bits (73), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 8/66 (12%)

Query: 102 PELTTEQLQDEDALDNVGQQVD--GTTPEVIGFDRLRSVGFSDEEIELLRQQFRATYGDL 159
           P L ++Q QDE+     G +V    T PE        S+G+    I+LLR  F   + D+
Sbjct: 481 PWLVSQQFQDEEFAGLSGARVVRIATNPEYA------SMGYGSRAIQLLRDYFEGKFADM 534

Query: 160 DTSQQP 165
             S  P
Sbjct: 535 SESAHP 540

>CAGL0K09614g complement(944619..947780) highly similar to sp|P53914
           Saccharomyces cerevisiae YNL132w, start by similarity
          Length = 1053

 Score = 32.0 bits (71), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 11/81 (13%)

Query: 102 PELTTEQLQDEDALDNVGQQVD--GTTPEVIGFDRLRSVGFSDEEIELLRQQFRATYGDL 159
           P L ++Q QDE+     G +V    T PE        S+G+    +ELL+  F   + DL
Sbjct: 613 PWLVSQQFQDEEFAGLSGARVVRIATNPEY------SSMGYGSRAMELLKDYFEGKFTDL 666

Query: 160 DTSQQPDG---ERADLRQLEE 177
               +P     +R D ++LE+
Sbjct: 667 SEDTKPRDFSLKRVDPKELEK 687

>YDR238C (SEC26) [1073] chr4 complement(937887..940808) Coatomer
           (COPI) complex beta chain (beta-COP) of secretory
           pathway vesicles, required for retrograde transport from
           Golgi to endoplasmic reticulum [2922 bp, 973 aa]
          Length = 973

 Score = 32.0 bits (71), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 86  ESAEENDKYYIHCIVGPELTTEQLQDEDALDNVGQQVDGTTPEVIGFDRLRSVG 139
           ES  E+D  ++ C     L  +    EDAL N+  + D  T +VIG+ R+RS G
Sbjct: 898 ESLGEDDCRFLSC----NLYAKSSFGEDALANLCIEKDSKTNDVIGYVRIRSKG 947

>Sklu_2316.1 YKL209C, Contig c2316 84-4016 reverse complement
          Length = 1310

 Score = 31.2 bits (69), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 45/100 (45%), Gaps = 12/100 (12%)

Query: 148 LRQQFRATYGD-----LDTSQQPDGERADLRQLEEQWIETGATEQGAQLSSIPTA----- 197
           +R++   TY D      D S+Q  GE   L +  E+   + A        ++ T      
Sbjct: 112 VRRKLLNTYLDKPLTWYDKSEQASGEFTQLNRCVEELRSSCAESSAITFQNVVTVFALTI 171

Query: 198 -NYRYNMDLLIGLMVGC-LFGVFSILLLKQGELFTKRQKM 235
            ++ Y+  L + +M G  +  VFS++L K  E FT+ + M
Sbjct: 172 TSFYYSWSLTLVIMAGVPIIIVFSVILSKLIERFTRLENM 211

>Kwal_33.14707
          Length = 1055

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 39/81 (48%), Gaps = 11/81 (13%)

Query: 102 PELTTEQLQDEDALDNVGQQVD--GTTPEVIGFDRLRSVGFSDEEIELLRQQFRATYGDL 159
           P L ++Q QD++     G ++    T PE        S+G+    +ELL+  +   + DL
Sbjct: 613 PWLISQQFQDDEFPGLSGARIVRVATNPE------YSSMGYGSRAVELLKDYYEGKFADL 666

Query: 160 DTSQQPDG---ERADLRQLEE 177
           + +++P     +R D R L +
Sbjct: 667 NENERPKNLELKRVDDRALSK 687

>YNL132W (KRE33) [4463] chr14 (375321..378491) Protein of unknown
           function, has high similarity to uncharacterized C.
           albicans Orf6.7058p [3171 bp, 1056 aa]
          Length = 1056

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 8/66 (12%)

Query: 102 PELTTEQLQDEDALDNVGQQVD--GTTPEVIGFDRLRSVGFSDEEIELLRQQFRATYGDL 159
           P L ++Q QDE+     G ++    T PE        S+G+    IELLR  F   + D+
Sbjct: 615 PWLISQQFQDEEFASLSGARIVRIATNPEYA------SMGYGSRAIELLRDYFEGKFTDM 668

Query: 160 DTSQQP 165
               +P
Sbjct: 669 SEDVRP 674

>CAGL0K11088g complement(1078328..1081246) highly similar to
           sp|P41810 Saccharomyces cerevisiae YDR238c SEC26, start
           by similarity
          Length = 972

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 86  ESAEENDKYYIHCIVGPELTTEQLQDEDALDNVGQQVDGTTPEVIGFDRLRSVG 139
           ES  E D  ++ C     L       EDAL N+  ++D  T +V+G+ R+RS G
Sbjct: 897 ESLGEKDCRFLCC----NLYARSSFGEDALANLCIELDPNTEQVVGYVRIRSKG 946

>Kwal_56.24313
          Length = 586

 Score = 30.0 bits (66), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 72 PLNAMSNLRLEQFFESAEENDKYY 95
          PL A   +R+E+F E+AE+ DKY+
Sbjct: 6  PLGATYGIRVERFLETAEDFDKYH 29

>KLLA0F24398g complement(2271709..2274876) highly similar to
           sp|P53914 Saccharomyces cerevisiae YNL132w singleton,
           start by similarity
          Length = 1055

 Score = 29.3 bits (64), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 10/67 (14%)

Query: 102 PELTTEQLQDEDALDNVGQQV--DGTTPEVIGFDRLRSVGFSDEEIELLRQQFRATYGDL 159
           P L ++Q QDE+     G +V    T PE        S+G+    +ELL+  F   + DL
Sbjct: 613 PWLISQQFQDEEFAGLSGARVVRIATNPEYA------SMGYGSRALELLKDHFEGKFTDL 666

Query: 160 --DTSQQ 164
             DT Q+
Sbjct: 667 NEDTVQK 673

>ADR313W [2054] [Homologous to ScYDL025C - SH]
           complement(1255932..1257668) [1737 bp, 578 aa]
          Length = 578

 Score = 28.9 bits (63), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 4/66 (6%)

Query: 31  TLEVSSIPYADVTTRWLRAMVRQIRPAKTVRHRLKFIRNGQPLNAMSNLRLEQFFE---S 87
           TL+ S  P   +T ++L++ +  IR  +  RH+L      +P     +LRL++F +   S
Sbjct: 161 TLDTSPHPNQHLT-QYLQSQIESIRDKEAQRHQLTPPPAKEPSQIKKSLRLKRFLKFPSS 219

Query: 88  AEENDK 93
           +++ DK
Sbjct: 220 SKQEDK 225

>Kwal_27.11707
          Length = 974

 Score = 28.9 bits (63), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 86  ESAEENDKYYIHCIVGPELTTEQLQDEDALDNVGQQVDGTTPEVIGFDRLRSVG 139
           E+  E D  ++ C     L ++    EDAL N+  + D ++ E++G  R+RS G
Sbjct: 899 EALGEKDCRFLSC----NLYSKSTFGEDALANLCIEKDPSSDEIVGHVRIRSKG 948

>YDR217C (RAD9) [1054] chr4 complement(899543..903472) DNA repair
           checkpoint protein required for cell cycle arrest
           following DNA damage, may act as part of a complex that
           binds Rad53p to facilitate its trans autophosphorylation
           [3930 bp, 1309 aa]
          Length = 1309

 Score = 28.5 bits (62), Expect = 5.8,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 43/98 (43%), Gaps = 7/98 (7%)

Query: 108 QLQDEDALDNVGQQVDGTTPEVIGFDRLRSVGFSDEEIELLRQQFRATYGDLDTSQQPDG 167
           QL D++   N  +Q DGT    +      S G S E  + L Q F +       SQ+   
Sbjct: 641 QLHDDNKECNSDKQ-DGTESLDVALIEHESKGQSSELQKNLMQLFPSE------SQEIIQ 693

Query: 168 ERADLRQLEEQWIETGATEQGAQLSSIPTANYRYNMDL 205
            R  +++ ++  IE G  E+     + PT + + N DL
Sbjct: 694 NRRTIKRRQKDTIEIGEEEENRSTKTSPTKHLKRNSDL 731

>AGR346C [4657] [Homologous to ScYNL132W (KRE33) - SH]
           (1370371..1373547) [3177 bp, 1058 aa]
          Length = 1058

 Score = 28.5 bits (62), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 8/60 (13%)

Query: 102 PELTTEQLQDEDALDNVGQQVD--GTTPEVIGFDRLRSVGFSDEEIELLRQQFRATYGDL 159
           P L ++Q QDE+     G +V    T PE        S+G+    IELLR  +   + DL
Sbjct: 626 PWLVSQQFQDEEFAGLSGARVVRIATNPEYA------SMGYGSRAIELLRDYYEQKFTDL 679

>KLLA0C15279g complement(1329012..1331927) highly similar to
           sp|P41810 Saccharomyces cerevisiae YDR238c SEC26
           coatomer complex beta chain of secretory pathway
           vesicles singleton, start by similarity
          Length = 971

 Score = 27.7 bits (60), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 4/52 (7%)

Query: 86  ESAEENDKYYIHCIVGPELTTEQLQDEDALDNVGQQVDGTTPEVIGFDRLRS 137
           E+  +ND  ++ C     L +     EDAL N+  + D  T E++G  R+RS
Sbjct: 896 EALGDNDSRFLSC----NLYSRSTFGEDALANLCIEKDPITQEIVGEIRIRS 943

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,098,632
Number of extensions: 299869
Number of successful extensions: 924
Number of sequences better than 10.0: 29
Number of HSP's gapped: 906
Number of HSP's successfully gapped: 29
Length of query: 248
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 149
Effective length of database: 13,168,927
Effective search space: 1962170123
Effective search space used: 1962170123
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)