Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR109W29929415500.0
Kwal_26.866929629012521e-175
KLLA0D07073g29729111941e-166
YPL134C (ODC1)31030510291e-141
YOR222W (ODC2)30729910221e-140
Scas_640.253062999871e-135
CAGL0J04114g3032949591e-131
Scas_589.103163017561e-100
Sklu_2334.23193173211e-34
YPR021C (AGC1)9022863313e-34
ADL049W9122873252e-33
YJR095W (SFC1)3223143113e-33
AGL311C3622953063e-32
Scas_691.43343273035e-32
CAGL0K02365g9192893059e-31
Scas_602.88852912986e-30
Sklu_2359.69022912924e-29
Kwal_47.173218812862916e-29
Kwal_47.182163333262816e-29
KLLA0F03212g3053012754e-28
KLLA0E13453g9062912836e-28
Scas_718.53243032721e-27
CAGL0M09020g3483172731e-27
Kwal_33.154463052842666e-27
Sklu_2398.43092862642e-26
Sklu_2075.33452852642e-26
YBR104W (YMC2)3293092581e-25
CAGL0L02079g2973002562e-25
Scas_582.73292752572e-25
CAGL0B03883g3062832544e-25
AER184W3052932534e-25
Kwal_56.230113032902501e-24
YPR058W (YMC1)3072872491e-24
Sklu_1926.23052882465e-24
CAGL0K12210g3112912465e-24
Scas_667.223062852456e-24
Kwal_23.43543433372476e-24
Scas_709.93652862486e-24
YEL006W3352912405e-23
KLLA0E09680g3072852351e-22
YBR291C (CTP1)2993062352e-22
Sklu_1275.13112852342e-22
CAGL0J02002g3612932353e-22
Sklu_1149.22963022314e-22
Scas_489.42973022315e-22
KLLA0B12826g3192782301e-21
KLLA0E12353g3052962281e-21
CAGL0K08250g2972752281e-21
Kwal_26.79672973022272e-21
KLLA0D09889g3642822302e-21
YIL006W3732822292e-21
Kwal_27.125993042942263e-21
CAGL0D01606g3052862246e-21
KLLA0F17864g3072962236e-21
ADL009W3792972241e-20
Kwal_26.76533252012212e-20
Sklu_2127.52782802182e-20
CAGL0F04213g3062952192e-20
Kwal_27.124813042952192e-20
KLLA0A09383g3662652213e-20
Kwal_55.208683803122214e-20
KLLA0B08503g3032772174e-20
Kwal_33.129883032822167e-20
Scas_379.23012822158e-20
AFR131C3442572179e-20
YBR085W (AAC3)3072952151e-19
Kwal_55.213353172792151e-19
Scas_632.92922822103e-19
CAGL0J09790g3002742114e-19
CAGL0L05742g3052882114e-19
YBL030C (PET9)3182852114e-19
KLLA0E18810g3773022116e-19
CAGL0F08305g3742582108e-19
Sklu_2432.52882822061e-18
KLLA0E23705g3682982073e-18
Scas_562.123002872034e-18
YMR056C (AAC1)3092972034e-18
Sklu_2431.53703242046e-18
YNL003C (PET8)2842922007e-18
CAGL0K11616g3202882001e-17
YJL133W (MRS3)3142852001e-17
Kwal_23.35293952842012e-17
KLLA0F13464g3002951973e-17
Kwal_33.140503142881973e-17
Sklu_2430.103242781964e-17
Scas_645.93912561976e-17
Sklu_2117.22982911947e-17
Scas_667.43082971947e-17
KLLA0E02772g2842851921e-16
KLLA0D14036g4313141961e-16
YDL198C (YHM1)3002811921e-16
YLR348C (DIC1)2982831912e-16
Kwal_14.22103152931922e-16
YKL120W (OAC1)3242881922e-16
CAGL0J01661g3273041912e-16
KLLA0D15015g3172911912e-16
AER450C3082691903e-16
CAGL0K10362g3012931893e-16
YJR077C (MIR1)3112681903e-16
CAGL0G01166g2952781893e-16
ACR260W3112831894e-16
CAGL0F00231g3072681894e-16
Scas_718.243372931886e-16
AFR146W2812761867e-16
AFL196W3612861887e-16
Sklu_1119.13072691877e-16
Scas_669.63732981888e-16
CAGL0F07711g3683171888e-16
Sklu_2115.42992871869e-16
Kwal_27.116262992911851e-15
CAGL0H03839g2822901832e-15
AEL253W3652891842e-15
YKR052C (MRS4)3042861832e-15
YOR130C (ORT1)2922861823e-15
YGR257C (MTM1)3662561833e-15
YMR166C3683211833e-15
Sklu_2363.23232971815e-15
Kwal_27.120813692961816e-15
YGR096W (TPC1)3142721807e-15
Scas_673.173142321807e-15
Scas_721.1293232891798e-15
Scas_721.273743031791e-14
Kwal_23.47313143071781e-14
Scas_558.22892911762e-14
AAL014C2712881752e-14
Kwal_33.155973052691752e-14
CAGL0M05225g3813041754e-14
Sklu_2442.82752941717e-14
Kwal_27.114192982941665e-13
YIL134W (FLX1)3113111655e-13
CAGL0H10538g2972851656e-13
KLLA0B14454g3052611656e-13
Sklu_2037.23103051647e-13
Scas_702.103022891621e-12
AER366W2932951602e-12
AGR191W2982821602e-12
Scas_662.123082991602e-12
Scas_715.453052591603e-12
AGR383W2932741594e-12
AGL064W2962801584e-12
Kwal_0.2322742921575e-12
CAGL0J05522g5191841596e-12
Kwal_23.39653073051576e-12
KLLA0E15532g3262931577e-12
AGL047C3162901551e-11
ADL264C3292781551e-11
YPR011C3263021533e-11
KLLA0A00979g3433591523e-11
KLLA0D04950g2742881504e-11
CAGL0G08910g2892951497e-11
YER053C3002571498e-11
Scas_714.183053041471e-10
YBR192W (RIM2)3773081472e-10
Scas_687.15*3283251462e-10
Scas_716.293162991452e-10
Kwal_23.57573072581452e-10
CAGL0C02013g3293141435e-10
CAGL0B04543g3172831427e-10
YPR128C (ANT1)3282851419e-10
ABL023W3092771401e-09
AER419W4931811411e-09
Sklu_2260.53022571372e-09
YNL083W5451821383e-09
Kwal_23.30425421771374e-09
KLLA0C11363g5171771357e-09
CAGL0D04774g3222881339e-09
YDL119C3072891321e-08
Kwal_26.79723583221312e-08
YHR002W (LEU5)3573261303e-08
KLLA0F04697g3073071293e-08
Scas_578.3*5241781295e-08
CAGL0K02915g3423241275e-08
Kwal_55.211063283011267e-08
AAR036W3172941241e-07
Sklu_2374.75131801242e-07
Scas_328.12272091203e-07
AFR147C3151281213e-07
Sklu_2433.84203361223e-07
CAGL0G03135g3071841204e-07
ADR036C3403091195e-07
Kwal_55.213383231411195e-07
AFR253W3443291196e-07
AFR542W3103121161e-06
KLLA0E08877g2942881161e-06
Scas_697.473281881152e-06
YFR045W2852071133e-06
Sklu_2127.43231531133e-06
Scas_717.203563251143e-06
Scas_705.93232981133e-06
KLLA0D04290g1881901104e-06
Kwal_47.192282812641115e-06
YMR241W (YHM2)3142841098e-06
YOR100C (CRC1)3271751091e-05
KLLA0E02750g3041721081e-05
Kwal_23.29133201681062e-05
Scas_613.241771611033e-05
KLLA0D04312g10384958e-05
Scas_696.93122821011e-04
Sklu_2194.33122811011e-04
CAGL0K07436g307297982e-04
Kwal_34.15907312272948e-04
KLLA0F08547g308288920.001
AGL065C335180900.002
KLLA0B11319g355337890.003
KLLA0E18788g381207850.011
Sklu_2435.2344332800.043
Scas_671.1*12373760.050
KLLA0C13431g328189730.30
Kwal_14.102868074672.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR109W
         (294 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...   601   0.0  
Kwal_26.8669                                                          486   e-175
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...   464   e-166
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...   400   e-141
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...   398   e-140
Scas_640.25                                                           384   e-135
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...   374   e-131
Scas_589.10                                                           295   e-100
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement        128   1e-34
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...   132   3e-34
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....   129   2e-33
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...   124   3e-33
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...   122   3e-32
Scas_691.4                                                            121   5e-32
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...   122   9e-31
Scas_602.8                                                            119   6e-30
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                         117   4e-29
Kwal_47.17321                                                         116   6e-29
Kwal_47.18216                                                         112   6e-29
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...   110   4e-28
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...   113   6e-28
Scas_718.5                                                            109   1e-27
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...   109   1e-27
Kwal_33.15446                                                         107   6e-27
Sklu_2398.4 , Contig c2398 9476-10405                                 106   2e-26
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement               106   2e-26
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...   103   1e-25
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...   103   2e-25
Scas_582.7                                                            103   2e-25
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...   102   4e-25
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...   102   4e-25
Kwal_56.23011                                                         100   1e-24
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...   100   1e-24
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          99   5e-24
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    99   5e-24
Scas_667.22                                                            99   6e-24
Kwal_23.4354                                                          100   6e-24
Scas_709.9                                                            100   6e-24
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    97   5e-23
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    95   1e-22
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    95   2e-22
Sklu_1275.1 , Contig c1275 314-1249                                    95   2e-22
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    95   3e-22
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         94   4e-22
Scas_489.4                                                             94   5e-22
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    93   1e-21
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    92   1e-21
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    92   1e-21
Kwal_26.7967                                                           92   2e-21
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    93   2e-21
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    93   2e-21
Kwal_27.12599                                                          92   3e-21
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    91   6e-21
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    91   6e-21
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    91   1e-20
Kwal_26.7653                                                           90   2e-20
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         89   2e-20
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    89   2e-20
Kwal_27.12481                                                          89   2e-20
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    90   3e-20
Kwal_55.20868                                                          90   4e-20
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    88   4e-20
Kwal_33.12988                                                          88   7e-20
Scas_379.2                                                             87   8e-20
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    88   9e-20
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    87   1e-19
Kwal_55.21335                                                          87   1e-19
Scas_632.9                                                             86   3e-19
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    86   4e-19
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    86   4e-19
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    86   4e-19
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    86   6e-19
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    86   8e-19
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       84   1e-18
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    84   3e-18
Scas_562.12                                                            83   4e-18
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    83   4e-18
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            83   6e-18
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    82   7e-18
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    82   1e-17
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    82   1e-17
Kwal_23.3529                                                           82   2e-17
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    80   3e-17
Kwal_33.14050                                                          80   3e-17
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         80   4e-17
Scas_645.9                                                             80   6e-17
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            79   7e-17
Scas_667.4                                                             79   7e-17
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    79   1e-16
KLLA0D14036g complement(1203522..1204817) some similarities with...    80   1e-16
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    79   1e-16
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    78   2e-16
Kwal_14.2210                                                           79   2e-16
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    79   2e-16
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    78   2e-16
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    78   2e-16
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    78   3e-16
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    77   3e-16
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    78   3e-16
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    77   3e-16
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    77   4e-16
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    77   4e-16
Scas_718.24                                                            77   6e-16
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    76   7e-16
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    77   7e-16
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             77   7e-16
Scas_669.6                                                             77   8e-16
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    77   8e-16
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            76   9e-16
Kwal_27.11626                                                          76   1e-15
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    75   2e-15
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    75   2e-15
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    75   2e-15
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    75   3e-15
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    75   3e-15
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    75   3e-15
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          74   5e-15
Kwal_27.12081                                                          74   6e-15
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    74   7e-15
Scas_673.17                                                            74   7e-15
Scas_721.129                                                           74   8e-15
Scas_721.27                                                            74   1e-14
Kwal_23.4731                                                           73   1e-14
Scas_558.2                                                             72   2e-14
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    72   2e-14
Kwal_33.15597                                                          72   2e-14
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    72   4e-14
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          70   7e-14
Kwal_27.11419                                                          69   5e-13
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    68   5e-13
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    68   6e-13
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    68   6e-13
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         68   7e-13
Scas_702.10                                                            67   1e-12
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    66   2e-12
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    66   2e-12
Scas_662.12                                                            66   2e-12
Scas_715.45                                                            66   3e-12
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    66   4e-12
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    65   4e-12
Kwal_0.232                                                             65   5e-12
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    66   6e-12
Kwal_23.3965                                                           65   6e-12
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    65   7e-12
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    64   1e-11
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    64   1e-11
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    64   3e-11
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    63   3e-11
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    62   4e-11
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    62   7e-11
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    62   8e-11
Scas_714.18                                                            61   1e-10
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    61   2e-10
Scas_687.15*                                                           61   2e-10
Scas_716.29                                                            60   2e-10
Kwal_23.5757                                                           60   2e-10
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    60   5e-10
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    59   7e-10
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    59   9e-10
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    59   1e-09
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    59   1e-09
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         57   2e-09
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    58   3e-09
Kwal_23.3042                                                           57   4e-09
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    57   7e-09
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    56   9e-09
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    55   1e-08
Kwal_26.7972                                                           55   2e-08
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    55   3e-08
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    54   3e-08
Scas_578.3*                                                            54   5e-08
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    54   5e-08
Kwal_55.21106                                                          53   7e-08
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    52   1e-07
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       52   2e-07
Scas_328.1                                                             51   3e-07
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    51   3e-07
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       52   3e-07
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    51   4e-07
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    50   5e-07
Kwal_55.21338                                                          50   5e-07
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    50   6e-07
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    49   1e-06
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    49   1e-06
Scas_697.47                                                            49   2e-06
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    48   3e-06
Sklu_2127.4 , Contig c2127 6322-7293                                   48   3e-06
Scas_717.20                                                            49   3e-06
Scas_705.9                                                             48   3e-06
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    47   4e-06
Kwal_47.19228                                                          47   5e-06
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    47   8e-06
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    47   1e-05
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    46   1e-05
Kwal_23.2913                                                           45   2e-05
Scas_613.24                                                            44   3e-05
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    41   8e-05
Scas_696.9                                                             44   1e-04
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            44   1e-04
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    42   2e-04
Kwal_34.15907                                                          41   8e-04
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    40   0.001
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    39   0.002
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    39   0.003
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    37   0.011
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         35   0.043
Scas_671.1*                                                            34   0.050
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    33   0.30 
Kwal_14.1028                                                           30   2.1  

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/294 (100%), Positives = 294/294 (100%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKK 60
           MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKK
Sbjct: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKK 60

Query: 61  IVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASA 120
           IVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASA
Sbjct: 61  IVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASA 120

Query: 121 GCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNG 180
           GCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNG
Sbjct: 121 GCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNG 180

Query: 181 GYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGV 240
           GYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGV
Sbjct: 181 GYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGV 240

Query: 241 VRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCRA 294
           VRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCRA
Sbjct: 241 VRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCRA 294

>Kwal_26.8669
          Length = 296

 Score =  486 bits (1252), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 232/290 (80%), Positives = 257/290 (88%)

Query: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVA 63
           +D + LPF YQF AGAVAG+SEILVMYPLDVVKTRMQLQV GG GP Y GVVDC+K+IVA
Sbjct: 2   TDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVA 61

Query: 64  GEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCV 123
            EG  RLYKGISSP+LMEAPKRATKFACNDEFQK+YK+ FGVEKL+Q LS+L+GASAGC 
Sbjct: 62  KEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCC 121

Query: 124 EAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYF 183
           EAFVVVPFELVKIRLQD SSSYKGP+DVVRKI+A+EGVLAMYNGLESTLWRH +WN GYF
Sbjct: 122 EAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYF 181

Query: 184 GIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRK 243
           GIIFQ RALLP A +K+Q   NDLI+ SIG +IG ++STPFDVVKSRIQNTAV+ G  RK
Sbjct: 182 GIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARK 241

Query: 244 YNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCR 293
           YNWS PS+ TIY+EEGFRALYKGFVPKVLRLGPGGGILLVVFTG +DF R
Sbjct: 242 YNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFR 291

 Score = 34.3 bits (77), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 41/104 (39%), Gaps = 5/104 (4%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQ-LQVQGGAGPHYTGVVDCLK 59
           +  + +KS        AG++ G    L+  P DVVK+R+Q   V  G    Y      + 
Sbjct: 191 LPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIF 250

Query: 60  KIVAGEGVGRLYKGISSPILMEAPKRATKF----ACNDEFQKLY 99
            I   EG   LYKG    +L   P           C D F+ L+
Sbjct: 251 TIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTLH 294

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score =  464 bits (1194), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 219/291 (75%), Positives = 249/291 (85%)

Query: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVA 63
           SD K LPF+YQF AGAVAGVSEILVMYPLD+VKT MQLQV GG+GP Y GV DCLK+I A
Sbjct: 2   SDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAA 61

Query: 64  GEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCV 123
            EG  RLYKGISSPILMEAPKRATKFACNDEFQK+YK  FG EKL+QPLS+L+GASAG  
Sbjct: 62  KEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGIC 121

Query: 124 EAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYF 183
           E+FVVVPFELVKIRLQD SS +  P+ VV+ IV +EG+LAMYNGLEST+WRH +WN GYF
Sbjct: 122 ESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYF 181

Query: 184 GIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRK 243
           GIIFQ RALLP A  K++   NDL++ ++G ++  +LSTPFDVVKSR+QNTAVIPGV RK
Sbjct: 182 GIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRK 241

Query: 244 YNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCRA 294
           YNWS P+L TIY+EEGF+ALYKGFVPKVLRLGPGGGILLVVFTGV+DF R 
Sbjct: 242 YNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRT 292

 Score = 35.4 bits (80), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 34/84 (40%), Gaps = 1/84 (1%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQ-LQVQGGAGPHYTGVVDCLK 59
           +  + TKS        AG V G    L+  P DVVK+R+Q   V  G    Y      L 
Sbjct: 191 LPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALA 250

Query: 60  KIVAGEGVGRLYKGISSPILMEAP 83
            I   EG   LYKG    +L   P
Sbjct: 251 TIYKEEGFKALYKGFVPKVLRLGP 274

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score =  400 bits (1029), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 193/305 (63%), Positives = 236/305 (77%), Gaps = 15/305 (4%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGP----------H 50
           M+S D + LPF+YQF AGA+AGVSE+LVMYPLDVVKTRMQLQV     P          H
Sbjct: 1   MTSIDNRPLPFIYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDH 60

Query: 51  YTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVE--KL 108
           YTGV+DCL KIV  EG   LYKGI+SPILMEAPKRA KF+ ND FQ  YK+ F     ++
Sbjct: 61  YTGVMDCLTKIVKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEM 120

Query: 109 SQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGL 168
           +Q +++ +GASAG VEAFVV PFELVKIRLQD +S +K P++VV+  V + GVL+++NGL
Sbjct: 121 TQKIAIYSGASAGAVEAFVVAPFELVKIRLQDVNSQFKTPIEVVKNSVVKGGVLSLFNGL 180

Query: 169 ESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVK 228
           E+T+WRH LWN GYFGIIFQ R LLPAA   T+   NDLI+ +IG ++GC+L+TPFDVVK
Sbjct: 181 EATIWRHVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVK 240

Query: 229 SRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGV 288
           SRIQ ++   G +RKYNWSLPS+L +YREEGF+ALYKGF PKV+RL PGGG+LLVVFT V
Sbjct: 241 SRIQRSS---GPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVVFTNV 297

Query: 289 LDFCR 293
           +DF R
Sbjct: 298 MDFFR 302

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score =  398 bits (1022), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 184/299 (61%), Positives = 230/299 (76%), Gaps = 7/299 (2%)

Query: 2   SSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQ-------GGAGPHYTGV 54
           S S+ K LPF+YQF +GAVAG+SE+ VMYPLDVVKTR QL+V        G     Y GV
Sbjct: 3   SDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGV 62

Query: 55  VDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSM 114
           +DCLKKIV  EG  RLY+GISSP+LMEAPKRATKFACND++QK++K  F   + +Q +S+
Sbjct: 63  IDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISI 122

Query: 115 LAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWR 174
            AGASAG  EA V+VPFEL+KIR+QD  SSY GP+D ++K +  EG++ +Y G+EST+WR
Sbjct: 123 AAGASAGMTEAAVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWR 182

Query: 175 HALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNT 234
           +ALWNGGYFG+I+Q R  +P A  K Q   NDLI+ +IG ++G ML+TPFDVVKSRIQ+ 
Sbjct: 183 NALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSV 242

Query: 235 AVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCR 293
             +   V+KYNW LPSLL IYREEGFRALYKGFVPKV RL PGG ++LVVFTG+++F R
Sbjct: 243 DAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFR 301

 Score = 34.3 bits (77), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 35/84 (41%), Gaps = 1/84 (1%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQ-LQVQGGAGPHYTGVVDCLK 59
           M  + TK         AGA+ G    ++  P DVVK+R+Q +     A   Y   +  L 
Sbjct: 201 MPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLL 260

Query: 60  KIVAGEGVGRLYKGISSPILMEAP 83
            I   EG   LYKG    +   AP
Sbjct: 261 VIYREEGFRALYKGFVPKVCRLAP 284

>Scas_640.25
          Length = 306

 Score =  384 bits (987), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 185/299 (61%), Positives = 235/299 (78%), Gaps = 8/299 (2%)

Query: 2   SSSDTKS-LPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAG----PHYTGVVD 56
           S+ +T++ LPF YQF AGA+AG+SE++VMYPLDVVKTRMQLQV  GA      HY GV+D
Sbjct: 3   SNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVID 62

Query: 57  CLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLA 116
           CL +IV  EG   +YKGISSP+LMEAPKRA KFA NDEF KL+K  FG ++L+Q +S+L+
Sbjct: 63  CLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLS 122

Query: 117 GASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHA 176
           GASAG  EA V+VPFELVKIRLQD +S +KGPV+V++ I+ ++G+  +Y+G+EST+WR+A
Sbjct: 123 GASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNA 182

Query: 177 LWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQN--T 234
           +WN GYFG+IFQ R LLP A +K +   NDL +  +G + G M +TPFDVVKSRIQ+   
Sbjct: 183 VWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGN 242

Query: 235 AVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCR 293
            +I G VRKYNW+ PS++ IY EEGFRALYKGFVPKVLRLGPGG +LLVVFT V++  R
Sbjct: 243 EIING-VRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFR 300

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score =  374 bits (959), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 186/294 (63%), Positives = 224/294 (76%), Gaps = 11/294 (3%)

Query: 7   KSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGP--HYTGVVDCLKKIVAG 64
           K LPF+YQF +GA AGVSE+LVMYPLDVVKTRMQLQV  G G    Y GV+DCL +IV  
Sbjct: 4   KPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKR 63

Query: 65  EGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVE 124
           EG  RLYKGISSP+LMEAPKRATKFACND +QK++K  +GV+KL+Q +S+L+G+ AG  E
Sbjct: 64  EGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTE 123

Query: 125 AFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFG 184
           A V+VPFELVKIRLQD +S + GP++VV K +   G+L++YNGLEST+WR+A WNGGYFG
Sbjct: 124 ACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFG 183

Query: 185 IIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTP---FDVVKSRIQNTAVIP--- 238
           +IFQ RALLP A   T+  TNDLI+ +IG    C  ST      VVKSRIQ+ A      
Sbjct: 184 VIFQIRALLPKAKTNTEKTTNDLIAGTIGGY--CRYSTEHTILSVVKSRIQSGATTTLAD 241

Query: 239 -GVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDF 291
             VV KYNW+ PSL  IY EEGF ALYKGF+PK+LRLGPGGGI+LVVF G++ F
Sbjct: 242 GTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAF 295

>Scas_589.10
          Length = 316

 Score =  295 bits (756), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 141/301 (46%), Positives = 197/301 (65%), Gaps = 13/301 (4%)

Query: 5   DTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGA----------GPHYTGV 54
           D   LPF+YQF +GAVAG+SE ++MYPLDVVKTR QLQ+   A           P ++ +
Sbjct: 7   DPVKLPFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSI 66

Query: 55  VDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSM 114
           + CL KI+  EG   LYKG+S P+LME PKRA KFA N++FQ++  + F +++++  +++
Sbjct: 67  LSCLSKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTL 126

Query: 115 LAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWR 174
           LAG  AG  E+ +VVPFELVKIRLQDA S Y+ P+   R I+  +G+  +Y G EST+WR
Sbjct: 127 LAGTFAGITESLIVVPFELVKIRLQDAQSDYRSPIRCTRTIIENQGLFGIYAGFESTIWR 186

Query: 175 HALWNGGYFGIIFQARALLPAAHNKT--QCITNDLISDSIGCSIGCMLSTPFDVVKSRIQ 232
           + +WN  YFG+IFQ +  +P A + T  Q I ND +  +I   + C LS PFDVVK+R+Q
Sbjct: 187 NTIWNASYFGLIFQVKKFIPRAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTRMQ 246

Query: 233 NTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFC 292
            +      +  Y W+  S+  IYR EG + +YKG +P + R GPGGG+LLVVF GV +  
Sbjct: 247 GSKKTSSGM-CYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGPGGGLLLVVFNGVNELF 305

Query: 293 R 293
           R
Sbjct: 306 R 306

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 34/73 (46%)

Query: 2   SSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKI 61
           + S TK       F  GA+AG     +  P DVVKTRMQ   +  +G  Y      +  I
Sbjct: 208 AKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTRMQGSKKTSSGMCYGWAWQSVFLI 267

Query: 62  VAGEGVGRLYKGI 74
              EG+  +YKGI
Sbjct: 268 YRTEGIKGIYKGI 280

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score =  128 bits (321), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 105/317 (33%), Positives = 153/317 (48%), Gaps = 46/317 (14%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGG-AGPHYTGVVDCLK 59
           MSS    S P +    AG  AG+ E L  +PLD +K RMQ+  +    G    G +   +
Sbjct: 1   MSSKKKSSNPAV-NLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGR 59

Query: 60  KIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEK---LSQPLSMLA 116
            I   EG+  LYKG+ + ++   PK A +F+  +     Y+ A   ++   +S   + LA
Sbjct: 60  NIYTEEGLLALYKGLGAVVIGIIPKMAIRFSSYE----FYRSALADKQTGSVSTGNTFLA 115

Query: 117 GASAGCVEAFVVV-PFELVKIRLQD--------ASSSYKGPVDVVRKIVAREGVLAMYNG 167
           G  AG  EA +VV P E+VKIRLQ         AS  Y+  +     IV  EG+ A+Y G
Sbjct: 116 GVGAGTTEAVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRG 175

Query: 168 LESTLWRHALWNGGYFGIIFQARALLPAAHN-------KTQCITNDLISDSIGCSIGCML 220
           +  T  R A   G  F +  + +  L   H        +T CI   LIS +IG       
Sbjct: 176 VSLTAARQATNQGANFTVYSKLKEFLQEHHKTDALPSWETSCI--GLISGAIGP----FS 229

Query: 221 STPFDVVKSRIQ---NTAVIPGVVRKYNWSLPSLLTI----YREEGFRALYKGFVPKVLR 273
           + P D +K+R+Q   +TA + G      WS   ++TI     +EEGFRALYKG  P+V+R
Sbjct: 230 NAPLDTIKTRLQKDKSTANMSG------WS--RIVTIGKQLIKEEGFRALYKGITPRVMR 281

Query: 274 LGPGGGILLVVFTGVLD 290
           + PG  +   V+  V +
Sbjct: 282 VAPGQAVTFTVYEFVRE 298

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 86/201 (42%), Gaps = 16/201 (7%)

Query: 106 EKLSQP-LSMLAGASAGCVEAFVVVPFELVKIRLQ----DASSSYKGP--VDVVRKIVAR 158
           +K S P ++++AG +AG  EA    P + +K+R+Q     A    K P  +   R I   
Sbjct: 5   KKSSNPAVNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTE 64

Query: 159 EGVLAMYNGLESTLW----RHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGC 214
           EG+LA+Y GL + +     + A+    Y    F   AL              L     G 
Sbjct: 65  EGLLALYKGLGAVVIGIIPKMAIRFSSYE---FYRSALADKQTGSVSTGNTFLAGVGAGT 121

Query: 215 SIGCMLSTPFDVVKSRIQNTAVIPGVVR--KYNWSLPSLLTIYREEGFRALYKGFVPKVL 272
           +   ++  P +VVK R+Q   + P      +Y  +L +   I +EEG  ALY+G      
Sbjct: 122 TEAVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAA 181

Query: 273 RLGPGGGILLVVFTGVLDFCR 293
           R     G    V++ + +F +
Sbjct: 182 RQATNQGANFTVYSKLKEFLQ 202

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score =  132 bits (331), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 95/286 (33%), Positives = 141/286 (49%), Gaps = 21/286 (7%)

Query: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLY 71
           LY F  G++AG     V+YP+D +KTRMQ Q    +   Y   +DCL KI++ EG+  LY
Sbjct: 531 LYNFSLGSIAGCIGATVVYPIDFIKTRMQAQ---RSLAQYKNSIDCLLKIISREGIKGLY 587

Query: 72  KGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPF 131
            G+   ++  AP++A K   ND  +       G  KLS    +++GASAG  +     P 
Sbjct: 588 SGLGPQLIGVAPEKAIKLTVNDFMRNRLTDKNG--KLSLFPEIISGASAGACQVIFTNPL 645

Query: 132 ELVKIRLQDASSSYKG-----PVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGII 186
           E+VKIRLQ   S Y G       +   +IV + G+  +YNG+ + L R   ++  YF   
Sbjct: 646 EIVKIRLQ-VQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPTY 704

Query: 187 FQARALL----PAAHNKTQCITN--DLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGV 240
              +  L    P    K   +     L + +I       L+TPFDV+K+R+Q   + P  
Sbjct: 705 AHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQ---IDPRK 761

Query: 241 VR-KYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
              KYN    ++ TI +EE FR+ +KG   +VLR  P  G  L  +
Sbjct: 762 GETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAY 807

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           AGA+AG+    +  P DV+KTR+Q+  + G    Y G+   ++ I+  E     +KG  +
Sbjct: 733 AGAIAGMPAAFLTTPFDVIKTRLQIDPRKGE-TKYNGIFHAIRTILKEESFRSFFKGGGA 791

Query: 77  PILMEAPKRATKFACNDEFQ 96
            +L  +P+     A  + F+
Sbjct: 792 RVLRSSPQFGFTLAAYELFK 811

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score =  129 bits (325), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 91/287 (31%), Positives = 142/287 (49%), Gaps = 24/287 (8%)

Query: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLY 71
           +Y F  G+VAG    +V+YP+D+VKTRMQ Q        Y   +DCL KI++ EGV  LY
Sbjct: 525 IYNFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFS---KYKNSIDCLLKILSKEGVRGLY 581

Query: 72  KGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPF 131
            G+   ++  AP++A K   ND  +       G  KLS P  +++GA+AG  +     P 
Sbjct: 582 SGLGPQLIGVAPEKAIKLTVNDHMRATLAGRDG--KLSLPCEIISGATAGACQVVFTNPL 639

Query: 132 ELVKIRLQ-------DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFG 184
           E+VKIRLQ       DA+ +    + V++ +    G++ +Y G  + L R   ++  YF 
Sbjct: 640 EIVKIRLQVKSDYVADAARNSVNAISVIKNL----GLIGLYRGAGACLLRDIPFSAIYFP 695

Query: 185 IIFQARALL----PAAHNKTQCIT--NDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIP 238
                ++ +    P   +K   +     L+S  +       L+TPFDV+K+R+Q      
Sbjct: 696 TYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKG 755

Query: 239 GVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
             V  YN    +  TI +EEG ++ +KG   +VLR  P  G  L  +
Sbjct: 756 ESV--YNGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAY 800

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           +G +AG+    +  P DV+KTR+Q+  + G    Y G+ D  + I+  EG+   +KG  +
Sbjct: 726 SGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESV-YNGIWDAARTILKEEGIKSFFKGGPA 784

Query: 77  PILMEAPKRATKFACNDEFQKLY 99
            +L  +P+     A  + F  L+
Sbjct: 785 RVLRSSPQFGFTLAAYEIFHNLF 807

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score =  124 bits (311), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 100/314 (31%), Positives = 148/314 (47%), Gaps = 36/314 (11%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQL--QVQGGAGPHYTGVVDCL 58
           MS     S P +    AG  AG+ E L  +PLD +K RMQ+  +V G       G +   
Sbjct: 1   MSQKKKASHPAI-NLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTG 59

Query: 59  KKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY-KQAFGVEKLSQPLSMLAG 117
           + I   EG   LYKG+ + ++   PK A +F+  + ++ L   +  G+  +S   + +AG
Sbjct: 60  RTIYQKEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGI--VSTGNTFVAG 117

Query: 118 ASAGCVEAFVVV-PFELVKIRLQ---------DASSSYKGPVDVVRKIVAREGVLAMYNG 167
             AG  EA +VV P E+VKIRLQ         +A   Y   +     IV  EGV A+Y G
Sbjct: 118 VGAGITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRG 177

Query: 168 LESTLWRHALWNGGYFGIIFQARALLPAAHN-------KTQCITNDLISDSIGCSIGCML 220
           +  T  R A   G  F +  + +  L   H        +T CI   LIS +IG       
Sbjct: 178 VSLTAARQATNQGANFTVYSKLKEFLQNYHQMDVLPSWETSCI--GLISGAIGP----FS 231

Query: 221 STPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTI----YREEGFRALYKGFVPKVLRLGP 276
           + P D +K+R+Q    I     +    +  ++TI     +EEGFRALYKG  P+V+R+ P
Sbjct: 232 NAPLDTIKTRLQKDKSIS---LEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAP 288

Query: 277 GGGILLVVFTGVLD 290
           G  +   V+  V +
Sbjct: 289 GQAVTFTVYEYVRE 302

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 87/200 (43%), Gaps = 12/200 (6%)

Query: 106 EKLSQP-LSMLAGASAGCVEAFVVVPFELVKIRLQ-----DASSSYKGP--VDVVRKIVA 157
           +K S P ++++AG +AG  EA    P + +K+R+Q           K P  +   R I  
Sbjct: 5   KKASHPAINLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQ 64

Query: 158 REGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISD-SIGCSI 216
           +EG LA+Y GL + +          F      R LL    +      N  ++    G + 
Sbjct: 65  KEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGAGITE 124

Query: 217 GCMLSTPFDVVKSRIQNTAVIPGVVR---KYNWSLPSLLTIYREEGFRALYKGFVPKVLR 273
             ++  P +VVK R+Q   + P       KYN ++ +  TI +EEG  ALY+G      R
Sbjct: 125 AVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAAR 184

Query: 274 LGPGGGILLVVFTGVLDFCR 293
                G    V++ + +F +
Sbjct: 185 QATNQGANFTVYSKLKEFLQ 204

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score =  122 bits (306), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 93/295 (31%), Positives = 138/295 (46%), Gaps = 19/295 (6%)

Query: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVA 63
           S  KS        AG  AG+ E L  +PLD +K RMQ+  +   G    G +     I +
Sbjct: 50  SSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYS 109

Query: 64  GEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY-KQAFGVEKLSQPLSMLAGASAGC 122
           GEG+   YKG+ + ++   PK A +F+  + ++ L   +  GV  +S   + LAG  AG 
Sbjct: 110 GEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGV--VSTGNTFLAGVGAGV 167

Query: 123 VEAFVVV-PFELVKIRLQ-------DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWR 174
            EA +VV P E+VKIRLQ            Y+  +     IV  EG+ A+Y G+  T  R
Sbjct: 168 TEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAAR 227

Query: 175 HALWNGGYFGIIFQARALLPAAHNKTQCIT--NDLISDSIGCSIGCMLSTPFDVVKSRIQ 232
            A   G  F +  +    L   H      +    LI    G +IG   + P D +K+R+Q
Sbjct: 228 QATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSG-AIGPFSNAPLDTIKTRLQ 286

Query: 233 NTAVIPGVVRKYNWSLPSLL--TIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
                  +    NW   + +   + +EEGFRALYKG  P+V+R+ PG  +   V+
Sbjct: 287 KDKSTRNLS---NWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVY 338

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 96/222 (43%), Gaps = 9/222 (4%)

Query: 78  ILMEAPKRATKFACNDEFQKLY-KQAFGVEKLSQP-LSMLAGASAGCVEAFVVVPFELVK 135
           + + A +R+    C+   Q+ Y       +K + P ++++AG +AG  EA    P + +K
Sbjct: 23  VYIGARRRSVADPCSAVCQQPYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIK 82

Query: 136 IRLQDASSSYKG--PVDVVR---KIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQAR 190
           +R+Q    + +G  P   +R    I + EG+LA Y GL + +          F      R
Sbjct: 83  VRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYR 142

Query: 191 ALLPAAHNKTQCITNDLISD-SIGCSIGCMLSTPFDVVKSRIQNTAVIPGV-VRKYNWSL 248
            LL           N  ++    G +   ++  P +VVK R+Q   +      +KY  ++
Sbjct: 143 TLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAI 202

Query: 249 PSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLD 290
            +   I +EEG  ALY+G      R     G    V++ +++
Sbjct: 203 QAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLME 244

>Scas_691.4
          Length = 334

 Score =  121 bits (303), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 102/327 (31%), Positives = 147/327 (44%), Gaps = 58/327 (17%)

Query: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQL-QVQGGAGPHYTGVVDCLKKIV 62
           +D KS P L    AG  AG+ E L  +PLD +K RMQ+ +   G  PH  G +   + I 
Sbjct: 7   NDKKSSP-LINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPH--GFITTGRNIY 63

Query: 63  AGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLS----MLAGA 118
           + EG   LYKG+ + ++   PK A +F+  +     Y+ A   +K ++ ++     LAG 
Sbjct: 64  SHEGFLALYKGLGAVVIGIIPKMAIRFSSYE----FYRNAL-TDKETRTITTGNTFLAGV 118

Query: 119 SAGCVEAFVVV-PFELVKIRLQD----------------------ASSSYKGPVDVVRKI 155
            AG  EA +VV P E+VKIRLQ                           Y   +     I
Sbjct: 119 GAGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTI 178

Query: 156 VAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNK-------TQCITNDLI 208
           V  EG  A+Y G+  T  R A   G  F +    +  L   HN+       T CI   LI
Sbjct: 179 VKEEGAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRESLPSWETSCI--GLI 236

Query: 209 SDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLL--TIYREEGFRALYKG 266
           S +IG       + P D +K+R+Q    I        W    ++   + +EEGFRALYKG
Sbjct: 237 SGAIGP----FSNAPLDTIKTRLQKDKSISS---NSAWKKIYIIGTQLIKEEGFRALYKG 289

Query: 267 FVPKVLRLGPGGGILLVVFTGVLDFCR 293
             P+V+R+ PG  +   V+    +F R
Sbjct: 290 ITPRVMRVAPGQAVTFTVY----EFVR 312

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 42/93 (45%)

Query: 5   DTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAG 64
           + +SLP       G ++G        PLD +KTR+Q      +   +  +     +++  
Sbjct: 221 NRESLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKE 280

Query: 65  EGVGRLYKGISSPILMEAPKRATKFACNDEFQK 97
           EG   LYKGI+  ++  AP +A  F   +  +K
Sbjct: 281 EGFRALYKGITPRVMRVAPGQAVTFTVYEFVRK 313

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score =  122 bits (305), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 89/289 (30%), Positives = 139/289 (48%), Gaps = 27/289 (9%)

Query: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLY 71
           LY F  G+VAG     ++YP+D VKTRMQ Q    +   Y   +DC  KI++ EG+  +Y
Sbjct: 544 LYNFSLGSVAGCIGATIVYPIDFVKTRMQAQ---RSLSQYKNSIDCFLKILSREGIRGVY 600

Query: 72  KGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPF 131
            G+   ++  AP++A K   ND  +   K   G  KL     +++GASAG  +     P 
Sbjct: 601 SGLGPQLIGVAPEKAIKLTVNDYMRNKLKDKNG--KLGLLSEIISGASAGACQVIFTNPL 658

Query: 132 ELVKIRLQDASSSYKGPVDVVR----KIVAREGVLAMYNGLESTLWRHALWNGGYFGIIF 187
           E+VKIRLQ          +  +    +I+ R G+  +Y G  + L R   ++  YF    
Sbjct: 659 EIVKIRLQVKGEYVAENAENAKLTALQIIKRLGLPGLYKGAAACLLRDVPFSAIYFPTYA 718

Query: 188 QARALL----PAAHNK-TQCITNDLIS-DSIGCSIGCMLSTPFDVVKSRIQ-----NTAV 236
             +  L    P   NK ++  T +L+S  ++       L+TPFDV+K+R+Q        +
Sbjct: 719 HLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGETI 778

Query: 237 IPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
             G++        +  TI REE F++ +KG   +VLR  P  G  L  +
Sbjct: 779 YKGIIH-------AARTILREESFKSFFKGGAARVLRSSPQFGFTLAAY 820

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 47/180 (26%), Positives = 85/180 (47%), Gaps = 16/180 (8%)

Query: 9   LPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVG 68
           L  L +  +GA AG  +++   PL++VK R+Q++ +  A       +  L +I+   G+ 
Sbjct: 635 LGLLSEIISGASAGACQVIFTNPLEIVKIRLQVKGEYVAENAENAKLTAL-QIIKRLGLP 693

Query: 69  RLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVE--------KLSQPLSMLAGASA 120
            LYKG ++ +L + P  A  F     +  L +  F  +        +L+    + AGA A
Sbjct: 694 GLYKGAAACLLRDVPFSAIYFP---TYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALA 750

Query: 121 GCVEAFVVVPFELVKIRLQ----DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHA 176
           G   A++  PF+++K RLQ       + YKG +   R I+  E   + + G  + + R +
Sbjct: 751 GMPAAYLTTPFDVIKTRLQIDPKKGETIYKGIIHAARTILREESFKSFFKGGAARVLRSS 810

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           AGA+AG+    +  P DV+KTR+Q+  + G    Y G++   + I+  E     +KG ++
Sbjct: 746 AGALAGMPAAYLTTPFDVIKTRLQIDPKKGETI-YKGIIHAARTILREESFKSFFKGGAA 804

Query: 77  PILMEAPKRATKFACNDEFQKLY 99
            +L  +P+     A  + F  ++
Sbjct: 805 RVLRSSPQFGFTLAAYELFHNIF 827

>Scas_602.8
          Length = 885

 Score =  119 bits (298), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 87/291 (29%), Positives = 138/291 (47%), Gaps = 31/291 (10%)

Query: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLY 71
           ++ F  G+VAG     ++YP+D +KTRMQ Q    +   Y   +DCL KI   EG+  LY
Sbjct: 499 IFNFSLGSVAGCIGATLVYPIDFIKTRMQAQ---RSLTKYKNSIDCLVKIFGKEGIRGLY 555

Query: 72  KGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPF 131
            G+   ++  AP++A K   ND  +K      G  +L     +L+GA+AG  +     P 
Sbjct: 556 SGLGPQLIGVAPEKAIKLTVNDFMRKSLVDKKGNLQLGA--EVLSGATAGACQVVFTNPL 613

Query: 132 ELVKIRLQDASSSYKGPVDVVR----KIVAREGVLAMYNGLESTLWRHALWNGGYFGIIF 187
           E+VKIRLQ  S      +   +    +I+    ++ +Y G+ + L R   ++  YF    
Sbjct: 614 EIVKIRLQVKSEYTNAMIPKSQLTAFQIIKELKLIGLYKGVGACLLRDVPFSAIYFPTYA 673

Query: 188 QARALLPAAHNKTQCITND------------LISDSIGCSIGCMLSTPFDVVKSRIQNTA 235
             +       N  Q   ND            L + ++       L+TPFDV+K+R+Q   
Sbjct: 674 HLK------KNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQ--- 724

Query: 236 VIPGVVR-KYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
           + PGV   +Y   L ++ TI +EE FR+ +KG   +V+R  P  G  L  +
Sbjct: 725 IEPGVGETRYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAY 775

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 48/193 (24%), Positives = 83/193 (43%), Gaps = 17/193 (8%)

Query: 96  QKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASS--SYKGPVDVVR 153
           + LY+  +         +   G+ AGC+ A +V P + +K R+Q   S   YK  +D + 
Sbjct: 484 ESLYRNYYFYPIFDSIFNFSLGSVAGCIGATLVYPIDFIKTRMQAQRSLTKYKNSIDCLV 543

Query: 154 KIVAREGVLAMYNGLESTLWRHALWNGGYFGI-IFQARALLPAAHNKTQCITNDLISDSI 212
           KI  +EG+  +Y+GL   L   A        +  F  ++L+    N    +  +++S + 
Sbjct: 544 KIFGKEGIRGLYSGLGPQLIGVAPEKAIKLTVNDFMRKSLVDKKGNLQ--LGAEVLSGAT 601

Query: 213 GCSIGCMLSTPFDVVKSRIQ-----NTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGF 267
             +   + + P ++VK R+Q       A+IP        S  +   I +E     LYKG 
Sbjct: 602 AGACQVVFTNPLEIVKIRLQVKSEYTNAMIPK-------SQLTAFQIIKELKLIGLYKGV 654

Query: 268 VPKVLRLGPGGGI 280
              +LR  P   I
Sbjct: 655 GACLLRDVPFSAI 667

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 50/96 (52%), Gaps = 7/96 (7%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAG-PHYTGVVDCLKKIVAGEGVGRLYKGIS 75
           AGA+AGV    +  P DV+KTR  LQ++ G G   YTG++  ++ I+  E     +KG +
Sbjct: 701 AGALAGVPAAFLTTPFDVIKTR--LQIEPGVGETRYTGILHAVRTILKEESFRSFFKGGA 758

Query: 76  SPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQP 111
           + ++  +P+     A  +    L+K  F +    QP
Sbjct: 759 ARVMRSSPQFGFTLAAYE----LFKNMFNISDDKQP 790

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score =  117 bits (292), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 89/291 (30%), Positives = 140/291 (48%), Gaps = 32/291 (10%)

Query: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLY 71
           +Y F  G++AG     V+YP+D+VKTRMQ Q    +   Y   +DC  KI + EG+  +Y
Sbjct: 519 IYNFTLGSIAGCIGATVVYPIDLVKTRMQAQ---RSFSQYKNSIDCFAKIFSREGIRGIY 575

Query: 72  KGISSPILMEAPKRATKFACNDEFQK--LYKQAFGVEKLSQPLSMLAGASAGCVEAFVVV 129
            G+   ++  AP++A K   ND  +   + K A     L     +L+GA AG  +     
Sbjct: 576 SGLGPQLIGVAPEKAIKLTVNDYMRGRLMDKHA----NLKWYFEILSGACAGACQVVFTN 631

Query: 130 PFELVKIRLQDASSSYKGPVDVVRK------IVAREGVLAMYNGLESTLWRHALWNGGYF 183
           P E+VKIRLQ   S Y G  DV++       ++ + G+  +Y G+ + L R   ++  YF
Sbjct: 632 PLEVVKIRLQ-VRSEYAG--DVLKSQVTALGVIKQLGIKGLYKGIAACLMRDVPFSAIYF 688

Query: 184 GI-------IFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAV 236
                    +F+         NK +     L++  +       L+TPFDV+K+R+Q   +
Sbjct: 689 PTYAHLKKDVFKYDPKDKKQRNKLK-TWELLVAGGLAGMPAAYLTTPFDVIKTRLQ---I 744

Query: 237 IP--GVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
            P  G  R Y     +  TI +EE F++ +KG   +VLR  P  G  L  +
Sbjct: 745 DPRKGETR-YEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAY 794

 Score = 66.6 bits (161), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 51/184 (27%), Positives = 86/184 (46%), Gaps = 23/184 (12%)

Query: 8   SLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGV 67
           +L + ++  +GA AG  +++   PL+VVK R+Q++ +      Y G  D LK  V   GV
Sbjct: 609 NLKWYFEILSGACAGACQVVFTNPLEVVKIRLQVRSE------YAG--DVLKSQVTALGV 660

Query: 68  GR------LYKGISSPILMEAPKRATKFAC-----NDEFQKLYKQAFGVEKLSQPLSMLA 116
            +      LYKGI++ ++ + P  A  F        D F+   K      KL     ++A
Sbjct: 661 IKQLGIKGLYKGIAACLMRDVPFSAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVA 720

Query: 117 GASAGCVEAFVVVPFELVKIRLQ----DASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172
           G  AG   A++  PF+++K RLQ       + Y+G     R I+  E   + + G  + +
Sbjct: 721 GGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYEGIFHAARTILKEESFKSFFKGGSARV 780

Query: 173 WRHA 176
            R +
Sbjct: 781 LRSS 784

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           AG +AG+    +  P DV+KTR+Q+  + G    Y G+    + I+  E     +KG S+
Sbjct: 720 AGGLAGMPAAYLTTPFDVIKTRLQIDPRKGE-TRYEGIFHAARTILKEESFKSFFKGGSA 778

Query: 77  PILMEAPKRATKFACNDEFQKLY 99
            +L  +P+     A  + FQ ++
Sbjct: 779 RVLRSSPQFGFTLAAYEIFQNMF 801

>Kwal_47.17321
          Length = 881

 Score =  116 bits (291), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 91/286 (31%), Positives = 141/286 (49%), Gaps = 22/286 (7%)

Query: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLY 71
           +Y F  G+VAG      +YP+D+VKTRMQ Q        Y   +DC  KI + EG+  +Y
Sbjct: 501 IYNFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFS---QYKNSIDCFVKIFSREGIRGIY 557

Query: 72  KGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPF 131
            G+   ++  AP++A K   ND  +KL        +L+ PL +++GA+AG  +     P 
Sbjct: 558 SGLGPQLVGVAPEKAIKLTVNDYVRKLLMDE--NNRLTLPLEIISGAAAGACQVIFTNPL 615

Query: 132 ELVKIRLQDASSSYKGPVDVVR----KIVAREGVLAMYNGLESTLWRHALWNGGYFGIIF 187
           E+VKIRLQ   S Y   +   +     +V   G+  +Y GL + L R   ++  YF    
Sbjct: 616 EIVKIRLQ-VRSEYADSLPKSQLTALGVVKSLGLRGLYKGLVACLMRDVPFSAIYFPTYA 674

Query: 188 QARALL----PAAHNK-TQCITNDLISD-SIGCSIGCMLSTPFDVVKSRIQNTAVIP--G 239
             +  +    P   NK  +  T +L++   +       L+TPFDV+K+R+Q   + P  G
Sbjct: 675 HLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQ---IDPRKG 731

Query: 240 VVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
             R Y   L +  TI +EE F++ +KG   +VLR  P  G  L  +
Sbjct: 732 ETR-YTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAY 776

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           AG +AG+    +  P DV+KTR+Q+  + G    YTG++   + I+  E     +KG  +
Sbjct: 702 AGGLAGMPAAYLTTPFDVIKTRLQIDPRKGE-TRYTGILHAARTILKEERFKSFFKGGGA 760

Query: 77  PILMEAPKRATKFACNDEFQKLY 99
            +L  +P+     A  + FQ ++
Sbjct: 761 RVLRSSPQFGFTLAAYEIFQNMF 783

>Kwal_47.18216
          Length = 333

 Score =  112 bits (281), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 96/326 (29%), Positives = 140/326 (42%), Gaps = 48/326 (14%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQG-GAGPHYTGVVDCLK 59
           MS+    S P +    AG  AG+ E L  +PLD +K RMQ+  +    G    G +   +
Sbjct: 1   MSNRKNSSHPAI-NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTAR 59

Query: 60  KIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY-KQAFGVEKLSQPLSMLAGA 118
            I   EG   LYKG+ + ++   PK A +F   + F+ L   +  GV  +S   + +AG 
Sbjct: 60  DISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGV--VSTGNTFVAGV 117

Query: 119 SAGCVEAFVVV-PFELVKIRLQ----------------------------------DASS 143
            AG  EA +VV P E+VKIRLQ                                   A+ 
Sbjct: 118 GAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATP 177

Query: 144 SYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCI 203
            Y+  +     IV  EG  A+Y G+  T  R A   G  F +    ++ L   H      
Sbjct: 178 KYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLP 237

Query: 204 T--NDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWS--LPSLLTIYREEG 259
           +    LI   I  ++G   + P D +K+R+Q         +   WS  L     + REEG
Sbjct: 238 SWETSLIG-LISGALGPFSNAPLDTIKTRLQKD---KSTSKDSGWSRILAIGRQLIREEG 293

Query: 260 FRALYKGFVPKVLRLGPGGGILLVVF 285
           FRALYKG  P+V+R+ PG  +   V+
Sbjct: 294 FRALYKGITPRVMRVAPGQAVTFTVY 319

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 84/228 (36%), Gaps = 64/228 (28%)

Query: 109 SQP-LSMLAGASAGCVEAFVVVPFELVKIRLQ------DASSSYKGPVDVVRKIVAREGV 161
           S P ++++AG +AG  EA    P + +K+R+Q      +     +G +   R I  +EG 
Sbjct: 8   SHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGF 67

Query: 162 LAMYNGLESTLWRHALWNGGYFGIIFQA----------RALLPAAHNKTQCITNDLISD- 210
           LA+Y GL + +           GII +           R LL           N  ++  
Sbjct: 68  LALYKGLGAVV----------IGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGV 117

Query: 211 SIGCSIGCMLSTPFDVVKSRIQ--------------------------------NTAVIP 238
             G +   M+  P +VVK R+Q                                N A  P
Sbjct: 118 GAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATP 177

Query: 239 GVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFT 286
               KY  ++ +   I +EEG RALY+G      R     G    V++
Sbjct: 178 ----KYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYS 221

 Score = 40.4 bits (93), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 48/108 (44%), Gaps = 6/108 (5%)

Query: 5   DTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAG 64
            T  LP       G ++G        PLD +KTR+Q          ++ ++   ++++  
Sbjct: 232 QTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIRE 291

Query: 65  EGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPL 112
           EG   LYKGI+  ++  AP +A  F   +  +K       +E L+ PL
Sbjct: 292 EGFRALYKGITPRVMRVAPGQAVTFTVYELIRK------KLEGLTAPL 333

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score =  110 bits (275), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 95/301 (31%), Positives = 137/301 (45%), Gaps = 25/301 (8%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQG-GAGPHYTGVVDCLK 59
           M+S    S P +    AG  AG+ E L  +PLD +K RMQ+     G+G    G +    
Sbjct: 1   MASKQKSSNPAV-NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGG 59

Query: 60  KIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGAS 119
           +I   EG    YKG+ + ++   PK A +F+  + ++ L        K+S   + +AG  
Sbjct: 60  EIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADK-ETGKVSTGNTFIAGVG 118

Query: 120 AGCVEAFVVVPFELV-KIRLQ-------DASSSYKGPVDVVRKIVAREGVLAMYNGLEST 171
           AG  EA VVV    V KIRLQ       + +  YK  V     IV  EG  A+Y G+  T
Sbjct: 119 AGITEAVVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLT 178

Query: 172 LWRHALWNGGYFGIIFQARALLPAAHNKTQCIT--NDLISDSIGCSIGCMLSTPFDVVKS 229
             R A   G  F +  + +  L   HN+    +    LI   I  +IG   + P D +K+
Sbjct: 179 AARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIG-LISGAIGPFSNAPLDTIKT 237

Query: 230 RIQNTAVIPGVVRKYNWSLPSLLTIY-----REEGFRALYKGFVPKVLRLGPGGGILLVV 284
           R+Q            N S    +TI      +EEGFRALYKG  P+V+R+ PG  +    
Sbjct: 238 RLQKDKSTK------NMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTA 291

Query: 285 F 285
           +
Sbjct: 292 Y 292

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 84/197 (42%), Gaps = 9/197 (4%)

Query: 106 EKLSQP-LSMLAGASAGCVEAFVVVPFELVKIRLQ----DASSSYKGP--VDVVRKIVAR 158
           +K S P ++++AG  AG +E     P + +K+R+Q       S  K P  +    +I   
Sbjct: 5   QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRN 64

Query: 159 EGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISD-SIGCSIG 217
           EG LA Y GL + +          F      R LL           N  I+    G +  
Sbjct: 65  EGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEA 124

Query: 218 CMLSTPFDVVKSRIQNTAVIP-GVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
            ++  P +VVK R+Q   + P     KY  ++ +  TI +EEGF ALY+G      R   
Sbjct: 125 VVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQAT 184

Query: 277 GGGILLVVFTGVLDFCR 293
             G    V++ + +F +
Sbjct: 185 NQGANFTVYSKLKEFLQ 201

 Score = 35.0 bits (79), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 40/93 (43%)

Query: 5   DTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAG 64
           + + LP       G ++G        PLD +KTR+Q             +    K+++  
Sbjct: 205 NQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQE 264

Query: 65  EGVGRLYKGISSPILMEAPKRATKFACNDEFQK 97
           EG   LYKGI+  ++  AP +A  F   +  +K
Sbjct: 265 EGFRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score =  113 bits (283), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 86/291 (29%), Positives = 138/291 (47%), Gaps = 32/291 (10%)

Query: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLY 71
           ++ F  G++AG     V+YP+D+VKTRMQ Q        Y   +DC+ KI   +G+  LY
Sbjct: 505 IHNFTLGSIAGCIGATVVYPIDLVKTRMQAQRNS---VQYKNSIDCVVKIFQTKGIRGLY 561

Query: 72  KGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPF 131
            G+   ++  AP++A K   ND  ++ +       K  Q   +L+GA+AG  +     P 
Sbjct: 562 SGLGPQLIGVAPEKAIKLTVNDFMRQYFMNKSRTIKWYQ--EILSGATAGACQVVFTNPL 619

Query: 132 ELVKIRLQ-------DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFG 184
           E+VKIRLQ       + +    G V ++R++    G+  +Y G  + L R   ++  YF 
Sbjct: 620 EIVKIRLQMRSDYVGENARPQLGAVGIIRQL----GLRGLYKGAAACLLRDVPFSAIYFP 675

Query: 185 IIFQARALL----PAAHNKTQCITN--DLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIP 238
                +  +    P   NK   +     L++  I       L+TPFDV+K+R+Q   + P
Sbjct: 676 TYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQ---IDP 732

Query: 239 GVVRK----YNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
              RK    Y   + +  TI +EE  ++ +KG   +VLR  P  G  L  F
Sbjct: 733 ---RKGETTYTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAF 780

 Score = 67.4 bits (163), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 51/205 (24%), Positives = 95/205 (46%), Gaps = 23/205 (11%)

Query: 6   TKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQ---VQGGAGPHYTGVVDCLKKIV 62
           ++++ +  +  +GA AG  +++   PL++VK R+Q++   V   A P   G V  ++++ 
Sbjct: 593 SRTIKWYQEILSGATAGACQVVFTNPLEIVKIRLQMRSDYVGENARPQL-GAVGIIRQL- 650

Query: 63  AGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVE--------KLSQPLSM 114
              G+  LYKG ++ +L + P  A  F     +  L K  F  +        KL     +
Sbjct: 651 ---GLRGLYKGAAACLLRDVPFSAIYFP---TYAHLKKDVFNFDPNDKNKRNKLKTWELL 704

Query: 115 LAGASAGCVEAFVVVPFELVKIRLQ----DASSSYKGPVDVVRKIVAREGVLAMYNGLES 170
           LAG  AG   A++  PF+++K RLQ       ++Y G +   R I+  E + + + G  +
Sbjct: 705 LAGGIAGMPAAYLTTPFDVIKTRLQIDPRKGETTYTGVIHAARTILKEESIKSFFKGGPA 764

Query: 171 TLWRHALWNGGYFGIIFQARALLPA 195
            + R +   G         + L P+
Sbjct: 765 RVLRSSPQFGFTLAAFEMFQGLFPS 789

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 45/89 (50%), Gaps = 1/89 (1%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74
             AG +AG+    +  P DV+KTR+Q+  + G    YTGV+   + I+  E +   +KG 
Sbjct: 704 LLAGGIAGMPAAYLTTPFDVIKTRLQIDPRKGETT-YTGVIHAARTILKEESIKSFFKGG 762

Query: 75  SSPILMEAPKRATKFACNDEFQKLYKQAF 103
            + +L  +P+     A  + FQ L+   F
Sbjct: 763 PARVLRSSPQFGFTLAAFEMFQGLFPSHF 791

>Scas_718.5
          Length = 324

 Score =  109 bits (272), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 88/303 (29%), Positives = 144/303 (47%), Gaps = 39/303 (12%)

Query: 8   SLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGV 67
           S   L    AG   G+S+++V  P D  K RMQ   +        G +D ++K+V  EGV
Sbjct: 36  STRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKS------VGALDIIRKLVKNEGV 89

Query: 68  GRLYKGISSPILMEAPKRATKFACNDEFQKLYKQ---AFGVEKLSQPLSM----LAGASA 120
              YKG   PI+      + +F  N+  ++ +++   + G +     L +    + G + 
Sbjct: 90  WAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTG 149

Query: 121 GCVEAFVVVPFELVKIRLQDASSS-----YKGPVDVVRKIVAREGVLAMYNGLESTLWRH 175
           G V +F+  P E V+IRLQ  + +     +KGP+D +RK+V  + ++    GL   + R 
Sbjct: 150 GVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLM---RGLRPMMLRA 206

Query: 176 ALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-------PFDVVK 228
               G YF + ++A   L A   K     +++ S  + CS G +          P DVVK
Sbjct: 207 GHGLGCYF-LTYEA---LIANEIKKGKDRSEIASWKL-CSYGSLSGVVLWLAIYPLDVVK 261

Query: 229 SRIQ-NTAVIPGVVRKYNWSLPSLLT-IYREEGFRALYKGFVPKVLRLGPGGGILLVVFT 286
           S IQ +T   P    ++  S+ +++  +YRE+G  A +KGF P +LR  P  G   V F 
Sbjct: 262 SMIQTDTLRNP----RFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317

Query: 287 GVL 289
            V+
Sbjct: 318 LVM 320

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score =  109 bits (273), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 94/317 (29%), Positives = 136/317 (42%), Gaps = 57/317 (17%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQL----------------------------QVQGGAG 48
           AG  AG+ E L  +PLD +K RMQ+                                 A 
Sbjct: 17  AGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGDATAA 76

Query: 49  PHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY-KQAFGVEK 107
               G +   + I A EG   LYKG+ + ++   PK A +F+  + ++ L   +  GV  
Sbjct: 77  IKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADKQTGVVS 136

Query: 108 LSQPLSMLAGASAGCVEAFVVV-PFELVKIRLQD---------ASSSYKGPVDVVRKIVA 157
            S   + +AG  AG  EA +VV P E+VKIRLQ          A   Y   V     I+ 
Sbjct: 137 TSN--TFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIK 194

Query: 158 REGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHN-------KTQCITNDLISD 210
            EG+ A+Y G+  T  R A   G  F +  + R  L   H        +T CI   LIS 
Sbjct: 195 EEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCI--GLISG 252

Query: 211 SIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLL--TIYREEGFRALYKGFV 268
           +IG       + P D +K+R+Q          +  W   + +   + +EEGFRALYKG  
Sbjct: 253 AIGP----FSNAPLDTIKTRLQKDKST-SFKGESGWKRIAHIGTQLLKEEGFRALYKGIT 307

Query: 269 PKVLRLGPGGGILLVVF 285
           P+V+R+ PG  +   V+
Sbjct: 308 PRVMRVAPGQAVTFTVY 324

 Score = 77.4 bits (189), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 84/174 (48%), Gaps = 12/174 (6%)

Query: 15  FFAGAVAGVSE-ILVMYPLDVVKTRMQLQ----VQGGAGPHYTGVVDCLKKIVAGEGVGR 69
           F AG  AGV+E +LV+ P++VVK R+Q Q        A P YT  V     I+  EG+  
Sbjct: 141 FIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGISA 200

Query: 70  LYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVV 129
           LY+G+S     +A  +   F    + ++  ++  G E L    +   G  +G +  F   
Sbjct: 201 LYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCIGLISGAIGPFSNA 260

Query: 130 PFELVKIRLQ-DASSSYKGPVDVVR------KIVAREGVLAMYNGLESTLWRHA 176
           P + +K RLQ D S+S+KG     R      +++  EG  A+Y G+   + R A
Sbjct: 261 PLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVA 314

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 88/219 (40%), Gaps = 37/219 (16%)

Query: 112 LSMLAGASAGCVEAFVVVPFELVKIRLQ-------------------------------D 140
           ++++AG +AG  EA    P + +K+R+Q                               D
Sbjct: 13  VNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGD 72

Query: 141 ASSSYKGP--VDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHN 198
           A+++ K P  +   R I A+EG LA+Y GL + +          F      R LL     
Sbjct: 73  ATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADKQT 132

Query: 199 KTQCITNDLISD-SIGCSIGCMLSTPFDVVKSRIQNTAVIPG---VVRKYNWSLPSLLTI 254
                +N  I+    G +   ++  P +VVK R+Q   + P       KY  ++ +  TI
Sbjct: 133 GVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTI 192

Query: 255 YREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCR 293
            +EEG  ALY+G      R     G    V++ + +F +
Sbjct: 193 IKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQ 231

>Kwal_33.15446
          Length = 305

 Score =  107 bits (266), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 81/284 (28%), Positives = 133/284 (46%), Gaps = 19/284 (6%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74
           F +G  +G+++  V +P D +K R+Q     G    + G +DC+ + +  +G+   Y G 
Sbjct: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTG---RFKGPLDCVYQTMRQQGIRGFYLGF 78

Query: 75  SSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLS--MLAGASAGCVEAFVVVPFE 132
           + P++      +    C   ++ L K+     +   PLS  +L+G  AG   +F+  P E
Sbjct: 79  TPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVE 138

Query: 133 LVKIRLQ---DASSS-YKGPVDVVRKIVAREGVLAMYNGLESTL--WRHALWNGGYFGII 186
           L K +LQ   DA ++ Y+GP+DV++K+ A +G+  MY GL STL    H ++  G + ++
Sbjct: 139 LAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSYELL 198

Query: 187 FQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-PFDVVKSRIQNTAVIPGVVRKYN 245
            +      A  N +    N   +     S G   +  P DV+K  I       G +R + 
Sbjct: 199 TR---WFKANTNLSDTAIN-FWAGGFSASFGFWTTAYPSDVIKQVILCNDKYDGSLRSWR 254

Query: 246 WSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVL 289
               +   I+R  G R  +KGFVP  LR  P     L  F  VL
Sbjct: 255 ---NAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVL 295

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 79/172 (45%), Gaps = 7/172 (4%)

Query: 106 EKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSS--YKGPVDVVRKIVAREGVLA 163
           E  S+ +  ++G  +G  +  V  PF+ +K+RLQ +  +  +KGP+D V + + ++G+  
Sbjct: 14  EAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRG 73

Query: 164 MYNGLESTLWRHALWNGGYFGIIFQARALLPA---AHNKTQCITNDLISDSIGCSIGCML 220
            Y G    L    L +    G +   R LL      H +   ++  ++S  +       +
Sbjct: 74  FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFI 133

Query: 221 STPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVL 272
           + P ++ K+++Q          +Y   L  +  +Y  +G R +YKG V  ++
Sbjct: 134 AAPVELAKAKLQ--VQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 7   KSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEG 66
           + LP      +G +AG S   +  P+++ K ++Q+Q        Y G +D +KK+ A +G
Sbjct: 112 EKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQT-TRYRGPLDVIKKVYAADG 170

Query: 67  VGRLYKGISSPILME 81
           +  +YKG+ S ++  
Sbjct: 171 IRGMYKGLVSTLIFR 185

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score =  106 bits (264), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 83/286 (29%), Positives = 136/286 (47%), Gaps = 34/286 (11%)

Query: 16  FAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGIS 75
            +G   G++++LV  P D+ K RMQ              VD +  ++  EG+   YKG  
Sbjct: 28  LSGTAGGIAQVLVGQPFDITKVRMQTSAGSATA------VDVVTSLIKNEGILGFYKGTL 81

Query: 76  SPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSM----LAGASAGCVEAFVVVPF 131
           +P++      + +F  N+  ++ +++  G    S+PLS+    + G ++GC  AF+  P 
Sbjct: 82  APLVGVGACVSCQFGVNEAMKRRFRRMNG--DPSKPLSLKQYYVCGVASGCANAFLATPI 139

Query: 132 ELVKIRLQD-----ASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGII 186
           E V+IRLQ      A++ Y+G +D +RK++ ++G  A+  G  +TL R    +G  FGI 
Sbjct: 140 EHVRIRLQLQTKSLANAEYQGSLDCMRKLL-KQG--ALMRGFTATLMRTC--HG--FGIY 192

Query: 187 FQARALLPAAHNKTQCITNDLISDSIGCSIGCM-------LSTPFDVVKSRIQNTAVIPG 239
           F     L A  +K      D+    + C  G         ++ P DVVKS +Q+  ++  
Sbjct: 193 FSTYEALIANQHKKGIPRKDIAPWKV-CIFGAFSGACYWAMAYPIDVVKSIMQSDRLVSP 251

Query: 240 VVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
           V     W +    +IY   G RA  KGF+P +LR  P  G     F
Sbjct: 252 VHGTNVWQVAK--SIYTTRGKRAFIKGFMPAMLRSLPVNGATFATF 295

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 79/200 (39%), Gaps = 12/200 (6%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKK 60
           M+   +K L     +  G  +G +   +  P++ V+ R+QLQ +  A   Y G +DC++K
Sbjct: 108 MNGDPSKPLSLKQYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLANAEYQGSLDCMRK 167

Query: 61  IVAGEGVGRLYKGISSPILMEAPKRATKFACNDEF-QKLYKQAFGVEKLSQPLSMLAGAS 119
           ++     G L +G ++ ++         F+  +      +K+    + ++     + GA 
Sbjct: 168 LLKQ---GALMRGFTATLMRTCHGFGIYFSTYEALIANQHKKGIPRKDIAPWKVCIFGAF 224

Query: 120 AGCVEAFVVVPFELVKIRLQDASSSYKGPV------DVVRKIVAREGVLAMYNGLESTLW 173
           +G     +  P ++VK  +Q  S     PV       V + I    G  A   G    + 
Sbjct: 225 SGACYWAMAYPIDVVKSIMQ--SDRLVSPVHGTNVWQVAKSIYTTRGKRAFIKGFMPAML 282

Query: 174 RHALWNGGYFGIIFQARALL 193
           R    NG  F        LL
Sbjct: 283 RSLPVNGATFATFEMTMRLL 302

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 78/181 (43%), Gaps = 10/181 (5%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172
            +L+G + G  +  V  PF++ K+R+Q ++ S    VDVV  ++  EG+L  Y G  + L
Sbjct: 26  DILSGTAGGIAQVLVGQPFDITKVRMQTSAGSATA-VDVVTSLIKNEGILGFYKGTLAPL 84

Query: 173 WRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGC---MLSTPFDVVKS 229
                     FG+    +      +       +       G + GC    L+TP + V+ 
Sbjct: 85  VGVGACVSCQFGVNEAMKRRFRRMNGDPSKPLSLKQYYVCGVASGCANAFLATPIEHVRI 144

Query: 230 RIQ-NTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGV 288
           R+Q  T  +     +Y  SL  +  + ++    AL +GF   ++R   G GI    +  +
Sbjct: 145 RLQLQTKSLANA--EYQGSLDCMRKLLKQG---ALMRGFTATLMRTCHGFGIYFSTYEAL 199

Query: 289 L 289
           +
Sbjct: 200 I 200

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score =  106 bits (264), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 81/285 (28%), Positives = 125/285 (43%), Gaps = 21/285 (7%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74
           F +G  +G+++  V +P D +K R+Q          + G +DC+ K    +G+   Y G 
Sbjct: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDS---TRFKGPLDCVYKTFTQQGIRGFYLGF 120

Query: 75  SSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLS--MLAGASAGCVEAFVVVPFE 132
           + P++      +    C   ++ L K+     +   PLS  +++G  AG   +F+  P E
Sbjct: 121 TPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVE 180

Query: 133 LVKIRLQ---DASSS-YKGPVDVVRKIVAREGVLAMYNGLESTL---WRHALWNGGYFGI 185
           L K +LQ   DA ++ Y GPVDV++K+ +  GV  +Y GL STL        W G Y   
Sbjct: 181 LAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWGSY--- 237

Query: 186 IFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-PFDVVKSRIQNTAVIPGVVRKY 244
             +        H        +  S     S G   +  P DV+K  +       G  R  
Sbjct: 238 --ELLTRWFKEHTNMSDTAINFWSGGFSASFGFWTTAYPSDVIKQVVLCNDKYDGTFR-- 293

Query: 245 NWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVL 289
           +W L +   I+R  G+R  +KGFVP  LR  P     L  F  VL
Sbjct: 294 SWKLAA-KDIWRTRGYRGFFKGFVPSFLRSFPANAAALAAFEFVL 337

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 82/176 (46%), Gaps = 15/176 (8%)

Query: 106 EKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDA--SSSYKGPVDVVRKIVAREGVLA 163
           E  S+ +  ++G  +G  +  V  PF+ +K+RLQ +  S+ +KGP+D V K   ++G+  
Sbjct: 56  EAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRG 115

Query: 164 MYNGLESTLWRHALWNGGYFGIIFQARALLP--AAHNKTQ-----CITNDLISDSIGCSI 216
            Y G    L    L +    G +   R LL     +N+ +     CI + +++   G S+
Sbjct: 116 FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMA---GWSV 172

Query: 217 GCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVL 272
              ++ P ++ K+++Q          KY   +  +  +Y   G R LYKG    ++
Sbjct: 173 S-FIAAPVELAKAKLQ--VQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 5   DTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAG 64
           + + LP      +G +AG S   +  P+++ K ++Q+Q        YTG VD +KK+ + 
Sbjct: 152 NEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKT-TKYTGPVDVIKKVYSS 210

Query: 65  EGVGRLYKGISSPILMEA 82
            GV  LYKG++S ++   
Sbjct: 211 NGVRGLYKGLTSTLIFRT 228

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score =  103 bits (258), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 94/309 (30%), Positives = 146/309 (47%), Gaps = 47/309 (15%)

Query: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLY 71
           L   FAG + G++++LV  P D  K R+Q           T  ++ L+ +V  EGV   Y
Sbjct: 35  LKDIFAGTIGGIAQVLVGQPFDTTKVRLQTAT------TRTTTLEVLRNLVKNEGVFAFY 88

Query: 72  KGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEK----------LSQ----PLSM--L 115
           KG  +P+L      + +F  N+  ++ + Q +   K          LS+    PLS   +
Sbjct: 89  KGALTPLLGVGICVSVQFGVNEAMKRFF-QNYNASKNPNMSSQDVDLSRSNTLPLSQYYV 147

Query: 116 AGASAGCVEAFVVVPFELVKIRLQDASSS-----YKGPVDVVRKIVAREGVLAMYNGLES 170
            G + G V +F+  P E ++IRLQ  +S+     +KGP D ++K+ A+ G++    GL  
Sbjct: 148 CGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLM---RGLFP 204

Query: 171 TLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-------P 223
           T+ R     G YF ++++A   L A    T    N++    + C  G    T       P
Sbjct: 205 TMIRAGHGLGTYF-LVYEA---LVAREIGTGLTRNEIPPWKL-CLFGAFSGTMLWLTVYP 259

Query: 224 FDVVKSRIQNTAVIPGVVRKYNWSLPSLL-TIYREEGFRALYKGFVPKVLRLGPGGGILL 282
            DVVKS IQN  +      KY  S+  +  TIY +EG RA +KGF P ++R  P  G   
Sbjct: 260 LDVVKSIIQNDDLRK---PKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATF 316

Query: 283 VVFTGVLDF 291
           + F  V+ F
Sbjct: 317 LTFELVMRF 325

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 83/196 (42%), Gaps = 19/196 (9%)

Query: 1   MSSSD-----TKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVV 55
           MSS D     + +LP    +  G   GV    +  P++ ++ R+Q Q   G    + G  
Sbjct: 127 MSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPW 186

Query: 56  DCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLS-- 113
           DC+KK+ A  G   L +G+   ++       T F     ++ L  +  G       +   
Sbjct: 187 DCIKKLKAQGG---LMRGLFPTMIRAGHGLGTYFLV---YEALVAREIGTGLTRNEIPPW 240

Query: 114 --MLAGASAGCVEAFVVVPFELVKIRLQDAS---SSYKGPVDVVRK-IVAREGVLAMYNG 167
              L GA +G +    V P ++VK  +Q+       YK  +  V K I A+EG+ A + G
Sbjct: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300

Query: 168 LESTLWRHALWNGGYF 183
              T+ R A  NG  F
Sbjct: 301 FGPTMVRSAPVNGATF 316

 Score = 28.5 bits (62), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 7/73 (9%)

Query: 203 ITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRA 262
           +  D+ + +IG     ++  PFD  K R+Q              +L  L  + + EG  A
Sbjct: 34  VLKDIFAGTIGGIAQVLVGQPFDTTKVRLQTATTR-------TTTLEVLRNLVKNEGVFA 86

Query: 263 LYKGFVPKVLRLG 275
            YKG +  +L +G
Sbjct: 87  FYKGALTPLLGVG 99

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score =  103 bits (256), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 89/300 (29%), Positives = 135/300 (45%), Gaps = 21/300 (7%)

Query: 3   SSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIV 62
           S D+K +     F AGA+AG  E  + YP +  KTR+QL  +         V+  +    
Sbjct: 2   SKDSKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVL--IYNTA 59

Query: 63  AGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGC 122
             +GVG +Y G  + I+    K AT+F   D  + L K     E LS P  +LAG  AG 
Sbjct: 60  KTQGVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDKKTGE-LSGPRGVLAGLGAGL 118

Query: 123 VEAFV-VVPFELVKIRLQDASSSYKGPVDVVRKIVAR--------EGVLAMYNGLESTLW 173
           +E+ V V PFE +K  L D   S +       + +AR        EG   +Y G+     
Sbjct: 119 LESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSM 178

Query: 174 RHALWNGGYFGIIFQARALLP--AAHNKTQCITNDL--ISDSIGCSIGCMLSTPFDVVKS 229
           R A       G   + + L+       K + +T+ L  I  +    +    + P D VK+
Sbjct: 179 RQAANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVKT 238

Query: 230 RIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVL 289
           R+Q+         KY+ +L    TIY+EEG +  +KG  P++ RL   GGI+  ++  VL
Sbjct: 239 RMQSL-----TASKYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVL 293

>Scas_582.7
          Length = 329

 Score =  103 bits (257), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 77/275 (28%), Positives = 126/275 (45%), Gaps = 7/275 (2%)

Query: 10  PFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGR 69
           P  +Q  AGA AG+ E   M+P+D +KTR+Q     G     T ++  + KI   EG   
Sbjct: 35  PLSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLA 94

Query: 70  LYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSM-LAGASAGCVEAFVV 128
           L+KG+ S IL   P  A  FA   EF K +       +  QP+ + ++GA+A     F +
Sbjct: 95  LWKGVQSVILGAGPAHAVYFATY-EFTKAHLIPDSQRETHQPIKVAVSGATATVASDFFM 153

Query: 129 VPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQ 188
            PF+ +K R+Q +    +   +V +KI   EG+ A Y    +T+  +  +    F I   
Sbjct: 154 NPFDTIKQRMQISDLKKEKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNFMIYES 213

Query: 189 ARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQ---NTAVIPGVVRKYN 245
           A       H+    I    +   I  +I   ++TP D +K+ IQ   ++ V   V++K N
Sbjct: 214 ASKFFNPLHHYNPLI--HCLCGGISGAIAAAVTTPLDCIKTVIQIRGSSVVSLEVMKKAN 271

Query: 246 WSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGI 280
               +   I    G++  ++G  P++L   P   I
Sbjct: 272 TFKKATSAILMVYGWKGFWRGLQPRILANMPATAI 306

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 5/72 (6%)

Query: 223 PFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILL 282
           P D +K+RIQ+T    G  +     +  +  I   EG  AL+KG    +L  GP   +  
Sbjct: 56  PIDALKTRIQSTTT-KGTEQTSTSIIKQISKISTMEGSLALWKGVQSVILGAGPAHAVYF 114

Query: 283 VVFTGVLDFCRA 294
             +    +F +A
Sbjct: 115 ATY----EFTKA 122

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score =  102 bits (254), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 87/283 (30%), Positives = 130/283 (45%), Gaps = 31/283 (10%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQL-QVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
           F AG  +GV++  V +P D VK R+Q  QV  GAG  + G +DC+ K +  +G+  LY G
Sbjct: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72

Query: 74  ISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLS--MLAGASAGCVEAFVVVPF 131
            + P+       +        ++ L  +    E    PLS  +++G  AG   +F+  P 
Sbjct: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPV 132

Query: 132 ELVKIRLQ---DA-SSSYKGPVDVVRKI----VAREGVL----AMYNGLESTLW---RHA 176
           EL K +LQ   DA ++ Y GP+DVV+K+    +A  G+L    ++Y GL STL       
Sbjct: 133 ELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSNFV 192

Query: 177 LWNGGYFGII--FQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-PFDVVKSRIQN 233
            W G Y  I   FQ    L A          +  +  +  S G   S  P DVVK  +  
Sbjct: 193 FWWGSYELITQWFQKNTNLSAP-------AINFWAGGLSASFGFWTSAYPSDVVKQVVLC 245

Query: 234 TAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
                G  + +     ++  IYR+ G    +KGF+P  LR  P
Sbjct: 246 NDKYDGSFKSWR---TAVSDIYRQRGIHGFFKGFLPSFLRSFP 285

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 86/188 (45%), Gaps = 27/188 (14%)

Query: 106 EKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQD------ASSSYKGPVDVVRKIVARE 159
           E  S+ +  +AG  +G  +  V  PF+ VK+RLQ       A   +KGP+D V K +  +
Sbjct: 5   ETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQ 64

Query: 160 GVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPA----AHNK---TQCITNDLISDSI 212
           G+  +Y G    L+   + +    G +   R LL       H+K   + CI + +++   
Sbjct: 65  GIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMA--- 121

Query: 213 GCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYRE--------EGFRALY 264
           G ++   ++ P ++ K+++Q          KY   +  +  ++++         G R+LY
Sbjct: 122 GWTV-SFIAAPVELAKAKLQ--VQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLY 178

Query: 265 KGFVPKVL 272
           KG +  ++
Sbjct: 179 KGLISTLI 186

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score =  102 bits (253), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 78/293 (26%), Positives = 135/293 (46%), Gaps = 20/293 (6%)

Query: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQ----VQGGAGPHYTGVVDCLK 59
           SD K   FL  F  G V+         P++ VK  +Q Q     QG     Y G+VDC K
Sbjct: 2   SDNKQSNFLINFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFK 61

Query: 60  KIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY---KQAFGVEKLSQPLSMLA 116
           +  A EGV   ++G ++ ++   P +A  FA  D+ + ++   K+  G  K     ++ +
Sbjct: 62  RTAASEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFRKEVDGYAKWFAG-NLAS 120

Query: 117 GASAGCVEAFVVVPFELVKIRLQDASSS--------YKGPVDVVRKIVAREGVLAMYNGL 168
           G +AG +    V   +  + RL   S S        + G VDV +K +A +G+  +Y G 
Sbjct: 121 GGAAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGF 180

Query: 169 ESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVK 228
             ++    ++ G YFG+    + LL   + ++  I + L+  ++  +     S P D V+
Sbjct: 181 LPSVVGIVVYRGLYFGMYDSLKPLLLTGNLESSFIASFLLGWAV-TTGASTASYPLDTVR 239

Query: 229 SRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGIL 281
            R+  T+   G   KY+ +  +   I   EG ++L+KG    +LR   G G++
Sbjct: 240 RRMMMTS---GQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGVI 289

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 74/183 (40%), Gaps = 28/183 (15%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQ---VQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
           +G  AG   +L +Y LD  +TR+       + G    + G+VD  KK +A +G+  LY+G
Sbjct: 120 SGGAAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRG 179

Query: 74  ISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFEL 133
               ++     R   F   D  + L     G  + S   S L G +     +    P + 
Sbjct: 180 FLPSVVGIVVYRGLYFGMYDSLKPLLLT--GNLESSFIASFLLGWAVTTGASTASYPLDT 237

Query: 134 VKIRLQDASSS---YKGPVDVVRKIVAREGV--------------------LAMYNGLES 170
           V+ R+   S     Y G  D  RKIVA EGV                    +++Y+ L+ 
Sbjct: 238 VRRRMMMTSGQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGVISLYDQLQL 297

Query: 171 TLW 173
            L+
Sbjct: 298 VLF 300

>Kwal_56.23011
          Length = 303

 Score =  100 bits (250), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 89/290 (30%), Positives = 133/290 (45%), Gaps = 34/290 (11%)

Query: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLY 71
           L   F G V GV+++LV  P D+ K R+Q        P  T     +K +V  EG+   Y
Sbjct: 24  LKDVFCGTVGGVAQVLVGQPFDITKVRLQ------TSPVPTTAAQVIKSLVKNEGLLAFY 77

Query: 72  KGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSM----LAGASAGCVEAFV 127
           KG  +P+       + +F  N+  +K +++  G     QPL++      G  +G   AF+
Sbjct: 78  KGTLAPLAGVGACVSCQFGVNEALKKWFRKKDG--NFDQPLALRQYYACGFVSGTANAFL 135

Query: 128 VVPFELVKIRLQ--DASSS---YKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGY 182
             P E V+IRLQ   ASSS   Y G +D  RK++ ++G  A+  G  +T  R +  +G  
Sbjct: 136 ATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLL-KQG--ALMRGFTATTLRTS--HG-- 188

Query: 183 FGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCM-------LSTPFDVVKSRIQNTA 235
           FGI F     L A       +  ++ +  + C  G         ++ PFDVVKS +Q   
Sbjct: 189 FGIYFLTYETLIANQAHHGVLRENIPAWKV-CVYGAFSGAFFWAMTYPFDVVKSVMQADK 247

Query: 236 VIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
           +   V  +   ++     IYRE G RA  KGF P +LR  P  G     F
Sbjct: 248 LKNPVYGRNPLAVAK--AIYRERGPRAFTKGFTPTMLRSLPVNGATFAAF 295

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score =  100 bits (249), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/287 (27%), Positives = 133/287 (46%), Gaps = 30/287 (10%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
              AG   G++++LV  P D  K R+Q      + P  T  ++ ++K++A EG    YKG
Sbjct: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTS----STP--TTAMEVVRKLLANEGPRGFYKG 81

Query: 74  ISSPILMEAPKRATKFACNDEFQKLY--KQAFGVEKLSQPLSMLAGASAGCVEAFVVVPF 131
             +P++      + +F  N+  ++ +  + A     LS P     G + G V +F+  P 
Sbjct: 82  TLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPI 141

Query: 132 ELVKIRLQDASSS-----YKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGII 186
           E V+IRLQ  + S     +KGP++ ++K+   +   A+  GL  T+ R     G YF ++
Sbjct: 142 EHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK---ALLRGLTPTILREGHGCGTYF-LV 197

Query: 187 FQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-------PFDVVKSRIQNTAVIPG 239
           ++A  L+    NK + +    I     C  G +  T       P DV+KS +Q   +   
Sbjct: 198 YEA--LIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQK- 254

Query: 240 VVRKYNWSLPSLL-TIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
              K+  S+ S+  T+Y   G  A +KGF P +LR  P  G     F
Sbjct: 255 --PKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATF 299

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 90/201 (44%), Gaps = 20/201 (9%)

Query: 4   SDTKSLPFLYQFFA-GAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIV 62
           S T SLP   Q++A G   G+    +  P++ V+ R+Q Q   G    + G ++C+KK+ 
Sbjct: 115 SSTLSLP---QYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLR 171

Query: 63  AGEGVGRLYKGISSPILMEAPKRATKFACNDEF--QKLYKQAFGVEKLSQPLSMLA--GA 118
             +    L +G++  IL E     T F   +     ++ K+  G+E+   P   L   GA
Sbjct: 172 HNKA---LLRGLTPTILREGHGCGTYFLVYEALIANQMNKRR-GLERKDIPAWKLCIFGA 227

Query: 119 SAGCVEAFVVVPFELVKIRLQDASSSYKGP------VDVVRKIVAREGVLAMYNGLESTL 172
            +G     +V P +++K  +Q  + + + P        V + + A  G+ A + G   T+
Sbjct: 228 LSGTALWLMVYPLDVIKSVMQ--TDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTM 285

Query: 173 WRHALWNGGYFGIIFQARALL 193
            R A  NG  F     A  LL
Sbjct: 286 LRAAPANGATFATFELAMRLL 306

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 83/183 (45%), Gaps = 14/183 (7%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172
            +LAG + G  +  V  PF+  K+RLQ  SS+    ++VVRK++A EG    Y G  + L
Sbjct: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQ-TSSTPTTAMEVVRKLLANEGPRGFYKGTLTPL 86

Query: 173 WRHALWNGGYFGIIFQARALLPAAHNKTQCITNDL-ISDSIGCS-----IGCMLSTPFDV 226
                     FG+     A+    H++   +++ L +     C      +   L++P + 
Sbjct: 87  IGVGACVSLQFGV---NEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEH 143

Query: 227 VKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFT 286
           V+ R+Q T    G   ++   L  +  +      +AL +G  P +LR G G G   +V+ 
Sbjct: 144 VRIRLQ-TQTGSGTNAEFKGPLECIKKLRHN---KALLRGLTPTILREGHGCGTYFLVYE 199

Query: 287 GVL 289
            ++
Sbjct: 200 ALI 202

 Score = 28.9 bits (63), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 13/76 (17%)

Query: 203 ITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPG---VVRKYNWSLPSLLTIYREEG 259
           +  DL++ + G     ++  PFD  K R+Q ++       VVRK          +   EG
Sbjct: 25  VVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRK----------LLANEG 74

Query: 260 FRALYKGFVPKVLRLG 275
            R  YKG +  ++ +G
Sbjct: 75  PRGFYKGTLTPLIGVG 90

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 99.4 bits (246), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 78/288 (27%), Positives = 128/288 (44%), Gaps = 32/288 (11%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
              AG   GVS++L+  P D  K R+Q      + P  T  +D +KK+V  EG    YKG
Sbjct: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQTS----SVP--TTALDVVKKLVKNEGFRGFYKG 79

Query: 74  ISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSM----LAGASAGCVEAFVVV 129
             +P++      + +F  N+  ++ +    G    ++ L +    L G + G   +F+  
Sbjct: 80  TLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLAS 139

Query: 130 PFELVKIRLQD-----ASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFG 184
           P E V+IRLQ      A++ + GP+D ++K+ A     ++  GL  T+ R +   G YF 
Sbjct: 140 PIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVYF- 195

Query: 185 IIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-------PFDVVKSRIQNTAVI 237
                 AL+  A+   + ++   I     C  G    T       P DV+KS +Q  +++
Sbjct: 196 --LTYEALI--ANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLL 251

Query: 238 PGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
               ++    L    TIY   G  + +KGF P +LR  P  G     F
Sbjct: 252 Q--PKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATF 297

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 85/190 (44%), Gaps = 14/190 (7%)

Query: 2   SSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKI 61
           +S   ++L  L  +  G   G +   +  P++ V+ R+Q Q   GA   + G +DC+KK+
Sbjct: 111 NSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKL 170

Query: 62  VAGEGVGRLYKGISSPILMEAPKRATKFACNDEF--QKLYKQAFGVEKLSQPLSMLA--G 117
            A      L +G++  +L E+      F   +     +L+K   GV +   P   L   G
Sbjct: 171 TANN---SLMRGLTPTMLRESHGCGVYFLTYEALIANELHK---GVSRSEIPTWKLCLFG 224

Query: 118 ASAGCVEAFVVVPFELVKIRLQDAS----SSYKGPVDVVRKIVAREGVLAMYNGLESTLW 173
           A++G     ++ P +++K  +Q  S       K  + V + I +  G+ + + G   T+ 
Sbjct: 225 ATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTML 284

Query: 174 RHALWNGGYF 183
           R A  NG  F
Sbjct: 285 RAAPANGATF 294

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 79/183 (43%), Gaps = 12/183 (6%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172
            +LAG + G  +  +  PF+  K+RLQ  SS     +DVV+K+V  EG    Y G  + L
Sbjct: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQ-TSSVPTTALDVVKKLVKNEGFRGFYKGTLTPL 84

Query: 173 WRHALWNGGYFGI------IFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDV 226
                     FG+       F +R    +  N+T  +    +    G +    L++P + 
Sbjct: 85  VGVGACVSVQFGVNEAMKRFFHSRN-GNSGPNETLGLLQYYLCGFAGGTANSFLASPIEH 143

Query: 227 VKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFT 286
           V+ R+Q T    G   +++  L     I +     +L +G  P +LR   G G+  + + 
Sbjct: 144 VRIRLQ-TQTGTGAAAQFHGPLDC---IKKLTANNSLMRGLTPTMLRESHGCGVYFLTYE 199

Query: 287 GVL 289
            ++
Sbjct: 200 ALI 202

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 8/83 (9%)

Query: 193 LPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLL 252
           L  AH+ T+ +  DL++ + G     ++  PFD  K R+Q T+ +P        +L  + 
Sbjct: 14  LDGAHDSTR-VFKDLLAGTAGGVSQVLIGQPFDTTKVRLQ-TSSVP------TTALDVVK 65

Query: 253 TIYREEGFRALYKGFVPKVLRLG 275
            + + EGFR  YKG +  ++ +G
Sbjct: 66  KLVKNEGFRGFYKGTLTPLVGVG 88

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 99.4 bits (246), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 134/291 (46%), Gaps = 39/291 (13%)

Query: 16  FAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGIS 75
           FAG + GV+++LV  P D  K R+Q            GV++ ++ ++  EG    YKG+ 
Sbjct: 31  FAGTMGGVAQVLVGQPFDTTKVRLQ------TSKTKIGVIEVVQNLLRNEGALAFYKGML 84

Query: 76  SPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQ----PLSM----LAGASAGCVEAFV 127
           +P+L      + +F  N+  ++ +  A+  +++      PL +    L G + G V +F+
Sbjct: 85  TPLLGVGICVSVQFGVNESMKRFFA-AYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFL 143

Query: 128 VVPFELVKIRLQDASSS-----YKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGY 182
             P E V+IRLQ  +S      +KGP D ++K+   +   A+  GL  T+ R     G  
Sbjct: 144 AAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRA----GHG 196

Query: 183 FGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-------PFDVVKSRIQNTA 235
            G  F A   L     +     N + +  + CS G +  T       P DVVKS +Q  +
Sbjct: 197 LGTYFAAYEALVVKEFEKGTPRNQIPAWKL-CSFGALSGTILWLTVYPVDVVKSVLQTDS 255

Query: 236 VIPGVVRKY-NWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
           +      KY N  + +   +Y++ G  A +KGFVP ++R  P      V F
Sbjct: 256 I---ENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSF 303

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 75/186 (40%), Gaps = 20/186 (10%)

Query: 9   LPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVG 68
           LP    +  G   GV    +  P++ V+ R+Q Q   G    + G  DC+KK+   +   
Sbjct: 124 LPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKA-- 181

Query: 69  RLYKGISSPILMEAPKRATKFACND-----EFQKLYKQAFGVEKLSQPLSMLA--GASAG 121
            L +G+   ++       T FA  +     EF+K      G  +   P   L   GA +G
Sbjct: 182 -LMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEK------GTPRNQIPAWKLCSFGALSG 234

Query: 122 CVEAFVVVPFELVKIRLQDAS---SSYKGP-VDVVRKIVAREGVLAMYNGLESTLWRHAL 177
            +    V P ++VK  LQ  S     YK   +   R +  + G+ A + G   T+ R A 
Sbjct: 235 TILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAP 294

Query: 178 WNGGYF 183
            N   F
Sbjct: 295 ANAATF 300

 Score = 49.7 bits (117), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 80/186 (43%), Gaps = 15/186 (8%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172
            + AG   G  +  V  PF+  K+RLQ  S +  G ++VV+ ++  EG LA Y G+ + L
Sbjct: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQ-TSKTKIGVIEVVQNLLRNEGALAFYKGMLTPL 87

Query: 173 WRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSI---------GCSIGCMLSTP 223
               +     FG+    +    AA+N  +      +   +         G  +   L+ P
Sbjct: 88  LGVGICVSVQFGVNESMKRFF-AAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAP 146

Query: 224 FDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLV 283
            + V+ R+Q T    G  R++      +  + +    +AL +G +P ++R G G G    
Sbjct: 147 IEHVRIRLQ-TQTSQGNERQFKGPFDCIKKLAKA---KALMRGLLPTMIRAGHGLGTYFA 202

Query: 284 VFTGVL 289
            +  ++
Sbjct: 203 AYEALV 208

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 7/73 (9%)

Query: 203 ITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRA 262
           +  D+ + ++G     ++  PFD  K R+Q +    GV+         +  + R EG  A
Sbjct: 26  VVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIE-------VVQNLLRNEGALA 78

Query: 263 LYKGFVPKVLRLG 275
            YKG +  +L +G
Sbjct: 79  FYKGMLTPLLGVG 91

>Scas_667.22
          Length = 306

 Score = 99.0 bits (245), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 78/285 (27%), Positives = 136/285 (47%), Gaps = 27/285 (9%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
              AG   G++++LV  P D  K R+Q      + P  T  ++ ++K++  EG    YKG
Sbjct: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTS----STP--TTAMEVIRKLLKNEGPKGFYKG 81

Query: 74  ISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSM----LAGASAGCVEAFVVV 129
             +P++      + +F  N+  ++ +  +   +  SQ LS+    + G + G   +F+  
Sbjct: 82  TLTPLIGVGACVSLQFGVNEAMKRFF-HSRNPDSTSQILSLPQYYICGLTGGITNSFLAS 140

Query: 130 PFELVKIRLQDASSS-----YKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFG 184
           P E V+IRLQ  + S     +KGP+D +RK+ A+ G +    GL  T+ R     G YF 
Sbjct: 141 PIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFM---RGLTPTMLREGHGCGTYF- 196

Query: 185 IIFQARAL--LPAAHNKTQCITNDL-ISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVV 241
           ++++A     +     +T+     L +  ++  +   M+  P DV+KS +Q   +     
Sbjct: 197 LVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNL---KS 253

Query: 242 RKYNWSLPSLL-TIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
            KY  S+ S+  T+Y + G  A +KGF P +LR  P  G     F
Sbjct: 254 PKYGNSISSVAKTLYAKGGLGAFFKGFGPTMLRAAPANGATFATF 298

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 88/201 (43%), Gaps = 18/201 (8%)

Query: 2   SSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKI 61
           S+S   SLP  Y    G   G++   +  P++ V+ R+Q Q   G    + G +DC++K+
Sbjct: 114 STSQILSLPQYY--ICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKL 171

Query: 62  VAGEGVGRLYKGISSPILMEAPKRATKF-----ACNDEFQKLYKQAFGVEKLSQPLSMLA 116
            A    G   +G++  +L E     T F        +E  K +K+    E  +  L +  
Sbjct: 172 RA---QGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKR---TEVPAWKLCLF- 224

Query: 117 GASAGCVEAFVVVPFELVKIRLQD---ASSSYKGPVDVVRKIV-AREGVLAMYNGLESTL 172
           GA +G     +V P +++K  +Q     S  Y   +  V K + A+ G+ A + G   T+
Sbjct: 225 GALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYAKGGLGAFFKGFGPTM 284

Query: 173 WRHALWNGGYFGIIFQARALL 193
            R A  NG  F     A  LL
Sbjct: 285 LRAAPANGATFATFELAMRLL 305

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 81/184 (44%), Gaps = 15/184 (8%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172
            +LAG + G  +  V  PF+  K+RLQ +S+     ++V+RK++  EG    Y G  + L
Sbjct: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA-MEVIRKLLKNEGPKGFYKGTLTPL 86

Query: 173 WRHALWNGGYFGI------IFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDV 226
                     FG+       F +R   P + ++   +    I    G      L++P + 
Sbjct: 87  IGVGACVSLQFGVNEAMKRFFHSRN--PDSTSQILSLPQYYICGLTGGITNSFLASPIEH 144

Query: 227 VKSRIQ-NTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
           V+ R+Q  T   P V  ++   L  +  +  + GF    +G  P +LR G G G   +V+
Sbjct: 145 VRIRLQTQTGSGPNV--EFKGPLDCIRKLRAQGGF---MRGLTPTMLREGHGCGTYFLVY 199

Query: 286 TGVL 289
             ++
Sbjct: 200 EAMV 203

 Score = 28.9 bits (63), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 38/82 (46%), Gaps = 14/82 (17%)

Query: 197 HNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPG---VVRKYNWSLPSLLT 253
           H+  + I  DL++ + G     ++  PFD  K R+Q ++       V+RK          
Sbjct: 20  HDNARVI-KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRK---------- 68

Query: 254 IYREEGFRALYKGFVPKVLRLG 275
           + + EG +  YKG +  ++ +G
Sbjct: 69  LLKNEGPKGFYKGTLTPLIGVG 90

>Kwal_23.4354
          Length = 343

 Score = 99.8 bits (247), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 82/337 (24%), Positives = 144/337 (42%), Gaps = 55/337 (16%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQ------------------ 42
           M+    K +    +  +  V  +   L++ P+DVV+ R+Q Q                  
Sbjct: 1   MADEKQKGIGLKERLLSAVVGSLLTSLILTPMDVVRIRLQQQKMLPDCGCETDAGLTSRA 60

Query: 43  --------------VQGGAGP-HYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRAT 87
                         V+    P  Y    D   KI   EGV  L++G+S  +LM AP    
Sbjct: 61  SSKGVFWQDICFEDVRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMV 120

Query: 88  KFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSS--- 144
            F     ++ L  ++   +K      ++ GA A  + A  V P EL + RLQ    S   
Sbjct: 121 YFI---GYESLRDKSRLQDKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPK 177

Query: 145 ------YKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGI---------IFQA 189
                  K  +   R  +++ G  A++ GLE TLWR   ++  Y+G          I   
Sbjct: 178 STTAMMIKDLIKESRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSE 237

Query: 190 RALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLP 249
           ++++ ++++      N  +  S G ++  +L+ PFDV K+R+Q T +   + +K + ++ 
Sbjct: 238 KSIVNSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMF 297

Query: 250 SLLTIYRE-EGFRALYKGFVPKVLRLGPGGGILLVVF 285
             L   R+ EG  ALY G VP+V+++ P   I++  +
Sbjct: 298 KYLNQMRKSEGLAALYTGLVPRVIKIAPSCAIMISTY 334

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 46/101 (45%), Gaps = 2/101 (1%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGA--GPHYTGVVDCL 58
           ++SS++    F+  F  G+  G    ++ +P DV KTRMQ+              +   L
Sbjct: 241 VNSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYL 300

Query: 59  KKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY 99
            ++   EG+  LY G+   ++  AP  A   +  +  ++L+
Sbjct: 301 NQMRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEVCKRLF 341

>Scas_709.9
          Length = 365

 Score =  100 bits (248), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 81/286 (28%), Positives = 137/286 (47%), Gaps = 22/286 (7%)

Query: 16  FAGAVAGVSEILVMYPLDVVKTRMQLQ-VQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74
            +GA+AG    +++ PLDV KTR+Q Q +Q    P+Y GV+  +  IV  EGV  LYKG+
Sbjct: 69  LSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGL 128

Query: 75  SSPILMEAPKRATKFACNDEFQKLYKQAF-GVEKLSQPLSMLAGASAGCVEAFVVVPFEL 133
              IL   P     F+  +  + LY +     + +S   S +   +AG     +  P  +
Sbjct: 129 IPIILGYFPTWMIYFSVYEFAKDLYPRVLPNSDFISHSCSAI---TAGAASTVLTNPIWV 185

Query: 134 VKIRLQ------DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIF 187
           VK RL       ++ + Y+G +D  +KI+ +EGV  +Y GL  +++   L    +F +  
Sbjct: 186 VKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFG-LLHVAIHFPVYE 244

Query: 188 QARALL-----PAAHNKTQ---CITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPG 239
           + +  L        HN  +    +T  +I+ S    +  +L+ P +++++R+Q  +    
Sbjct: 245 KLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQLKSD-KL 303

Query: 240 VVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
           ++ K+   L  +   YR EG    Y GF   +LR  P   I LV F
Sbjct: 304 LISKHKL-LDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSF 348

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 84/176 (47%), Gaps = 13/176 (7%)

Query: 11  FLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQ-GGAGPHYTGVVDCLKKIVAGEGVGR 69
           F+    +   AG +  ++  P+ VVKTR+ LQ   G +  HY G +D  KKI+  EGV  
Sbjct: 162 FISHSCSAITAGAASTVLTNPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRT 221

Query: 70  LYKGISSPILMEAPKRATKFACNDEFQ-KLYKQAFGVEKLSQPLSM------LAGASAGC 122
           LY G+  P +      A  F   ++ + +L+         SQ  S+      +A +++  
Sbjct: 222 LYTGL-VPSMFGLLHVAIHFPVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKM 280

Query: 123 VEAFVVVPFELVKIRLQDASS----SYKGPVDVVRKIVAREGVLAMYNGLESTLWR 174
           + + +  P E+++ R+Q  S     S    +D++++    EG+L  Y+G  + L R
Sbjct: 281 LASILTYPHEILRTRMQLKSDKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLR 336

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 80/175 (45%), Gaps = 8/175 (4%)

Query: 107 KLSQP-LSMLAGASAGCVEAFVVVPFELVKIRLQD------ASSSYKGPVDVVRKIVARE 159
            LS P ++ L+GA AG +   +V P ++ K RLQ        +  Y+G +  +  IV  E
Sbjct: 60  HLSDPKITALSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDE 119

Query: 160 GVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCM 219
           GV  +Y GL   +  +      YF +   A+ L P     +  I++   + + G +   +
Sbjct: 120 GVRGLYKGLIPIILGYFPTWMIYFSVYEFAKDLYPRVLPNSDFISHSCSAITAGAA-STV 178

Query: 220 LSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRL 274
           L+ P  VVK+R+     +      Y  ++ +   I  +EG R LY G VP +  L
Sbjct: 179 LTNPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGL 233

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/95 (22%), Positives = 43/95 (45%), Gaps = 1/95 (1%)

Query: 3   SSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIV 62
           +S   SL       A + + +   ++ YP ++++TRMQL+        +  ++D +K+  
Sbjct: 260 NSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQLKSDKLLISKH-KLLDLIKRTY 318

Query: 63  AGEGVGRLYKGISSPILMEAPKRATKFACNDEFQK 97
             EG+   Y G ++ +L   P  A      + F+ 
Sbjct: 319 RYEGLLGFYSGFATNLLRTVPASAITLVSFEYFRN 353

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 97.1 bits (240), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 125/291 (42%), Gaps = 33/291 (11%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQ---LQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
           +GA++G    +++ P DV KTR+Q   LQ       HY G       I   EG   LYKG
Sbjct: 44  SGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYKG 103

Query: 74  ISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFEL 133
           +   +L   P     F+  D  +K     F         S  +  +AG +      P  +
Sbjct: 104 LQPTVLGYIPTLMIYFSVYDFCRKYSVDIFPHSPFLSNAS--SAITAGAISTVATNPIWV 161

Query: 134 VKIRLQ------DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIF 187
           VK RL         S+ YKG +D  RKI+ +EG  A+Y GL   L        G   +  
Sbjct: 162 VKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALL-------GMLNVAI 214

Query: 188 Q----ARALLPAAHNKTQCITNDLISDS---------IGCSIGCMLSTPFDVVKSRIQNT 234
           Q        +   ++++  ++ D+ S +         +   +   ++ P +++++R+Q  
Sbjct: 215 QFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQLK 274

Query: 235 AVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
           + +P  V+++   LP +   YR+EGF   Y GF   ++R  P   + LV F
Sbjct: 275 SDLPNTVQRH--LLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSF 323

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 78/176 (44%), Gaps = 12/176 (6%)

Query: 10  PFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQ-GGAGPHYTGVVDCLKKIVAGEGVG 68
           PFL    +   AG    +   P+ VVKTR+ LQ   G    HY G +D  +KI+  EG  
Sbjct: 137 PFLSNASSAITAGAISTVATNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAK 196

Query: 69  RLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLS------MLAGASAGC 122
            LY G+  P L+     A +F   +  +  +  +   +  +   S      +LA   +  
Sbjct: 197 ALYAGL-VPALLGMLNVAIQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKM 255

Query: 123 VEAFVVVPFELVKIRLQ---DASSSYKGPVDVVRKIVAR-EGVLAMYNGLESTLWR 174
           V + V  P E+++ R+Q   D  ++ +  +  + KI  R EG    Y+G  + L R
Sbjct: 256 VASTVTYPHEILRTRMQLKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVR 311

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 81/177 (45%), Gaps = 10/177 (5%)

Query: 105 VEKLSQP-LSMLAGASAGCVEAFVVVPFELVKIRLQ--------DASSSYKGPVDVVRKI 155
           ++K + P ++ ++GA +G + A +V PF++ K RLQ          S  YKG       I
Sbjct: 32  LKKNADPRVAAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATI 91

Query: 156 VAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCS 215
              EG   +Y GL+ T+  +      YF +    R         +  ++N   + + G +
Sbjct: 92  FKDEGAAGLYKGLQPTVLGYIPTLMIYFSVYDFCRKYSVDIFPHSPFLSNASSAITAG-A 150

Query: 216 IGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVL 272
           I  + + P  VVK+R+     I      Y  ++ +   I ++EG +ALY G VP +L
Sbjct: 151 ISTVATNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALL 207

 Score = 28.5 bits (62), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 43/103 (41%), Gaps = 6/103 (5%)

Query: 3   SSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQ--VQGGAGPHYTGVVDCLKK 60
           S+D  S  F     A  ++ +    V YP ++++TRMQL+  +      H   ++  +K 
Sbjct: 235 STDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQLKSDLPNTVQRH---LLPLIKI 291

Query: 61  IVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAF 103
               EG    Y G ++ ++   P        + E+ K Y   F
Sbjct: 292 TYRQEGFAGFYSGFATNLVRTVPAAVVTL-VSFEYSKKYLTTF 333

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 95.1 bits (235), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 123/285 (43%), Gaps = 21/285 (7%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74
           F AG  +GV++  V +P D +K R+Q          + G +DC+ K    +G+   Y G 
Sbjct: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNE---TRFKGPLDCVYKTFRNQGIRGFYLGF 83

Query: 75  SSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLS--MLAGASAGCVEAFVVVPFE 132
           + P++      +    C   ++ L  +         PLS  +++G  AG   +F+  P E
Sbjct: 84  TPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIE 143

Query: 133 LVKIRLQ----DASSSYKGPVDVVRKIVAREGVLAMYNGLESTL---WRHALWNGGYFGI 185
           L K +LQ      ++ YKGP+DV++KI + +G+  +Y GL STL        W G Y  +
Sbjct: 144 LAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYELL 203

Query: 186 IFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-PFDVVKSRIQNTAVIPGVVRKY 244
               R      + K      +  +     S G   +  P DVVK  +       G  + +
Sbjct: 204 TRWFR-----ENTKMSEAAINFWAGGFSASFGFWTTAYPSDVVKQVVLCNDKYDGSFKSW 258

Query: 245 NWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVL 289
                ++  IY+ +G    +KGFVP  LR  P     L  F  VL
Sbjct: 259 R---TAVKDIYQSKGINGFFKGFVPSFLRSFPANAAALAAFEFVL 300

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 78/172 (45%), Gaps = 7/172 (4%)

Query: 106 EKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSS--YKGPVDVVRKIVAREGVLA 163
           E  S+ +  +AG  +G  +  V  PF+ +K+RLQ + +   +KGP+D V K    +G+  
Sbjct: 19  ETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRG 78

Query: 164 MYNGLESTLWRHALWNGGYFGIIFQARALLPA---AHNKTQCITNDLISDSIGCSIGCML 220
            Y G    L    L +    G +   R L+      +++   ++  +IS  +       +
Sbjct: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFI 138

Query: 221 STPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVL 272
           + P ++ K+++Q          +Y   L  +  IY  +G R LYKG +  ++
Sbjct: 139 APPIELAKAKLQ--VQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 5   DTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAG 64
           + + LP      +G +AG S   +  P+++ K ++Q+Q        Y G +D +KKI + 
Sbjct: 115 NDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYD-KTTTRYKGPLDVIKKIYSA 173

Query: 65  EGVGRLYKGISSPILMEA 82
           +G+  LYKG+ S ++   
Sbjct: 174 QGIRGLYKGLISTLIFRT 191

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 95.1 bits (235), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 83/306 (27%), Positives = 139/306 (45%), Gaps = 28/306 (9%)

Query: 1   MSSSDTKS-LPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLK 59
           MSS  TKS +  L+ F AG++AG +E  + YP +  KTR+QL  +         V+  + 
Sbjct: 1   MSSKATKSDVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVL--IY 58

Query: 60  KIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGAS 119
           K    +G+G +Y G  + I+    K   +F   D  + + + +   E LS    ++AG  
Sbjct: 59  KTAKTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLRDSETGE-LSGTRGVIAGLG 117

Query: 120 AGCVEAFV-VVPFELVKIRL----QDASSSY----KGPVDVVRKIVAREGVLAMYNGLES 170
           AG +E+   V PFE +K  L    Q A+  Y    +G V     +V  +G   +Y G+  
Sbjct: 118 AGLLESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLP 177

Query: 171 TLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCML-------STP 223
              R A       G   + + L+    + T    +  +S  +   +G          + P
Sbjct: 178 VSMRQAANQAVRLGCYNKIKTLI---QDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMP 234

Query: 224 FDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLV 283
            D VK+R+Q+         KY+ ++    TI++EEG +  +KG  P++ RL   GGI+  
Sbjct: 235 LDTVKTRMQSLDST-----KYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFT 289

Query: 284 VFTGVL 289
           ++  VL
Sbjct: 290 IYEKVL 295

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 94.7 bits (234), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 133/285 (46%), Gaps = 34/285 (11%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           +G   G++++LV  P D+ K RMQ        P     ++ +K +V  EG+   YKG   
Sbjct: 29  SGTSGGIAQVLVGQPFDITKVRMQ---TSSGSPT---AIEVIKNLVKNEGLLAFYKGTLV 82

Query: 77  PILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSML----AGASAGCVEAFVVVPFE 132
           P++      + +F  N+  ++ + +  G +   Q LS+L     G  +G   AF+  P E
Sbjct: 83  PLIGVGACVSCQFGVNEAMKRYFLRVNGYK--DQHLSLLQYYTCGFVSGSANAFLATPIE 140

Query: 133 LVKIRLQ-----DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIF 187
            V+IRLQ      A + Y+G +D ++K++ ++   A+  G  +TL R +  +G  FG+ F
Sbjct: 141 HVRIRLQLQTKALAKAEYRGSLDCMKKLLKQK---ALMRGFTATLMRTS--HG--FGVYF 193

Query: 188 QARALLPAAHNKTQCITNDLISDSIGCSIGCM-------LSTPFDVVKSRIQNTAVIPGV 240
                L    NK   +  D+    + C  G         ++ PFDVVKS +Q   ++  V
Sbjct: 194 LTYEALIMNQNKNGVLRKDIPPWKV-CVFGAFSGAFFWAMTYPFDVVKSIMQADRLVSPV 252

Query: 241 VRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
             K  + +    +I+   G+ A  KGFVP +LR  P  G     F
Sbjct: 253 HGKNVFQVAK--SIHATRGWGAFVKGFVPTMLRSLPVNGATFATF 295

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 82/181 (45%), Gaps = 10/181 (5%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172
            +++G S G  +  V  PF++ K+R+Q +S S    ++V++ +V  EG+LA Y G    L
Sbjct: 26  DIISGTSGGIAQVLVGQPFDITKVRMQTSSGS-PTAIEVIKNLVKNEGLLAFYKGTLVPL 84

Query: 173 WRHALWNGGYFGII-FQARALLPAAHNKTQCIT--NDLISDSIGCSIGCMLSTPFDVVKS 229
                     FG+     R  L     K Q ++         +  S    L+TP + V+ 
Sbjct: 85  IGVGACVSCQFGVNEAMKRYFLRVNGYKDQHLSLLQYYTCGFVSGSANAFLATPIEHVRI 144

Query: 230 RIQ-NTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGV 288
           R+Q  T  +     +Y  SL  +  + ++   +AL +GF   ++R   G G+  + +  +
Sbjct: 145 RLQLQTKALAKA--EYRGSLDCMKKLLKQ---KALMRGFTATLMRTSHGFGVYFLTYEAL 199

Query: 289 L 289
           +
Sbjct: 200 I 200

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 83/202 (41%), Gaps = 11/202 (5%)

Query: 7   KSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEG 66
           + L  L  +  G V+G +   +  P++ V+ R+QLQ +  A   Y G +DC+KK++  + 
Sbjct: 114 QHLSLLQYYTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQKA 173

Query: 67  VGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLA--GASAGCVE 124
           + R +    +  LM        +    E   + +   GV +   P   +   GA +G   
Sbjct: 174 LMRGF----TATLMRTSHGFGVYFLTYEALIMNQNKNGVLRKDIPPWKVCVFGAFSGAFF 229

Query: 125 AFVVVPFELVKIRLQD----ASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNG 180
             +  PF++VK  +Q     +    K    V + I A  G  A   G   T+ R    NG
Sbjct: 230 WAMTYPFDVVKSIMQADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNG 289

Query: 181 GYFGIIFQARALLPAAHNKTQC 202
             F   F+    L  + +K  C
Sbjct: 290 ATFA-TFEVTMRLLESLDKVAC 310

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 95.1 bits (235), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 82/293 (27%), Positives = 135/293 (46%), Gaps = 27/293 (9%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQ---LQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
           +GA+AG+   +V+ PLDV KTR+Q   LQ +     +Y G +  +  IV  EGV  LYKG
Sbjct: 74  SGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYKG 133

Query: 74  ISSPILMEAPKRATKFA----CNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVV 129
           +   I+   P     F+    C D    L   +     +S   S +   +AG V   V  
Sbjct: 134 LVPIIMGYFPTWMIYFSVYEFCKD---NLRTNSSNWSFVSHSFSAI---TAGAVSTVVTN 187

Query: 130 PFELVKIRLQ------DASSSYKGPVDVVRKIVAREGVLAMYNGLEST---LWRHALWNG 180
           P  +VK RL         ++ Y+G  D  +KI+ +EGV A+Y GL  +   L   A+   
Sbjct: 188 PIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLLGLLHVAIHFP 247

Query: 181 GY--FGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIP 238
            Y    + F+      +++     +   +++ S+   +  +LS P +++++R+Q  + +P
Sbjct: 248 VYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQLKSDLP 307

Query: 239 GVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDF 291
              R+    +P +   Y +EG    Y GF   + R  P   I LV F  V +F
Sbjct: 308 SHQRRL---IPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYVRNF 357

 Score = 71.6 bits (174), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 87/180 (48%), Gaps = 10/180 (5%)

Query: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGP-HYTGVVDCLKKIV 62
           +++ +  F+   F+   AG    +V  P+ VVKTR+ LQ   G+   HY G  D  KKI+
Sbjct: 161 TNSSNWSFVSHSFSAITAGAVSTVVTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKII 220

Query: 63  AGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYK-----QAFGVEKLSQPLSMLAG 117
             EGV  LY G+  P L+     A  F   +  +  +K     ++    K++    +LA 
Sbjct: 221 NQEGVKALYAGL-VPSLLGLLHVAIHFPVYERLKVSFKCYQRDESSNESKINLKRLILAS 279

Query: 118 ASAGCVEAFVVVPFELVKIRLQ---DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWR 174
           + +  V + +  P E+++ RLQ   D  S  +  + +++    +EG+   Y+G  + L+R
Sbjct: 280 SVSKMVASVLSYPHEILRTRLQLKSDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFR 339

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 82/189 (43%), Gaps = 9/189 (4%)

Query: 94  EFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQ--------DASSSY 145
           E  ++    FG       ++ ++GA AG +   VV P ++ K RLQ          +  Y
Sbjct: 52  EVPRVRNTLFGFTLNDNRINAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYY 111

Query: 146 KGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITN 205
           +G +  +  IV  EGV  +Y GL   +  +      YF +    +  L    +    +++
Sbjct: 112 RGSIGTMTTIVRDEGVRGLYKGLVPIIMGYFPTWMIYFSVYEFCKDNLRTNSSNWSFVSH 171

Query: 206 DLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYK 265
              + + G ++  +++ P  VVK+R+     I      Y  +  +   I  +EG +ALY 
Sbjct: 172 SFSAITAG-AVSTVVTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYA 230

Query: 266 GFVPKVLRL 274
           G VP +L L
Sbjct: 231 GLVPSLLGL 239

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 48/95 (50%), Gaps = 10/95 (10%)

Query: 205 NDLISDSIGCSIGCMLS----TPFDVVKSRIQNTAVIPGVVRK--YNWSLPSLLTIYREE 258
           ND   ++I  ++  +LS     P DV K+R+Q   +         Y  S+ ++ TI R+E
Sbjct: 66  NDNRINAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDE 125

Query: 259 GFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCR 293
           G R LYKG VP ++   P      +++  V +FC+
Sbjct: 126 GVRGLYKGLVPIIMGYFPT----WMIYFSVYEFCK 156

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 37/84 (44%), Gaps = 2/84 (2%)

Query: 3   SSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIV 62
           SS+   +       A +V+ +   ++ YP ++++TR+QL  +     H   ++  +K   
Sbjct: 264 SSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQL--KSDLPSHQRRLIPLIKITY 321

Query: 63  AGEGVGRLYKGISSPILMEAPKRA 86
             EG+   Y G  + +    P  A
Sbjct: 322 IQEGIFGFYSGFGTNLFRTLPASA 345

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 93.6 bits (231), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 81/302 (26%), Positives = 136/302 (45%), Gaps = 27/302 (8%)

Query: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVA 63
           S +K +     F AG +AG  E  V YP +  KTR+QL  +         V+  +     
Sbjct: 2   SQSKQVDPSKSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVL--IYNTAK 59

Query: 64  GEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCV 123
            +G+G +Y G  + I+    K   +F   D  + L +     E LS P  ++AG  AG +
Sbjct: 60  TQGIGSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLLRDPKTGE-LSGPRGVIAGLGAGLL 118

Query: 124 EAFV-VVPFELVKIRL----QDASSSY----KGPVDVVRKIVAREGVLAMYNGLESTLWR 174
           E+ V V PFE +K  L    Q A+  Y    KG +     +V ++G+  +Y G+     R
Sbjct: 119 ESVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMR 178

Query: 175 HALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCM-------LSTPFDVV 227
            A       G   + + ++    + T    +  +S  +   +G          + P D V
Sbjct: 179 QAANQAVRLGCYNKIKVMV---QDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTV 235

Query: 228 KSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTG 287
           K+R+Q+        ++Y+ ++    TI++EEG +A +KG  P++ RL   GGI+  V+  
Sbjct: 236 KTRMQSLDS-----KRYSSTINCFTTIFKEEGLKAFWKGATPRLGRLFLSGGIVFTVYEK 290

Query: 288 VL 289
           VL
Sbjct: 291 VL 292

>Scas_489.4
          Length = 297

 Score = 93.6 bits (231), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 79/302 (26%), Positives = 135/302 (44%), Gaps = 21/302 (6%)

Query: 3   SSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIV 62
           S + K +  L+ F AGA+AG  E  + YP +  KTR+QL  +         V+  +    
Sbjct: 2   SQEKKPVDPLHSFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVL--IYNTA 59

Query: 63  AGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGC 122
             +G G +Y G  + I+    K   +F   D  + + +     E LS P  ++AG  AG 
Sbjct: 60  KTQGTGAIYVGCPAFIVGNTAKAGIRFLGFDTIKNMLRDPVTGE-LSGPRGVVAGLGAGL 118

Query: 123 VEAFV-VVPFELVKIRLQDASSSYK--------GPVDVVRKIVAREGVLAMYNGLESTLW 173
           +E+ V V PFE +K  L D   + K        G +     +V  +G++ +Y G+     
Sbjct: 119 LESVVAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSM 178

Query: 174 RHALWNGGYFGIIFQARALLPAAHN--KTQCITNDL--ISDSIGCSIGCMLSTPFDVVKS 229
           R A       G   + + ++    N  K + +++ L  I  +    +    + P D VK+
Sbjct: 179 RQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKT 238

Query: 230 RIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVL 289
           R+Q+         KY  ++     I++EEG +  +KG  P++ RL   GGI+  ++  VL
Sbjct: 239 RMQSLDAT-----KYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVL 293

Query: 290 DF 291
            F
Sbjct: 294 VF 295

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 93.2 bits (230), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 123/278 (44%), Gaps = 22/278 (7%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQ--VQGGAGPHYTGVVDCLKKIVAGEGVGRLYK 72
           F AG +A    + V  P D VKTRMQLQ  +   A   YT  +     I   EG+  L K
Sbjct: 24  FVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGIAGLQK 83

Query: 73  GISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQP-----LSMLAGASAGCVEAFV 127
           G++S  L +     ++    +  + +    F     S       +++ AGA++G V AF+
Sbjct: 84  GLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGATSGVVGAFI 143

Query: 128 VVPFELVKIRLQDASSS--------YKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWN 179
             P  LVK R+Q  S++        Y    + +  I   EG+  ++ G+++ + R  + +
Sbjct: 144 GSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGVDAAMLRTGIGS 203

Query: 180 GGYFGIIFQARALLPAAHNKTQCITNDLISDSI-GCSIGCMLSTPFDVVKSRIQNTAVIP 238
                I    +  L             L+S +I G  +G  ++ P+DVV +R+ N     
Sbjct: 204 AVQLPIYNICKNFLLKHDLMNDGTGLHLLSSTIAGFGVGVAMN-PWDVVLTRVYNQKG-- 260

Query: 239 GVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
                Y+  +   +   R EG  ALYKGF  ++LR+GP
Sbjct: 261 ---NLYSGPIDCFIKTVRNEGLSALYKGFGAQILRIGP 295

 Score = 79.0 bits (193), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 93/211 (44%), Gaps = 15/211 (7%)

Query: 96  QKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQ-------DASSSYKGP 148
           ++ + Q     K+S+  S +AG  A C+   V  PF+ VK R+Q       +A+  Y  P
Sbjct: 6   EEKHNQKTAAHKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNP 65

Query: 149 VDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLP------AAHNKTQC 202
           +     I   EG+  +  GL S        NG   G     R +L          +K Q 
Sbjct: 66  IQAFGVIFKNEGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQH 125

Query: 203 ITNDLISDSIGCSIGCMLSTPFDVVKSRIQN--TAVIPGVVRKYNWSLPSLLTIYREEGF 260
           I  ++ + +    +G  + +P  +VK+R+Q+   A+  G    Y  +   L TI+R EG 
Sbjct: 126 IGINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGI 185

Query: 261 RALYKGFVPKVLRLGPGGGILLVVFTGVLDF 291
           + L++G    +LR G G  + L ++    +F
Sbjct: 186 KGLFRGVDAAMLRTGIGSAVQLPIYNICKNF 216

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 34/71 (47%), Gaps = 4/71 (5%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
              +  +AG    + M P DVV TR+  Q     G  Y+G +DC  K V  EG+  LYKG
Sbjct: 230 HLLSSTIAGFGVGVAMNPWDVVLTRVYNQ----KGNLYSGPIDCFIKTVRNEGLSALYKG 285

Query: 74  ISSPILMEAPK 84
             + IL   P 
Sbjct: 286 FGAQILRIGPH 296

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 92.4 bits (228), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 130/296 (43%), Gaps = 25/296 (8%)

Query: 3   SSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQ----VQGGAGPHYTGVVDCL 58
           S+D K   F   F  G V+         P++ VK  +Q Q     QG     YTG+V+C 
Sbjct: 2   STDKKQSNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECF 61

Query: 59  KKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAG- 117
           K+  A EGV   ++G ++ ++   P +A  FA  D+ + +    FG +K        AG 
Sbjct: 62  KRTAADEGVASFWRGNTANVIRYFPTQALNFAFKDKIKAM----FGFKKEEGYAKWFAGN 117

Query: 118 ----ASAGCVEAFVVVPFELVKIRLQDASSS--------YKGPVDVVRKIVAREGVLAMY 165
                 AG +    V   +  + RL   S S        + G VDV +K +A +GV  +Y
Sbjct: 118 LASGGLAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLY 177

Query: 166 NGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFD 225
            G   ++    ++ G YFG+    + LL     +   + + L+  ++  +     S P D
Sbjct: 178 RGFLPSVVGIVVYRGLYFGLYDSLKPLLLTGSLENSFLASFLLGWAV-TTGASTASYPLD 236

Query: 226 VVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGIL 281
            V+ R+  T+   G   KY+ +  +   I   EG ++L+KG    +LR   G G++
Sbjct: 237 TVRRRMMMTS---GQAVKYDGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVI 289

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 68/171 (39%), Gaps = 28/171 (16%)

Query: 29  MYPLDVVKTRMQLQ---VQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKR 85
           +Y LD  +TR+       + G    + G+VD  KK +A +GV  LY+G    ++     R
Sbjct: 132 VYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIVVYR 191

Query: 86  ATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSS- 144
              F   D  + L     G  + S   S L G +     +    P + V+ R+   S   
Sbjct: 192 GLYFGLYDSLKPLLLT--GSLENSFLASFLLGWAVTTGASTASYPLDTVRRRMMMTSGQA 249

Query: 145 --YKGPVDVVRKIVAREG--------------------VLAMYNGLESTLW 173
             Y G  D  RKIVA EG                    V++MY+ L+  L+
Sbjct: 250 VKYDGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVISMYDQLQVILF 300

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 92.4 bits (228), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 74/275 (26%), Positives = 127/275 (46%), Gaps = 12/275 (4%)

Query: 10  PFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGR 69
           P  +Q  AGA AG+ E  V++P+D +KTR+Q    G A     G++  + KI   EG   
Sbjct: 15  PLHHQLLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAAT---QGLIKQISKITTAEGSLA 71

Query: 70  LYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPL-SMLAGASAGCVEAFVV 128
           L+KG+ S IL   P  A  FA   EF K            QP+ + ++G +A  V   ++
Sbjct: 72  LWKGVQSVILGAGPAHAVYFATY-EFSKSKLIDPQDMHTHQPIKTAISGMAATTVADALM 130

Query: 129 VPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQ 188
            PF+++K R+Q   ++ +    V + I  +EG  A Y    +TL  +  +    F I   
Sbjct: 131 NPFDVIKQRMQ--LNTRESVWHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYES 188

Query: 189 ARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQ---NTAVIPGVVRKYN 245
           A   +  ++     I    IS  +  +    ++TP D +K+ +Q   +  V   ++++ N
Sbjct: 189 ATKFMNPSNEYNPFI--HCISGGLSGATCAAITTPLDCIKTVLQVRGSETVSNEIMKQAN 246

Query: 246 WSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGI 280
               +   IY+  G++   +G  P+V+   P   I
Sbjct: 247 TFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAI 281

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 10/66 (15%)

Query: 223 PFDVVKSRIQNT---AVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGG 279
           P D +K+RIQ++   A   G++++       +  I   EG  AL+KG    +L  GP   
Sbjct: 36  PVDAIKTRIQSSSSGAATQGLIKQ-------ISKITTAEGSLALWKGVQSVILGAGPAHA 88

Query: 280 ILLVVF 285
           +    +
Sbjct: 89  VYFATY 94

>Kwal_26.7967
          Length = 297

 Score = 92.0 bits (227), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/302 (25%), Positives = 134/302 (44%), Gaps = 27/302 (8%)

Query: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVA 63
           S  K +  L+ F AG++AG  E  + YP +  KTR+QL  +          +  + +   
Sbjct: 2   SQKKQVDPLHSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASR--NPLTLIYRTAK 59

Query: 64  GEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCV 123
            +G+G +Y G  + I+    K   +F   D  + + +     E LS P  ++AG  AG +
Sbjct: 60  VQGLGAVYVGCPAFIVGNTAKAGVRFLGFDAIKNILRDPTTGE-LSGPRGIVAGLGAGLL 118

Query: 124 EAFV-VVPFELVKIRL----QDASSSY----KGPVDVVRKIVAREGVLAMYNGLESTLWR 174
           E+ V V PFE +K  L    Q AS  Y    +G +     +V  +G   +Y G+     R
Sbjct: 119 ESVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMR 178

Query: 175 HALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCM-------LSTPFDVV 227
            A       G   + + ++    + T    +  +S  +   +G          + P D V
Sbjct: 179 QAANQAVRLGCYNKIKTMI---QDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTV 235

Query: 228 KSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTG 287
           K+R+Q+         KY+ ++    T++REEG +  +KG  P++ RL   GGI+  ++  
Sbjct: 236 KTRMQSLDS-----SKYSSTINCFATVFREEGLKTFWKGATPRLGRLILSGGIVFTIYEK 290

Query: 288 VL 289
           VL
Sbjct: 291 VL 292

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 4/72 (5%)

Query: 2   SSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKI 61
           +S+  K L     F  GA +G+  +    P+D VKTRMQ          Y+  ++C   +
Sbjct: 202 NSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQSL----DSSKYSSTINCFATV 257

Query: 62  VAGEGVGRLYKG 73
              EG+   +KG
Sbjct: 258 FREEGLKTFWKG 269

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 93.2 bits (230), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/282 (27%), Positives = 132/282 (46%), Gaps = 32/282 (11%)

Query: 29  MYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGR-LYKGISSPILMEAPKRAT 87
           M+ LD VKTR Q      +   Y  ++   + I+  EG+ + LY G S  +L   P  A 
Sbjct: 73  MHSLDTVKTRQQ---GAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAAI 129

Query: 88  KFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQ-------- 139
            FA  +  ++     +G+ +    L+  AG     + +FV VP E++K RLQ        
Sbjct: 130 FFATYEYTKRKMIGEWGINETFSHLT--AGFLGDFISSFVYVPSEVLKTRLQLQGRYNNP 187

Query: 140 --DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAH 197
              +  +YK   D V  IV REG   ++ G ++TL R   ++G  F    + R L  A  
Sbjct: 188 FFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFAVE 247

Query: 198 NKT----QCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPS--- 250
           NKT      ++N++I+ +    +  +++TP DVVK+RIQ    +P +    + +L     
Sbjct: 248 NKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQ--LPDIPENSSQNLKQQTL 305

Query: 251 -------LLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
                  ++T+Y+ EG   L+ G  P+ +       I+L+++
Sbjct: 306 TNSITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLY 347

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 92.8 bits (229), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/282 (27%), Positives = 129/282 (45%), Gaps = 19/282 (6%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQ-VQGG-AGPHYTGVVDCLKKIVAGEGVGRLYKGI 74
           +GA AG    + + PLDV KTR+Q Q +Q     P+Y G++  L  IV  EG   LYKG+
Sbjct: 83  SGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKGL 142

Query: 75  SSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELV 134
              +L   P     F+  +  +K +   F   +        A  +AG     +  P  +V
Sbjct: 143 VPIVLGYFPTWMIYFSVYEFSKKFFHGIF--PQFDFVAQSCAAITAGAASTTLTNPIWVV 200

Query: 135 KIRLQ------DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQ 188
           K RL       +  + YKG  D  RK+  +EG  A+Y GL  +L    L++      I++
Sbjct: 201 KTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLL--GLFHVAIHFPIYE 258

Query: 189 ---ARALLPAAHNKTQCITND--LISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRK 243
               R    +  N T  I     +++ S+   I   ++ P +++++R+Q  + IP  +++
Sbjct: 259 DLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDIPDSIQR 318

Query: 244 YNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
             +  P +   Y +EG +  Y GF   ++R  P   I LV F
Sbjct: 319 RLF--PLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSF 358

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 78/172 (45%), Gaps = 9/172 (5%)

Query: 11  FLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGP-HYTGVVDCLKKIVAGEGVGR 69
           F+ Q  A   AG +   +  P+ VVKTR+ LQ   G  P HY G  D  +K+   EG   
Sbjct: 176 FVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKA 235

Query: 70  LYKGISSPILMEAPKRATKFACNDEFQ---KLYKQAFGVEKLSQPLSMLAGASAGCVEAF 126
           LY G+  P L+     A  F   ++ +     Y +      ++    ++A + +  + + 
Sbjct: 236 LYAGL-VPSLLGLFHVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASA 294

Query: 127 VVVPFELVKIRLQDAS----SSYKGPVDVVRKIVAREGVLAMYNGLESTLWR 174
           V  P E+++ R+Q  S    S  +    +++   A+EG+   Y+G  + L R
Sbjct: 295 VTYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVR 346

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 75/173 (43%), Gaps = 8/173 (4%)

Query: 109 SQPLSMLAGASAGCVEAFVVVPFELVKIRLQD-------ASSSYKGPVDVVRKIVAREGV 161
           S  ++ L+GA AG +    V P ++ K RLQ         +  Y+G +  +  IV  EG 
Sbjct: 76  STQITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGP 135

Query: 162 LAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLS 221
             +Y GL   +  +      YF +   ++        +   +     + + G +    L+
Sbjct: 136 RGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQSCAAITAGAA-STTLT 194

Query: 222 TPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRL 274
            P  VVK+R+   + +      Y  +  +   ++ +EGF+ALY G VP +L L
Sbjct: 195 NPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGL 247

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 13/100 (13%)

Query: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQ------VQGGAGPHYTGVVDC 57
           ++T S+       A +V+ +    V YP ++++TRMQL+      +Q    P        
Sbjct: 271 NNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDIPDSIQRRLFP-------L 323

Query: 58  LKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQK 97
           +K   A EG+   Y G ++ ++   P  A      + F+ 
Sbjct: 324 IKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEYFRN 363

>Kwal_27.12599
          Length = 304

 Score = 91.7 bits (226), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 79/294 (26%), Positives = 131/294 (44%), Gaps = 30/294 (10%)

Query: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLY 71
           L    AG   G++++LV  P D  K R+Q           T  V+ +KK+V  EG+   Y
Sbjct: 25  LKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTP------TTAVEVVKKLVKNEGLRGFY 78

Query: 72  KGISSPILMEAPKRATKFACNDEFQKLYK--QAFGVEKLSQPLSMLAGASAGCVEAFVVV 129
           KG  +P++      + +F  N+  ++ ++   A   + L+ P   + G   G   +F+  
Sbjct: 79  KGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLAS 138

Query: 130 PFELVKIRLQDASSS-----YKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFG 184
           P E V+IRLQ  ++S     +KGP+D + K+ A     A+  GL  T+ R A     YF 
Sbjct: 139 PIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANG---ALMRGLSPTILREAQGCATYF- 194

Query: 185 IIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-------PFDVVKSRIQNTAVI 237
           + ++A      A+   + I    +     C  G +          P DV+KS +Q T  +
Sbjct: 195 LTYEAL----VANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQ-TDNL 249

Query: 238 PGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDF 291
              VR  N    + L +  + G+++ +KGF P +LR  P  G     F   + F
Sbjct: 250 KNPVRGKNIIQVARL-VNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAMRF 302

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 87/193 (45%), Gaps = 19/193 (9%)

Query: 2   SSSDT-KSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKK 60
           SS+D  K+L     +  G V GV+   +  P++ V+ R+Q Q   G    + G +DC+ K
Sbjct: 109 SSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINK 168

Query: 61  IVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAF--GVEKLSQPLSMLA-- 116
           + A    G L +G+S  IL EA   AT F     ++ L       G+ +   P   L   
Sbjct: 169 LRAN---GALMRGLSPTILREAQGCATYFLT---YEALVANQIGKGIARSDVPAWKLCLF 222

Query: 117 GASAGCVEAFVVVPFELVKIRLQDASSSYKGPV------DVVRKIVAREGVLAMYNGLES 170
           GA +G      V P +++K  +Q  + + K PV       V R + A+ G  + + G   
Sbjct: 223 GAVSGVTLWLTVYPLDVIKSLMQ--TDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGP 280

Query: 171 TLWRHALWNGGYF 183
           T+ R A  NG  F
Sbjct: 281 TMLRAAPANGATF 293

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 15/77 (19%)

Query: 203 ITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPG----VVRKYNWSLPSLLTIYREE 258
           +  DL++ + G     ++  PFD  K R+Q T+  P     VV+K          + + E
Sbjct: 24  VLKDLLAGTAGGMAQVLVGQPFDTTKVRLQ-TSTTPTTAVEVVKK----------LVKNE 72

Query: 259 GFRALYKGFVPKVLRLG 275
           G R  YKG +  ++ +G
Sbjct: 73  GLRGFYKGTLTPLVGVG 89

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 90.9 bits (224), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 125/286 (43%), Gaps = 32/286 (11%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74
             AG   G++++L+  P D  K R+Q           T   + +K ++  EG    YKG 
Sbjct: 29  LLAGTAGGIAQVLIGQPFDTTKVRLQ------TSKVPTSAAEVVKNLLKNEGPKGFYKGT 82

Query: 75  SSPILMEAPKRATKFACNDEFQKLYKQAFGVEK---LSQPLSMLAGASAGCVEAFVVVPF 131
            +P++      + +F  N+  ++ +  A  V+    LS     L G + G   +F+  P 
Sbjct: 83  LTPLVGVGACVSIQFGVNEAMKRFF-HARNVDHNATLSLSQYYLCGLTGGMTNSFLASPI 141

Query: 132 ELVKIRLQD-----ASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGII 186
           E V+IRLQ      A + +KGP+D ++K+ +++G++    GL  T+ R     G YF ++
Sbjct: 142 EHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQKGLM---RGLIPTMLREGHGCGTYF-LV 197

Query: 187 FQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-------PFDVVKSRIQNTAVIPG 239
           ++A      +    Q +    I     C  G +  T       P DVVKS +Q   +   
Sbjct: 198 YEALV----SKQINQGLKRTEIPPWKLCLYGALSGTALWLMVYPIDVVKSVMQTDNLNKP 253

Query: 240 VVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
              K    +     +Y  EG +A +KGF P +LR  P  G     F
Sbjct: 254 QNGKNMIQVAR--NLYAREGLKAFFKGFGPTMLRAAPANGGTFATF 297

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 83/184 (45%), Gaps = 8/184 (4%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74
           +  G   G++   +  P++ V+ R+Q Q   GA   + G +DC+KK+ + +G   L +G+
Sbjct: 124 YLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQKG---LMRGL 180

Query: 75  SSPILMEAPKRATKFACNDEF-QKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFEL 133
              +L E     T F   +    K   Q     ++      L GA +G     +V P ++
Sbjct: 181 IPTMLREGHGCGTYFLVYEALVSKQINQGLKRTEIPPWKLCLYGALSGTALWLMVYPIDV 240

Query: 134 VKIRLQ----DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQA 189
           VK  +Q    +   + K  + V R + AREG+ A + G   T+ R A  NGG F     A
Sbjct: 241 VKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGGTFATFELA 300

Query: 190 RALL 193
             LL
Sbjct: 301 MRLL 304

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 79/183 (43%), Gaps = 14/183 (7%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172
            +LAG + G  +  +  PF+  K+RLQ  S       +VV+ ++  EG    Y G  + L
Sbjct: 28  DLLAGTAGGIAQVLIGQPFDTTKVRLQ-TSKVPTSAAEVVKNLLKNEGPKGFYKGTLTPL 86

Query: 173 WRHALWNGGYFGI------IFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDV 226
                     FG+       F AR +    HN T  ++   +    G      L++P + 
Sbjct: 87  VGVGACVSIQFGVNEAMKRFFHARNV---DHNATLSLSQYYLCGLTGGMTNSFLASPIEH 143

Query: 227 VKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFT 286
           V+ R+Q T    G   ++   +  +  +  ++G   L +G +P +LR G G G   +V+ 
Sbjct: 144 VRIRLQ-TQTGSGAQAEFKGPIDCIKKLRSQKG---LMRGLIPTMLREGHGCGTYFLVYE 199

Query: 287 GVL 289
            ++
Sbjct: 200 ALV 202

 Score = 28.1 bits (61), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/73 (21%), Positives = 32/73 (43%), Gaps = 7/73 (9%)

Query: 203 ITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRA 262
           +  DL++ + G     ++  PFD  K R+Q + V              +  + + EG + 
Sbjct: 25  VVKDLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVPTSAAE-------VVKNLLKNEGPKG 77

Query: 263 LYKGFVPKVLRLG 275
            YKG +  ++ +G
Sbjct: 78  FYKGTLTPLVGVG 90

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 90.5 bits (223), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 85/296 (28%), Positives = 132/296 (44%), Gaps = 43/296 (14%)

Query: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLY 71
           L   F+G V GV+++LV  P D++K R  LQ   G    +  + D +K     EG    Y
Sbjct: 25  LKDVFSGTVGGVAQVLVGQPFDIIKVR--LQTMPGNATAWEAITDLVKY----EGFMGFY 78

Query: 72  KGISSPILMEAPKRATKFACNDEFQKLYK---QAFGV--EKLSQPLSMLAGASAGCVEAF 126
           KG  +P++      + +F  N+  ++ ++   ++ G+    LS       G  +G   A 
Sbjct: 79  KGTMAPLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSANAL 138

Query: 127 VVVPFELVKIRLQD-----ASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGG 181
           +  P E V+IRLQ      A++ YK  +D   K++ ++G  ++  G  +TL R +   G 
Sbjct: 139 LATPIEHVRIRLQLQKEALANAEYKSTLDCTEKLL-KQG--SLMRGFTATLMRTSHGFGI 195

Query: 182 YFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCM-------LSTPFDVVKSRIQ-- 232
           YF + ++       AH        + IS    C  G +       ++ PFDVVKS +Q  
Sbjct: 196 YF-LTYETLIASQLAHG----FRREDISAWKACMFGALSGAFFWAMTYPFDVVKSVMQAD 250

Query: 233 ---NTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
              N A    VV+           IYRE G RA  KGF+P +LR  P  G     F
Sbjct: 251 KLVNPAYGTNVVQVAK-------NIYRERGLRAFTKGFMPTMLRSLPVNGATFAAF 299

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 90.9 bits (224), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 83/297 (27%), Positives = 142/297 (47%), Gaps = 34/297 (11%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           +GA+AG    +++ PLDV KTR+Q Q  G    +Y G+V  L  I+  EGV  LYKG++ 
Sbjct: 90  SGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLAP 149

Query: 77  PILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKI 136
            +L   P     F+  ++ ++ Y        +S   S L   +AG +   +  P  +VK 
Sbjct: 150 IVLGYFPTWMLYFSVYEKCKQRYPSYLPGGFVSHAASAL---TAGAISTALTNPIWVVKT 206

Query: 137 RL------QDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGG-YFGIIFQA 189
           RL         S++Y+  +D  RK+   EG+   Y+GL  +L+   L++   +F +  + 
Sbjct: 207 RLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLF--GLFHVAIHFPVYEKL 264

Query: 190 RALL----PAA------HNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQ--NTAVI 237
           +  L    PAA      HNK Q +   +++  +   +  +++ P +++++R+Q  ++ V 
Sbjct: 265 KIWLHRNTPAADGQRLDHNKLQ-LDRLIVASCLSKVVASVITYPHEILRTRMQVRHSGVP 323

Query: 238 PGVVRKYNWSLPSLL-TIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCR 293
           P        SL +LL  I   EG+   Y GF   ++R  P   I LV F     + R
Sbjct: 324 P--------SLLNLLGRIRASEGYVGFYSGFATNLVRTVPASVITLVSFEYFRKYLR 372

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 72/168 (42%), Gaps = 7/168 (4%)

Query: 112 LSMLAGASAGCVEAFVVVPFELVKIRLQ-----DASSSYKGPVDVVRKIVAREGVLAMYN 166
           ++ ++GA AG V   +V P ++ K RLQ          Y+G V  +  I+  EGV  +Y 
Sbjct: 86  VTAVSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYK 145

Query: 167 GLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDV 226
           GL   +  +      YF +  + +   P+         +   S     +I   L+ P  V
Sbjct: 146 GLAPIVLGYFPTWMLYFSVYEKCKQRYPS--YLPGGFVSHAASALTAGAISTALTNPIWV 203

Query: 227 VKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRL 274
           VK+R+   + +      Y  +L +   +YR EG +  Y G VP +  L
Sbjct: 204 VKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLFGL 251

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 74/174 (42%), Gaps = 11/174 (6%)

Query: 11  FLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQ-GGAGPHYTGVVDCLKKIVAGEGVGR 69
           F+    +   AG     +  P+ VVKTR+ +Q        +Y   +D  +K+   EG+  
Sbjct: 180 FVSHAASALTAGAISTALTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKV 239

Query: 70  LYKGISSPILMEAPKRATKFACNDEFQ-KLYK-------QAFGVEKLSQPLSMLAGASAG 121
            Y G+  P L      A  F   ++ +  L++       Q     KL     ++A   + 
Sbjct: 240 FYSGL-VPSLFGLFHVAIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSK 298

Query: 122 CVEAFVVVPFELVKIRLQDASSSYKGP-VDVVRKIVAREGVLAMYNGLESTLWR 174
            V + +  P E+++ R+Q   S      ++++ +I A EG +  Y+G  + L R
Sbjct: 299 VVASVITYPHEILRTRMQVRHSGVPPSLLNLLGRIRASEGYVGFYSGFATNLVR 352

>Kwal_26.7653
          Length = 325

 Score = 89.7 bits (221), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 95/201 (47%), Gaps = 15/201 (7%)

Query: 106 EKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQ-------DASSSYKGPVDVVRKIVAR 158
           +K+S+  S +AG  A C+   V  P ELVK R+Q       DA   YK P+  ++ I   
Sbjct: 20  QKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKN 79

Query: 159 EGVLAMYNGLESTLWRHALWNGGYFGIIFQARALL-----PAAH-NKTQCITNDLISDSI 212
           EG+  +  GL          NG   G     R++L     PA   +K Q +  +++S + 
Sbjct: 80  EGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGAT 139

Query: 213 GCSIGCMLSTPFDVVKSRIQN--TAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPK 270
              IG ++ +P  ++K+R+Q+   A+  G    Y      L +IYR EGF+ LY+G    
Sbjct: 140 SGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAA 199

Query: 271 VLRLGPGGGILLVVFTGVLDF 291
           +LR G G  + L ++     F
Sbjct: 200 ILRTGAGSSVQLPIYNTAKHF 220

 Score = 77.0 bits (188), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 68/280 (24%), Positives = 127/280 (45%), Gaps = 26/280 (9%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPH--YTGVVDCLKKIVAGEGVGRLYK 72
           F AG +A    + V  P+++VKTRMQLQ +  A     Y   +  LK I   EG+  L K
Sbjct: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87

Query: 73  GISSPILMEAPKRATKFACNDEFQKLYKQAF-------GVEKLSQPLSMLAGASAGCVEA 125
           G+S   + +     ++    +  + +  + F        V+ ++  +++++GA++G + A
Sbjct: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVA--VNVVSGATSGIIGA 145

Query: 126 FVVVPFELVKIRLQDASSS--------YKGPVDVVRKIVAREGVLAMYNGLESTLWRHAL 177
            +  P  L+K R+Q  S++        Y    + +  I   EG   +Y G+++ + R   
Sbjct: 146 IMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205

Query: 178 WNGGYFGIIFQARALLPAAHNKTQCITNDLISDSI-GCSIGCMLSTPFDVVKSRIQNTAV 236
            +     I   A+  L       +     L++ ++ G  +G +++ P+DV+ +R+ N   
Sbjct: 206 GSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMN-PWDVILTRVYNQK- 263

Query: 237 IPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
                  Y   L   +   R EG  ALYKGF  ++ R+ P
Sbjct: 264 ----GNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 43/94 (45%), Gaps = 7/94 (7%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
              A  V+G    +VM P DV+ TR+  Q     G  Y G +DC  K V  EG+G LYKG
Sbjct: 234 HLVASTVSGFGVGVVMNPWDVILTRVYNQ----KGNLYKGPLDCFVKTVRIEGIGALYKG 289

Query: 74  ISSPILMEAPKRATKFACNDEFQKLYKQAFGVEK 107
             + I   AP       C    ++  K  + VEK
Sbjct: 290 FEAQIFRIAPH---TILCLTFMEQTMKVVYAVEK 320

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 88.6 bits (218), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 120/280 (42%), Gaps = 32/280 (11%)

Query: 18  GAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGR-LYKGISS 76
           G++AG    ++ YP D VK R+Q Q        +     C+K     EG+ R  Y+GI S
Sbjct: 13  GSIAGAVGKVIEYPFDTVKVRLQTQ----PAHMFPTTWSCIKFTYDNEGLWRGFYQGIGS 68

Query: 77  PILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLS--MLAGASAGCVEAFVVVPFELV 134
           P+   A + A  F   ++ ++L      VE L  PLS  + AGA AG   +FV+ P EL+
Sbjct: 69  PLAGAALENAVLFVSFNQAKRL----LDVESLLSPLSKTVWAGAFAGACASFVLTPVELI 124

Query: 135 KIRLQ-----DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQA 189
           K +LQ        +S+   +  ++ +++  G L ++ G   T  R +     +F      
Sbjct: 125 KCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEVV 184

Query: 190 RALLPAAHNKTQCITNDLISDSIGCSIGCMLST---PFDVVKSRIQNTAV-IPGVVRKYN 245
           +  L +     Q  T +L++   G S G   +    P D +KS +Q   + +    RK  
Sbjct: 185 KNYLASRRQAEQNTTWELLAS--GASAGLAFNASIFPADTIKSTMQTDHIDLSSATRK-- 240

Query: 246 WSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
                   IY  +G    Y+G    ++R  P    +   +
Sbjct: 241 --------IYARQGIAGFYRGLGITLIRAVPANAAIFYTY 272

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 79/180 (43%), Gaps = 4/180 (2%)

Query: 114 MLAGASAGCVEAFVVVPFELVKIRLQDASSS-YKGPVDVVRKIVAREGVL-AMYNGLEST 171
           +L G+ AG V   +  PF+ VK+RLQ   +  +      ++     EG+    Y G+ S 
Sbjct: 10  ILYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTTWSCIKFTYDNEGLWRGFYQGIGSP 69

Query: 172 LWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRI 231
           L   AL N   F    QA+ LL    +    ++  + + +   +    + TP +++K ++
Sbjct: 70  LAGAALENAVLFVSFNQAKRLLD-VESLLSPLSKTVWAGAFAGACASFVLTPVELIKCKL 128

Query: 232 QNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDF 291
           Q  + +      +   LP++ ++  E GF  L++G     +R   GG      +  V ++
Sbjct: 129 Q-VSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEVVKNY 187

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 34/73 (46%), Gaps = 8/73 (10%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           +GA AG++    ++P D +K+ MQ          +  +    +KI A +G+   Y+G+  
Sbjct: 205 SGASAGLAFNASIFPADTIKSTMQ--------TDHIDLSSATRKIYARQGIAGFYRGLGI 256

Query: 77  PILMEAPKRATKF 89
            ++   P  A  F
Sbjct: 257 TLIRAVPANAAIF 269

 Score = 32.0 bits (71), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 6/81 (7%)

Query: 206 DLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEG-FRALY 264
           D++  SI  ++G ++  PFD VK R+Q     P  +    WS       Y  EG +R  Y
Sbjct: 9   DILYGSIAGAVGKVIEYPFDTVKVRLQTQ---PAHMFPTTWSCIKF--TYDNEGLWRGFY 63

Query: 265 KGFVPKVLRLGPGGGILLVVF 285
           +G    +        +L V F
Sbjct: 64  QGIGSPLAGAALENAVLFVSF 84

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 89.0 bits (219), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 130/295 (44%), Gaps = 19/295 (6%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQ----VQGGAGPHYTGVVD 56
           MS +      F   F  G V+         P++ VK  +Q Q     QG     Y G+VD
Sbjct: 1   MSETKKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVD 60

Query: 57  CLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKL--YKQAFGVEKLSQPLSM 114
           C ++    EG+   ++G ++ ++   P +A  FA  D+ + +  +K+  G  K     ++
Sbjct: 61  CFQRTARQEGIISFWRGNTANVIRYFPTQALNFAFKDQIKAMFGFKKEEGYAKWFAG-NL 119

Query: 115 LAGASAGCVEAFVVVPFELVKIRL-QDASSSYKGP-------VDVVRKIVAREGVLAMYN 166
            +G  AG +    V   +  + RL  DA SS KG        VDV +K +A +GV  +Y 
Sbjct: 120 ASGGIAGGLSLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYR 179

Query: 167 GLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDV 226
           G   ++    ++ G YFG+    + LL     +   I + L+   +  +     S P D 
Sbjct: 180 GFLPSVIGIVVYRGLYFGLYDSCKPLLLTGSLEGSFIASFLLGWVV-TTGASTASYPLDT 238

Query: 227 VKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGIL 281
           V+ R+  T+   G   KY  ++  L  I   EG  +L+KG    +LR   G G++
Sbjct: 239 VRRRMMMTS---GQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGAGVI 290

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 77/183 (42%), Gaps = 28/183 (15%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQG---GAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
           +G +AG   ++ +Y LD  +TR+    +    G    + G+VD  KK +A +GV  LY+G
Sbjct: 121 SGGIAGGLSLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRG 180

Query: 74  ISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFEL 133
               ++     R   F   D  + L     G  + S   S L G       +    P + 
Sbjct: 181 FLPSVIGIVVYRGLYFGLYDSCKPLLLT--GSLEGSFIASFLLGWVVTTGASTASYPLDT 238

Query: 134 VKIRLQDASSS---YKGPVDVVRKIVAREGV--------------------LAMYNGLES 170
           V+ R+   S     YKG +D ++KIVA EGV                    +++Y+ L+ 
Sbjct: 239 VRRRMMMTSGQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGAGVISLYDQLQM 298

Query: 171 TLW 173
            L+
Sbjct: 299 ILF 301

>Kwal_27.12481
          Length = 304

 Score = 89.0 bits (219), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 132/295 (44%), Gaps = 20/295 (6%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQ----VQGGAGPHYTGVVD 56
           M+ S  +S  F   F  G V+         P++ VK  +Q Q     QG     YTG+ +
Sbjct: 1   MADSKKQS-NFAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIGE 59

Query: 57  CLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKL--YKQAFGVEKLSQPLSM 114
           C K+  A EG+   ++G ++ ++   P +A  FA  D+ + +  +K+  G  K     ++
Sbjct: 60  CFKRTAANEGIASFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAG-NL 118

Query: 115 LAGASAGCVEAFVVVPFELVKIRL--------QDASSSYKGPVDVVRKIVAREGVLAMYN 166
            +G +AG +    V   +  + RL        +     + G VDV +K +A +G+  +Y 
Sbjct: 119 ASGGAAGGLSLMFVYSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYR 178

Query: 167 GLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDV 226
           G   ++    ++ G YFG     + LL     +   + + L+  ++  +     S P D 
Sbjct: 179 GFLPSVVGIVVYRGLYFGGYDSLKPLLLTGSLEGSFLASFLLGWAV-TTGASTASYPLDT 237

Query: 227 VKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGIL 281
           V+ R+  T+   G   KYN +  +   I   EG ++L+KG    +LR   G G++
Sbjct: 238 VRRRMMMTS---GQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVI 289

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 75/183 (40%), Gaps = 28/183 (15%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQG---GAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
           +G  AG   ++ +Y LD  +TR+    +G   G    + G+VD  KK +A +G+  LY+G
Sbjct: 120 SGGAAGGLSLMFVYSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRG 179

Query: 74  ISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFEL 133
               ++     R   F   D  + L     G  + S   S L G +     +    P + 
Sbjct: 180 FLPSVVGIVVYRGLYFGGYDSLKPLLLT--GSLEGSFLASFLLGWAVTTGASTASYPLDT 237

Query: 134 VKIRLQDASSS---YKGPVDVVRKIVAREG--------------------VLAMYNGLES 170
           V+ R+   S     Y G  D  RKIVA EG                    V++MY+ L+ 
Sbjct: 238 VRRRMMMTSGQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVISMYDQLQM 297

Query: 171 TLW 173
            L+
Sbjct: 298 ILF 300

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 89.7 bits (221), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 74/265 (27%), Positives = 110/265 (41%), Gaps = 32/265 (12%)

Query: 50  HYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLS 109
            +    +   KI   EG+  L++G+S  +LM  P     F+  + F+           L+
Sbjct: 96  RFNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYFSGYEMFRDHSPMRDSYPSLN 155

Query: 110 QPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSS---------YKGPVDVVRKIVAREG 160
            PL    GA+A  V A  V P EL+K RLQ    S         +K  +   R  +   G
Sbjct: 156 -PL--FCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGG 212

Query: 161 VLAMYNGLESTLWRH----ALWNGGY------FGIIFQARALLPAAHNKTQCITNDLISD 210
              ++ GLE TLWR     A++ G Y      F I F  + L            N  I  
Sbjct: 213 YKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFIGG 272

Query: 211 SIGCSIGCMLSTPFDVVKSRIQ----------NTAVIPGVVRKYNWSLPSLLTIYREEGF 260
           S+  S   +L+ PFDV K+R+Q          NT V P            L  I + EG+
Sbjct: 273 SVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEGY 332

Query: 261 RALYKGFVPKVLRLGPGGGILLVVF 285
            ALY G +P+V+++ P   I++  +
Sbjct: 333 GALYTGLIPRVMKIAPSCAIMISTY 357

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 45/100 (45%), Gaps = 11/100 (11%)

Query: 11  FLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYT-----------GVVDCLK 59
           F+  F  G+V+G S  L+ +P DV KTRMQ+ +        T           G+   L 
Sbjct: 265 FINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLY 324

Query: 60  KIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY 99
            I   EG G LY G+   ++  AP  A   +  +  ++L+
Sbjct: 325 NIKQTEGYGALYTGLIPRVMKIAPSCAIMISTYELSKRLF 364

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 81/190 (42%), Gaps = 18/190 (9%)

Query: 8   SLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVV--DCLKKI---V 62
           S P L   F GA A +     + PL+++KTR+Q  +        T ++  D LK+    +
Sbjct: 150 SYPSLNPLFCGATARMVAATTVAPLELIKTRLQ-SIPRSRKDTTTQMMFKDLLKETRNEI 208

Query: 63  AGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPL---------S 113
              G   L+KG+   +  + P  A  +   + ++K +   F  + L   L         S
Sbjct: 209 RSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINS 268

Query: 114 MLAGASAGCVEAFVVVPFELVKIRLQ---DASSSYKGPVDVVRKIVAREGVLAMYNGLES 170
            + G+ +G   A +  PF++ K R+Q   D  +  +  +   +K V+  G+      ++ 
Sbjct: 269 FIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQ 328

Query: 171 TLWRHALWNG 180
           T    AL+ G
Sbjct: 329 TEGYGALYTG 338

>Kwal_55.20868
          Length = 380

 Score = 89.7 bits (221), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 82/312 (26%), Positives = 138/312 (44%), Gaps = 33/312 (10%)

Query: 2   SSSDTKSLPFLYQFF--------AGAVAGVSEILVMYPLDVVKTRMQLQ-VQGGAGPHYT 52
           S+  + ++PF+ + F        +GA+AG    + + PLDV KTR+Q Q +      +Y 
Sbjct: 58  SNDGSNTIPFVNRSFDDTEITALSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYK 117

Query: 53  GVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAF-GVEKLSQP 111
           G++  L  I+  EG   LYKG+   I+   P     F+  +  +KLY + F   + +S  
Sbjct: 118 GILGTLTTIIRDEGARGLYKGLVPIIMGYFPTWMIYFSVYERSKKLYPRIFPSFDFISHS 177

Query: 112 LSMLAGASAGCVEAFVVVPFELVKIRL------QDASSSYKGPVDVVRKIVAREGVLAMY 165
            S L   +AG V   +  P  +VK RL         S+ Y    D   K+   EG+   Y
Sbjct: 178 ASAL---TAGTVSTILTNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFY 234

Query: 166 NGLESTLWRHALWNGG-YFGIIFQARALLPAAHNKTQCITNDL------ISDSIGCSIGC 218
            GL  +L    L++   +F I  + +  L    + ++   ++L      I+ S    +  
Sbjct: 235 AGLLPSLL--GLFHVAIHFPIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVAS 292

Query: 219 MLSTPFDVVKSRIQ----NTAVIPGVVRKYNWSLPSLLT-IYREEGFRALYKGFVPKVLR 273
            L+ P +++++R+Q     T  +  + +     L  L+   Y+ EG R  Y GF   + R
Sbjct: 293 TLTYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLAR 352

Query: 274 LGPGGGILLVVF 285
             P   I LV F
Sbjct: 353 TLPASAITLVSF 364

 Score = 32.3 bits (72), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/103 (20%), Positives = 43/103 (41%), Gaps = 6/103 (5%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQ------VQGGAGPHYTGV 54
           MS ++  +L       A + + +    + YP ++++TRMQL+      +         G+
Sbjct: 267 MSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQLKAYPTDPLAALQKTSRHGL 326

Query: 55  VDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQK 97
           +  +K     EG+   Y G ++ +    P  A      + F+K
Sbjct: 327 IRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFEYFRK 369

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 88.2 bits (217), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 76/277 (27%), Positives = 127/277 (45%), Gaps = 32/277 (11%)

Query: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLY 71
           +    AG   G++++LV  P D  K R+Q           T  V  +K ++  EG    Y
Sbjct: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQ------TSETSTNAVKVIKDLIKNEGPMGFY 77

Query: 72  KGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSML----AGASAGCVEAFV 127
           KG  +P++      + +F  N+  ++ +   F  E  SQ LS+L     G + G   +F+
Sbjct: 78  KGTLTPLVGVGACVSLQFGVNEAMKRFF-HTFD-EAASQHLSLLQYYICGVAGGFTNSFL 135

Query: 128 VVPFELVKIRLQD-----ASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGY 182
             P E ++IRLQ      A++ +KGP+D ++K+     ++    GL  T+ R +   G Y
Sbjct: 136 ASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLM---RGLTPTMLRESHGCGVY 192

Query: 183 FGIIFQARALLPAAHNKTQCITNDLISDSI---GCSIGCMLST---PFDVVKSRIQNTAV 236
           F + ++A   L     K+     D+ +  +   G + G +L T   P DV+KS +Q   +
Sbjct: 193 F-LTYEA---LIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNL 248

Query: 237 IPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLR 273
                +  N  L    TI   +G   L+KGF P +LR
Sbjct: 249 --KTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 85/177 (48%), Gaps = 14/177 (7%)

Query: 6   TKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGE 65
           ++ L  L  +  G   G +   +  P++ ++ R+Q Q   GA   + G +DC+KK+    
Sbjct: 113 SQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVN- 171

Query: 66  GVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLA--GASAGCV 123
             G+L +G++  +L E+      F   +     ++   G+++   P   L   GA++G +
Sbjct: 172 --GQLMRGLTPTMLRESHGCGVYFLTYEALIG-HQVKSGIQRKDIPAWKLCLFGAASGTL 228

Query: 124 EAFVVVPFELVKIRLQDASSSYKGP------VDVVRKIVAREGVLAMYNGLESTLWR 174
              +V P +++K  +Q  + + K P      + V R I+AR+GV  ++ G   T+ R
Sbjct: 229 LWTMVYPLDVIKSVMQ--TDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 76/183 (41%), Gaps = 14/183 (7%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172
            +LAG + G  +  V  PF+  K+RLQ + +S    V V++ ++  EG +  Y G  + L
Sbjct: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA-VKVIKDLIKNEGPMGFYKGTLTPL 84

Query: 173 WRHALWNGGYFGIIFQARALLPAAHNKTQCITNDL------ISDSIGCSIGCMLSTPFDV 226
                     FG+     A+    H   +  +  L      I    G      L++P + 
Sbjct: 85  VGVGACVSLQFGV---NEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEH 141

Query: 227 VKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFT 286
           ++ R+Q T    G   ++   +  +  + R  G   L +G  P +LR   G G+  + + 
Sbjct: 142 IRIRLQ-TQTGSGATAEFKGPIDCIKKL-RVNG--QLMRGLTPTMLRESHGCGVYFLTYE 197

Query: 287 GVL 289
            ++
Sbjct: 198 ALI 200

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 8/83 (9%)

Query: 193 LPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLL 252
           L + H+ T+ I  DL++ + G     ++  PFD  K R+Q +      V+        + 
Sbjct: 14  LESPHDNTRVI-KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVK-------VIK 65

Query: 253 TIYREEGFRALYKGFVPKVLRLG 275
            + + EG    YKG +  ++ +G
Sbjct: 66  DLIKNEGPMGFYKGTLTPLVGVG 88

>Kwal_33.12988
          Length = 303

 Score = 87.8 bits (216), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 129/282 (45%), Gaps = 28/282 (9%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           AG   G++++LV  P D+ K R+Q      + P  T  +  ++ +V  EG+   YKG + 
Sbjct: 29  AGTTGGIAQVLVGQPFDITKVRLQT----SSTP--TTALRVVQDLVKNEGLRGFYKGTTL 82

Query: 77  PILMEAPKRATKFACNDEFQKLY--KQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELV 134
           P++      +++F  N+  ++ +  +  F    L  P     G  +GC  AF+  P E V
Sbjct: 83  PLIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLPEYYACGFVSGCANAFLATPIEHV 142

Query: 135 KIRLQ-----DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQA 189
           +I LQ      A + Y+G +D ++K++ +EG L    G   T+ R +  +G  FG+ F +
Sbjct: 143 RILLQVQTKSRADAEYQGAMDCIKKLL-KEGKLM--RGFTPTILRTS--HG--FGVYFTS 195

Query: 190 RALLPAAHNKTQCITNDL------ISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRK 243
              +  +  +      D+      +  +   S+   +  PFDV+KS +Q+  +   V   
Sbjct: 196 YEAMICSEQRKGIARKDIPAWKLCLYGAFSGSLLWAMVYPFDVIKSVMQSDKLRTPVYGT 255

Query: 244 YNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
             + +     IY E G +A  KGF P +LR  P  G     F
Sbjct: 256 NVFQVAK--NIYNERGPKAFVKGFGPTMLRSLPVNGATFTAF 295

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 87/195 (44%), Gaps = 23/195 (11%)

Query: 12  LYQFFA-GAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRL 70
           L +++A G V+G +   +  P++ V+  +Q+Q +  A   Y G +DC+KK++     G+L
Sbjct: 118 LPEYYACGFVSGCANAFLATPIEHVRILLQVQTKSRADAEYQGAMDCIKKLLKE---GKL 174

Query: 71  YKGISSPILMEAPKRATKFA------CNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVE 124
            +G +  IL  +      F       C+++ + + ++     KL      L GA +G + 
Sbjct: 175 MRGFTPTILRTSHGFGVYFTSYEAMICSEQRKGIARKDIPAWKLC-----LYGAFSGSLL 229

Query: 125 AFVVVPFELVKIRLQDASSSYKGPV------DVVRKIVAREGVLAMYNGLESTLWRHALW 178
             +V PF+++K  +Q  S   + PV       V + I    G  A   G   T+ R    
Sbjct: 230 WAMVYPFDVIKSVMQ--SDKLRTPVYGTNVFQVAKNIYNERGPKAFVKGFGPTMLRSLPV 287

Query: 179 NGGYFGIIFQARALL 193
           NG  F     A  +L
Sbjct: 288 NGATFTAFEMAMRIL 302

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 76/183 (41%), Gaps = 14/183 (7%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172
            + AG + G  +  V  PF++ K+RLQ  SS+    + VV+ +V  EG+   Y G    L
Sbjct: 26  DITAGTTGGIAQVLVGQPFDITKVRLQ-TSSTPTTALRVVQDLVKNEGLRGFYKGTTLPL 84

Query: 173 WRHALWNGGYFGIIFQARALLPAAHNKTQCITNDL-ISDSIGCSI--GC---MLSTPFDV 226
               L     FG      A+    H +    +  L + +   C    GC    L+TP + 
Sbjct: 85  IGVGLCVSSQFGT---NEAMKRYFHKRNNFQSTSLRLPEYYACGFVSGCANAFLATPIEH 141

Query: 227 VKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFT 286
           V+  +Q          +Y  ++  +  + +E     L +GF P +LR   G G+    + 
Sbjct: 142 VRILLQ-VQTKSRADAEYQGAMDCIKKLLKEG---KLMRGFTPTILRTSHGFGVYFTSYE 197

Query: 287 GVL 289
            ++
Sbjct: 198 AMI 200

>Scas_379.2
          Length = 301

 Score = 87.4 bits (215), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 127/282 (45%), Gaps = 13/282 (4%)

Query: 8   SLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGV 67
           S P  +Q  AGA AG+ E  VM+P+D +KTR    +Q  +    + ++  + KI   EG 
Sbjct: 20  SAPLSHQLLAGAFAGIMEHSVMFPIDALKTR----IQSTSAKSTSNMLSQMAKISTAEGS 75

Query: 68  GRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPL-SMLAGASAGCVEAF 126
             L+KG+ S IL   P  A  FA   E+ K Y       +  QPL + L+G  A      
Sbjct: 76  LALWKGVQSVILGAGPAHAVYFATY-EYTKKYLIDEKDMQTHQPLKTALSGTVATIAADA 134

Query: 127 VVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGII 186
           ++ PF+ +K R+Q  +++     +V ++I   EG  A Y    +TL  +  +    F I 
Sbjct: 135 LMNPFDTLKQRMQLNTNT--TVWNVTKQIYKNEGFSAFYYSYPTTLAMNIPFAAFNFMIY 192

Query: 187 FQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQ---NTAVIPGVVRK 243
             A       ++    +    +S  +  +    ++TP D +K+ +Q   + +V   V+++
Sbjct: 193 ESATKFFNPTNDYNPLV--HCLSGGLSGATCAAITTPLDCIKTVLQVRGSESVSLQVMKE 250

Query: 244 YNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
            N    +   IY+  G +  ++G  P+V    P   I    +
Sbjct: 251 ANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAY 292

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 88.2 bits (217), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 69/257 (26%), Positives = 119/257 (46%), Gaps = 27/257 (10%)

Query: 53  GVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPL 112
           G ++ L+KI   EG+  L++G+   ++M  P     F+    ++ L   +    +L    
Sbjct: 82  GTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFS---GYEALRDNSPLASRLPVAN 138

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQ------DASSSYKGPVDVVRKI---VAREGVLA 163
            ++ GA A  + A  + P EL++ RLQ      D   +     D++R++   V+  G  A
Sbjct: 139 PLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEVSVMGYRA 198

Query: 164 MYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITN------DLISDSIGCSIG 217
           ++ GLE TLWR   ++  Y+G     +    A H  T   +N           S+G ++ 
Sbjct: 199 LFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFACGSMGGAVA 258

Query: 218 CMLSTPFDVVKSRIQNTAVIP------GVVRKYNWS---LPSLLTIYREEGFRALYKGFV 268
            +L+ PFDV K+R+Q     P      G   K + S      L  I + EG RALY G +
Sbjct: 259 ALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEGIRALYTGLL 318

Query: 269 PKVLRLGPGGGILLVVF 285
           P+V+++ P   I++  +
Sbjct: 319 PRVMKIAPSCAIMISTY 335

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 73/184 (39%), Gaps = 24/184 (13%)

Query: 9   LPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVV-DCLKKI---VAG 64
           LP       GA A +     + PL++++TR+Q   +         ++ D L+++   V+ 
Sbjct: 134 LPVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEVSV 193

Query: 65  EGVGRLYKGISSPILMEAPKRATKFA----CNDEFQKLYKQAFGVEKLSQPLSMLA-GAS 119
            G   L+KG+   +  + P  A  +     C  +F   +            +   A G+ 
Sbjct: 194 MGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFACGSM 253

Query: 120 AGCVEAFVVVPFELVKIRLQDASSS---------------YKGPVDVVRKIVAREGVLAM 164
            G V A +  PF++ K R+Q A +S                +G    +  I   EG+ A+
Sbjct: 254 GGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEGIRAL 313

Query: 165 YNGL 168
           Y GL
Sbjct: 314 YTGL 317

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 68/159 (42%), Gaps = 11/159 (6%)

Query: 139 QDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHN 198
           ++ ++  +G ++ +RKI   EG+  ++ GL  TL      N  YF      R   P A  
Sbjct: 74  REPAARLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEALRDNSPLASR 133

Query: 199 KTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREE 258
               + N L+  +    +      P +++++R+Q+        R   + +  LL   R E
Sbjct: 134 LP--VANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTI-YLIGDLLREMRHE 190

Query: 259 ----GFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCR 293
               G+RAL+KG    + R  P   I    + G  +FC+
Sbjct: 191 VSVMGYRALFKGLEITLWRDVPFSAI----YWGTYEFCK 225

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 43/99 (43%), Gaps = 10/99 (10%)

Query: 11  FLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQ-------GGAGPHYT---GVVDCLKK 60
           F+  F  G++ G    L+ +P DV KTRMQ+ +        GG         G+   L  
Sbjct: 244 FIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNA 303

Query: 61  IVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY 99
           I   EG+  LY G+   ++  AP  A   +  +  +K +
Sbjct: 304 IRKSEGIRALYTGLLPRVMKIAPSCAIMISTYELSKKFF 342

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 26/54 (48%)

Query: 207 LISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGF 260
           ++S S G  +  +  TP DVV+ R+    ++P        S P+    +++E F
Sbjct: 15  MVSASAGSLVTSLFLTPLDVVRVRLHQQEMLPSCTCTGQLSKPAGKVFWQDECF 68

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 87.4 bits (215), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/295 (26%), Positives = 131/295 (44%), Gaps = 21/295 (7%)

Query: 3   SSDTK--SLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQ----VQGGAGPHYTGVVD 56
           SSD K     F   F  G V+         P++ VK  +Q Q     QG     Y+G+VD
Sbjct: 2   SSDAKQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVD 61

Query: 57  CLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKL--YKQAFGVEKLSQPLSM 114
           C K+    EG+   ++G ++ ++   P +A  FA  D+ + +  +K+  G  K     ++
Sbjct: 62  CFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAG-NL 120

Query: 115 LAGASAGCVEAFVVVPFELVKIRL-QDASSSYKGP-------VDVVRKIVAREGVLAMYN 166
            +G +AG +    V   +  + RL  DA SS KG         DV +K +  +G+  +Y 
Sbjct: 121 ASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYR 180

Query: 167 GLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDV 226
           G   ++    ++ G YFG+    + L+         + + L+   +  +     S P D 
Sbjct: 181 GFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASFLLGWVV-TTGASTCSYPLDT 239

Query: 227 VKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGIL 281
           V+ R+  T+   G   KYN ++  L  I   EG  +L+KG    +LR   G G++
Sbjct: 240 VRRRMMMTS---GQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVI 291

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 72/183 (39%), Gaps = 28/183 (15%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQG---GAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
           +G  AG   +L +Y LD  +TR+    +    G    + G+ D  KK +  +G+  LY+G
Sbjct: 122 SGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRG 181

Query: 74  ISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFEL 133
               ++     R   F   D  + L     G    S   S L G       +    P + 
Sbjct: 182 FMPSVVGIVVYRGLYFGMFDSLKPLVLT--GSLDGSFLASFLLGWVVTTGASTCSYPLDT 239

Query: 134 VKIRLQDASSS---YKGPVDVVRKIVAREGV--------------------LAMYNGLES 170
           V+ R+   S     Y G +D ++KIVA EGV                    ++MY+ L+ 
Sbjct: 240 VRRRMMMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVISMYDQLQM 299

Query: 171 TLW 173
            L+
Sbjct: 300 ILF 302

>Kwal_55.21335
          Length = 317

 Score = 87.4 bits (215), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 123/279 (44%), Gaps = 30/279 (10%)

Query: 18  GAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEG-VGRLYKGISS 76
           G++AG +  ++ YPLD +K R+Q Q        +     C+K     EG V   Y+G++S
Sbjct: 52  GSIAGAAGKVIEYPLDTIKVRLQTQ----PAHVFPTSWSCIKYTYQKEGFVKGFYQGVAS 107

Query: 77  PILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKI 136
           P++  A + A  F   +  Q   +Q   V  LSQ  ++L+GA AG   ++V+ P EL+K 
Sbjct: 108 PLVGAALENAVLFVTFNRAQNFLQQYESVSPLSQ--TVLSGAFAGACTSYVLTPVELIKC 165

Query: 137 RLQ-----DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARA 191
            LQ      A++ +      V+ IV  +G+  ++ G  ST  R       +F      ++
Sbjct: 166 TLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESLKS 225

Query: 192 LLPAAHNKTQCITNDLISDSIGCSIGCMLST---PFDVVKS--RIQNTAVIPGVVRKYNW 246
            L    N T+  T +L++   G S G   +    P D +KS  + Q+  ++    R    
Sbjct: 226 YLARRRNDTENHTWELLAS--GASAGVAFNASIFPADTIKSTAQTQHLGIVDATKR---- 279

Query: 247 SLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
                  I    G   LY+G    ++R  P   I+   +
Sbjct: 280 -------ILARSGPAGLYRGLGITLIRAAPANAIVFYTY 311

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 81/168 (48%), Gaps = 5/168 (2%)

Query: 10  PFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGR 69
           P      +GA AG     V+ P++++K  +Q+    GA   ++ +   +K IV  +G+G 
Sbjct: 138 PLSQTVLSGAFAGACTSYVLTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGG 197

Query: 70  LYKGISSPILMEAPKRATKFACNDEFQK-LYKQAFGVEKLSQPLSMLAGASAGCVEAFVV 128
           L++G SS  + E    A  F   +  +  L ++    E  +  L + +GASAG      +
Sbjct: 198 LWQGQSSTFIRECAGGAVWFTTYESLKSYLARRRNDTENHTWEL-LASGASAGVAFNASI 256

Query: 129 VPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHA 176
            P + +K     A + + G VD  ++I+AR G   +Y GL  TL R A
Sbjct: 257 FPADTIK---STAQTQHLGIVDATKRILARSGPAGLYRGLGITLIRAA 301

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 8/82 (9%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           +GA AGV+    ++P D +K+  Q Q        + G+VD  K+I+A  G   LY+G+  
Sbjct: 244 SGASAGVAFNASIFPADTIKSTAQTQ--------HLGIVDATKRILARSGPAGLYRGLGI 295

Query: 77  PILMEAPKRATKFACNDEFQKL 98
            ++  AP  A  F   +    L
Sbjct: 296 TLIRAAPANAIVFYTYETLSNL 317

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/180 (20%), Positives = 78/180 (43%), Gaps = 4/180 (2%)

Query: 114 MLAGASAGCVEAFVVVPFELVKIRLQDASSS-YKGPVDVVRKIVAREG-VLAMYNGLEST 171
           +L G+ AG     +  P + +K+RLQ   +  +      ++    +EG V   Y G+ S 
Sbjct: 49  ILYGSIAGAAGKVIEYPLDTIKVRLQTQPAHVFPTSWSCIKYTYQKEGFVKGFYQGVASP 108

Query: 172 LWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRI 231
           L   AL N   F    +A+  L   +     ++  ++S +   +    + TP +++K  +
Sbjct: 109 LVGAALENAVLFVTFNRAQNFLQ-QYESVSPLSQTVLSGAFAGACTSYVLTPVELIKCTL 167

Query: 232 QNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDF 291
           Q  + + G   +++   P++  I + +G   L++G     +R   GG +    +  +  +
Sbjct: 168 Q-VSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESLKSY 226

 Score = 35.0 bits (79), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 6/89 (6%)

Query: 206 DLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGF-RALY 264
           D++  SI  + G ++  P D +K R+Q     P  V   +WS   +   Y++EGF +  Y
Sbjct: 48  DILYGSIAGAAGKVIEYPLDTIKVRLQTQ---PAHVFPTSWSC--IKYTYQKEGFVKGFY 102

Query: 265 KGFVPKVLRLGPGGGILLVVFTGVLDFCR 293
           +G    ++       +L V F    +F +
Sbjct: 103 QGVASPLVGAALENAVLFVTFNRAQNFLQ 131

>Scas_632.9
          Length = 292

 Score = 85.5 bits (210), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 81/282 (28%), Positives = 129/282 (45%), Gaps = 33/282 (11%)

Query: 18  GAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPH-YTGVVDCLKKIVAGEGVGR-LYKGIS 75
           G++AG    ++ YP D VK R+Q Q     G H +     C+K     EGV R  ++GI 
Sbjct: 24  GSIAGAFGKIIEYPFDTVKVRLQTQ-----GSHIFPTTWSCIKYTYHNEGVWRGFFQGIG 78

Query: 76  SPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVK 135
           SP+   A + AT F   ++   + ++   V  LS  L  L+GA AG   +FV+ P EL+K
Sbjct: 79  SPLFGAALENATLFVSYNQCSNVLEKFTNVSPLSNIL--LSGAFAGSCASFVLTPVELIK 136

Query: 136 IRLQ--DASSSYKGPVDVVRKI-----VARE-GVLAMYNGLESTLWRHALWNGGYFGIIF 187
            +LQ  +  ++ +G +   + I     V RE G+L ++ G  ST  R +L    +F    
Sbjct: 137 CKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLGGVAWFATYE 196

Query: 188 QARALLPAAHNKTQCITNDLISDSIGCSIGCMLST---PFDVVKSRIQNTAV-IPGVVRK 243
             +  L      T+  T +L+    G S G   +    P D VKS +Q   + +   V+K
Sbjct: 197 VMKQGLKDRRKDTENKTWELLVS--GASAGLAFNASIFPADTVKSMMQTEHITLINAVKK 254

Query: 244 YNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
                  +LT Y   GF   Y+G    ++R  P    +  ++
Sbjct: 255 -------VLTTYGITGF---YRGLGITLIRAVPANATVFYMY 286

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 42/82 (51%), Gaps = 8/82 (9%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           +GA AG++    ++P D VK+ MQ +       H T +++ +KK++   G+   Y+G+  
Sbjct: 219 SGASAGLAFNASIFPADTVKSMMQTE-------HIT-LINAVKKVLTTYGITGFYRGLGI 270

Query: 77  PILMEAPKRATKFACNDEFQKL 98
            ++   P  AT F   +   K+
Sbjct: 271 TLIRAVPANATVFYMYETLSKM 292

 Score = 31.6 bits (70), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 10/76 (13%)

Query: 194 PAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQN--TAVIPGVVRKYNWSLPSL 251
           P   +  Q   +D+++ SI  + G ++  PFD VK R+Q   + + P       WS   +
Sbjct: 8   PIEKSSVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQTQGSHIFPTT-----WS--CI 60

Query: 252 LTIYREEG-FRALYKG 266
              Y  EG +R  ++G
Sbjct: 61  KYTYHNEGVWRGFFQG 76

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 85.9 bits (211), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 76/274 (27%), Positives = 124/274 (45%), Gaps = 29/274 (10%)

Query: 19  AVAGVSEILVMYPLDVVKTR-MQLQVQGGAGPHYTGVVDCLKKIVA-GEGVGRLYKGISS 76
           A AG+ EI V +P+D +  R M    +  +G     V+       A G+ V  L+ G+  
Sbjct: 18  ASAGILEIGVFHPVDTISKRLMSNHTKITSGAQLNSVIFRDHAAEAFGKRVFTLFPGLGY 77

Query: 77  PILMEAPKRATKFA--------CNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVV 128
             + +  +R  K+          N  F+K +  AFG +      S  AG+  G  E  V+
Sbjct: 78  AAVYKILQRVYKYGGQPFANEFLNKHFKKDFDSAFGDKTGKALRSATAGSLIGIGE-IVL 136

Query: 129 VPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQ 188
           +P +++KI+ Q    ++KG   +  KI+  EG+  +Y G   T  R+A  +   FG    
Sbjct: 137 LPLDVLKIKRQTNPEAFKGRGFL--KILKDEGIFNLYRGWGWTAARNAPGSFALFGGNAF 194

Query: 189 ARALLPAAHNKTQCI-TNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWS 247
           A+  +    + +Q   + + IS  +G S   ++S P DV+K+RIQN           N+ 
Sbjct: 195 AKEYILGLQDYSQATWSQNFISSIVGASASLIVSAPLDVIKTRIQNR----------NFD 244

Query: 248 LPS-----LLTIYREEGFRALYKGFVPKVLRLGP 276
            P      +    + EGF A +KG  PK+L  GP
Sbjct: 245 NPESGFKIVKNTLKNEGFTAFFKGLTPKLLTTGP 278

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 4/78 (5%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
            F +  V   + ++V  PLDV+KTR+Q +        +  V + LK     EG    +KG
Sbjct: 213 NFISSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKIVKNTLKN----EGFTAFFKG 268

Query: 74  ISSPILMEAPKRATKFAC 91
           ++  +L   PK    FA 
Sbjct: 269 LTPKLLTTGPKLVFSFAL 286

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 85.9 bits (211), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 79/288 (27%), Positives = 132/288 (45%), Gaps = 21/288 (7%)

Query: 10  PFLYQFFAGAVAGVSEILVMYPLDVVKTRMQ----LQVQGGAGPHYTGVVDCLKKIVAGE 65
           P  +Q  AGA AG++E  V++PLD +KTR+Q    +   GG  P  + ++  L  I A E
Sbjct: 17  PLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQ-PIPSTMLRQLSSISAQE 75

Query: 66  GVGRLYKGISSPILMEAPKRATKFACNDEFQK-LYKQAFGVEKLSQPLSMLAGASAGCVE 124
           G   L+KG+ S +L   P  A  FA  +  +  L  +A    K     +  +GA+A    
Sbjct: 76  GSMVLWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTAFSGATATIAA 135

Query: 125 AFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFG 184
             ++ PF+++K R+Q  ++      D  ++I ++EG  A Y+   +TL  +  +    FG
Sbjct: 136 DALMNPFDVIKQRIQLNTN--ISVWDTAKRIYSKEGFQAFYSSYPTTLAINIPFAAFNFG 193

Query: 185 IIFQA-RALLPAAHNKTQCITNDLISDSIGCSIGCM---LSTPFDVVKSRIQ---NTAVI 237
           I   A R   P+       + N  I    G   G     L+TP D +K+ +Q   +  V 
Sbjct: 194 IYDTATRYFNPSG------VYNPFIHCLCGGISGAACAGLTTPLDCIKTALQVRGSEKVS 247

Query: 238 PGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
             V ++ +    +   IY+  G+R  + G  P++L   P   I    +
Sbjct: 248 MEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAISWTAY 295

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 55/138 (39%), Gaps = 12/138 (8%)

Query: 3   SSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIV 62
           ++ T    F    F+GA A ++   +M P DV+K R+QL            V D  K+I 
Sbjct: 113 ATSTSKYHFFKTAFSGATATIAADALMNPFDVIKQRIQLNTN-------ISVWDTAKRIY 165

Query: 63  AGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQP-LSMLAGASAG 121
           + EG    Y    + + +  P  A  F   D   +     F    +  P +  L G  +G
Sbjct: 166 SKEGFQAFYSSYPTTLAINIPFAAFNFGIYDTATRY----FNPSGVYNPFIHCLCGGISG 221

Query: 122 CVEAFVVVPFELVKIRLQ 139
              A +  P + +K  LQ
Sbjct: 222 AACAGLTTPLDCIKTALQ 239

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 85.9 bits (211), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 128/285 (44%), Gaps = 19/285 (6%)

Query: 11  FLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQ----VQGGAGPHYTGVVDCLKKIVAGEG 66
           FL  F  G V+         P++ VK  +Q Q     QG     Y G++DC K+    EG
Sbjct: 23  FLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEG 82

Query: 67  VGRLYKGISSPILMEAPKRATKFACNDEFQKL--YKQAFGVEKLSQPLSMLAGASAGCVE 124
           V   ++G ++ ++   P +A  FA  D+ + +  +K+  G  K     ++ +G +AG + 
Sbjct: 83  VISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAG-NLASGGAAGALS 141

Query: 125 AFVVVPFELVKIRL-QDASSSYKGP-------VDVVRKIVAREGVLAMYNGLESTLWRHA 176
              V   +  + RL  D+ SS KG        +DV +K +  +GV  +Y G   ++    
Sbjct: 142 LLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIV 201

Query: 177 LWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAV 236
           ++ G YFG+    + LL     +   + + L+   +  +     S P D V+ R+  T+ 
Sbjct: 202 VYRGLYFGMYDSLKPLLLTGSLEGSFLASFLLGWVV-TTGASTCSYPLDTVRRRMMMTS- 259

Query: 237 IPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGIL 281
             G   KY+ +   L  I   EG  +L+KG    +LR   G G++
Sbjct: 260 --GQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGVI 302

 Score = 49.7 bits (117), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 73/183 (39%), Gaps = 28/183 (15%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQG---GAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
           +G  AG   +L +Y LD  +TR+    +    G    + G++D  KK +  +GV  LY+G
Sbjct: 133 SGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRG 192

Query: 74  ISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFEL 133
               ++     R   F   D  + L     G  + S   S L G       +    P + 
Sbjct: 193 FLPSVVGIVVYRGLYFGMYDSLKPLLLT--GSLEGSFLASFLLGWVVTTGASTCSYPLDT 250

Query: 134 VKIRLQDASSS---YKGPVDVVRKIVAREGV--------------------LAMYNGLES 170
           V+ R+   S     Y G  D +RKIVA EGV                    ++MY+ L+ 
Sbjct: 251 VRRRMMMTSGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGVISMYDQLQM 310

Query: 171 TLW 173
            L+
Sbjct: 311 ILF 313

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 85.9 bits (211), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 79/302 (26%), Positives = 135/302 (44%), Gaps = 22/302 (7%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKK 60
           MSS+     PF + F AG++AG  E  + YP +  KTR+QL  +         V+  +  
Sbjct: 81  MSSNKPAVDPF-HSFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVL--IYN 137

Query: 61  IVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASA 120
                G+  +Y G  + I+    K   +F   D  + L +      +LS    ++AG  A
Sbjct: 138 TGKNYGISSIYVGCPAFIVGNTAKAGIRFLGFDTIKNLLRDK-KTGELSGFRGVVAGLGA 196

Query: 121 GCVEAFV-VVPFELVKIRLQDASSSY--------KGPVDVVRKIVAREGVLAMYNGLEST 171
           G +E+ V V PFE +K  L D   +         KG V    K+++ +G   +Y G+   
Sbjct: 197 GLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPV 256

Query: 172 LWRHALWNGGYFGIIFQARALLPAAHN--KTQCITNDL--ISDSIGCSIGCMLSTPFDVV 227
             R A       G   + + L+    N  K + +++ L  I  +    +    + P D V
Sbjct: 257 SMRQAANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTV 316

Query: 228 KSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTG 287
           K+R+Q+         +Y+ ++    TI++EEG +  +KG  P++ RL   GGI+  ++  
Sbjct: 317 KTRMQSLNA-----GQYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYEK 371

Query: 288 VL 289
           VL
Sbjct: 372 VL 373

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 85.5 bits (210), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 113/258 (43%), Gaps = 28/258 (10%)

Query: 50  HYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLS 109
            + G ++  +KI   EGV  L++GIS  +LM  P     F    E+ +      G+    
Sbjct: 109 KFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFT-GYEYVRDRSPLNGLYPTI 167

Query: 110 QPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSS---------YKGPVDVVRKIVAREG 160
            PL  + GA A  + A  V P EL+K +LQ   SS         Y+   + ++  +A  G
Sbjct: 168 NPL--ICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRG 225

Query: 161 VL-AMYNGLESTLWRH----ALWNGGYFGIIFQARALLPAAHNKTQC----ITNDLISDS 211
           V   M+ GLE TLWR     A++   Y     +   L P+  +K        TN  +   
Sbjct: 226 VAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSFLGGF 285

Query: 212 IGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIY-------REEGFRALY 264
           I  S+  + + PFDV K+R Q + V    +   N    S  T++       + EG  ALY
Sbjct: 286 ISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEGIGALY 345

Query: 265 KGFVPKVLRLGPGGGILL 282
            G  P+V ++ P   I++
Sbjct: 346 TGLAPRVAKIAPSCAIMI 363

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 81/188 (43%), Gaps = 33/188 (17%)

Query: 10  PFLYQFFAGAVAGVSEILVMYPLDVVKTRMQ----LQVQGGAGPHYTGVVDCLKKIVAGE 65
           P +     GA A       + PL+++KT++Q      ++ G+   Y  + + +K  +A  
Sbjct: 165 PTINPLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMR 224

Query: 66  GVGR-LYKGISSPILMEAPKRATKFACNDEFQKL---YKQAFGVEKLSQPL-----SMLA 116
           GV + ++KG+   +  + P  A  +A + EF K    Y      +K S        S L 
Sbjct: 225 GVAQTMFKGLEITLWRDVPFSAIYWA-SYEFYKTKVAYLSPSTFDKNSSNWFHFTNSFLG 283

Query: 117 GASAGCVEAFVVVPFELVKIRLQ----------------DASSSYKGPVDVVRKIVAREG 160
           G  +G + A    PF++ K R Q                 +S++  G ++ +RK    EG
Sbjct: 284 GFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKT---EG 340

Query: 161 VLAMYNGL 168
           + A+Y GL
Sbjct: 341 IGALYTGL 348

 Score = 34.3 bits (77), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 45/100 (45%), Gaps = 14/100 (14%)

Query: 11  FLYQFFAGAVAGVSEILVMYPLDVVKTRMQL-----------QVQGGAGPHYTGVVDCLK 59
           F   F  G ++G    +  +P DV KTR Q+            ++ G+     G ++ ++
Sbjct: 277 FTNSFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIR 336

Query: 60  KIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY 99
           K    EG+G LY G++  +   AP  A   +  +  ++L+
Sbjct: 337 KT---EGIGALYTGLAPRVAKIAPSCAIMISSYELTKRLF 373

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 84.0 bits (206), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 126/282 (44%), Gaps = 32/282 (11%)

Query: 10  PFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGR 69
           P  Y ++ G   G+   +  +PLD+ K R+Q        P  T +V    +I+  EGV  
Sbjct: 7   PVKYPWWYGGFGGIVACVATHPLDLAKVRLQT----APAPKPT-LVRMASQILRNEGVPG 61

Query: 70  LYKGISSPILMEAPKRATKFACNDEFQKLY--KQAFGVEKLSQPLSMLAGASAGCVEAFV 127
           LY G+++ IL +      +F   D  ++ Y  K+         P SM +GA  G +    
Sbjct: 62  LYSGLTAAILRQCTYTTARFGVYDFVKERYIPKEYLNSMLYLLPCSMFSGAVGGLIGN-- 119

Query: 128 VVPFELVKIRLQDASS-------SYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNG 180
             P ++V IR+Q+ SS       +YK   D + KI + EGV  ++ G +  L R  L   
Sbjct: 120 --PADVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTS 177

Query: 181 GYFGIIFQARALLPA-----AHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTA 235
                   A+  L         NK+    + L++  +  ++     +P DV+K+R+ N  
Sbjct: 178 SQVVTYDIAKNYLVQNVGLDKDNKSTHFASSLLAGLVATTV----CSPADVIKTRVMNAH 233

Query: 236 VIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPG 277
                   ++ ++  LL   ++EG   +++G++P  +RLGP 
Sbjct: 234 -----KHSHDSAVRILLDAVKQEGPSFMFRGWLPSFVRLGPN 270

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 84.3 bits (207), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 129/298 (43%), Gaps = 50/298 (16%)

Query: 28  VMYPLDVVKTRMQ------------LQVQGGAGPHYTG--------VVDCLKKIVAGEGV 67
           V  P DVVKTR+Q            +Q  G +  H+              +  +   EG 
Sbjct: 67  VTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGF 126

Query: 68  GRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFV 127
             L+KG+   ++   P R+  F      + +Y +     + +  + +LA A+AG   + V
Sbjct: 127 RSLFKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEAPWIHLLAAATAGWATSTV 186

Query: 128 VVPFELVKIRLQ---DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFG 184
             P  LVK RLQ     + +YK  +D ++ +V  EGVL +Y GL ++      + G   G
Sbjct: 187 TNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSAS------YLGSVEG 240

Query: 185 I-----------IFQARALLPAAH-NKTQCITNDLI------SDSIGCS--IGCMLSTPF 224
           I           I + R++    H ++    T+D +      S S G +  +  +++ P 
Sbjct: 241 ILQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFVASIVTYPH 300

Query: 225 DVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILL 282
           +VV++R++      G + KY   + S   I +EEG  ++Y G  P +LR  P   I+ 
Sbjct: 301 EVVRTRLRQAPTENGKL-KYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTVPNSIIMF 357

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%)

Query: 27  LVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRA 86
           +V YP +VV+TR++          YTG+V   + I+  EG+  +Y G++  +L   P   
Sbjct: 295 IVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTVPNSI 354

Query: 87  TKFAC 91
             F  
Sbjct: 355 IMFGT 359

 Score = 35.4 bits (80), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 43/90 (47%), Gaps = 19/90 (21%)

Query: 220 LSTPFDVVKSRIQN----------------TAVIPGVVR---KYNWSLPSLLTIYREEGF 260
           ++ PFDVVK+R+Q+                ++ +  V R    +  +   +  +YR+EGF
Sbjct: 67  VTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGF 126

Query: 261 RALYKGFVPKVLRLGPGGGILLVVFTGVLD 290
           R+L+KG  P ++ + P   I  + +    D
Sbjct: 127 RSLFKGLGPNLVGVIPARSINFLTYGTTKD 156

>Scas_562.12
          Length = 300

 Score = 82.8 bits (203), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 75/287 (26%), Positives = 127/287 (44%), Gaps = 20/287 (6%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKK 60
           M+S+D K    + +    A AG+ EI V +P+D +  R+          H    V   + 
Sbjct: 1   MASNDRKQ-SGVARLLGSASAGILEIGVFHPVDTISKRLMSNHTKIGNSHELNRVIFREH 59

Query: 61  IVA--GEGVGRLYKGISSPILMEAPKRATKFA--------CNDEFQKLYKQAFGVEKLSQ 110
                G+ +  L+ G+      +  +R  K+          N  ++K +  AFG +    
Sbjct: 60  FSEPLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDSAFGEKTGKA 119

Query: 111 PLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLES 170
             S  AG+  G  E  V++P +++KI+ Q    ++KG   V  KI+  EG+  +Y G   
Sbjct: 120 MRSATAGSLIGIGE-IVLLPLDVLKIKRQTNPEAFKGRGFV--KILKDEGIFNLYRGWGW 176

Query: 171 TLWRHALWNGGYFGIIFQARALLPAAHNKTQCI-TNDLISDSIGCSIGCMLSTPFDVVKS 229
           T  R+A  +   FG    A+  +    + +Q   + + IS  +G S   ++S P DV+K+
Sbjct: 177 TAARNAPGSFALFGGNAFAKEYILGLEDYSQASWSQNFISSIVGASCSLIVSAPLDVIKT 236

Query: 230 RIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
           RIQN +            L  +   ++ EG  A +KG  PK+L  GP
Sbjct: 237 RIQNRS-----FDNPETGLTIVKNTFKNEGITAFFKGLTPKLLTTGP 278

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 14  QFFAGAVAGVS-EILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYK 72
           Q F  ++ G S  ++V  PLDV+KTR  +Q +    P  TG+   +K     EG+   +K
Sbjct: 212 QNFISSIVGASCSLIVSAPLDVIKTR--IQNRSFDNPE-TGLT-IVKNTFKNEGITAFFK 267

Query: 73  GISSPILMEAPKRATKFAC 91
           G++  +L   PK    FA 
Sbjct: 268 GLTPKLLTTGPKLVFSFAL 286

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 82.8 bits (203), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 74/297 (24%), Positives = 133/297 (44%), Gaps = 24/297 (8%)

Query: 2   SSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQV----QGGAGPHYTGVVDC 57
           + + T+   F   F  G V+         P++ VK  MQ Q     QG     Y G++DC
Sbjct: 4   TETQTQQSHFGVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDC 63

Query: 58  LKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY---KQAFGVEKLSQPLSM 114
            K+    EG+   ++G ++ +L   P +A  FA  D+ + L    ++  G  K     ++
Sbjct: 64  FKRTATHEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWFAG-NL 122

Query: 115 LAGASAGCVEAFVVVPFELVKIRL-QDASSS-------YKGPVDVVRKIVAREGVLAMYN 166
            +G +AG +    V   +  + RL  DA  S       + G +DV +K +  +G+L +Y 
Sbjct: 123 FSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYR 182

Query: 167 GLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLIS--DSIGCSIGCMLSTPF 224
           G   ++    ++ G YFG+    + +L     +   + + L+    ++G S     S P 
Sbjct: 183 GFVPSVLGIIVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWVITMGASTA---SYPL 239

Query: 225 DVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGIL 281
           D V+ R+  T+   G   KY+ +L  L  I ++EG  +L+KG    + R     G++
Sbjct: 240 DTVRRRMMMTS---GQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFRGVAAAGVI 293

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 75/185 (40%), Gaps = 28/185 (15%)

Query: 11  FLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGP---HYTGVVDCLKKIVAGEGV 67
           F    F+G  AG   +L +Y LD  +TR+    +G        + G++D  KK +  +G+
Sbjct: 118 FAGNLFSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGL 177

Query: 68  GRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFV 127
             LY+G    +L     R   F   D F+ +     G  + S   S L G       +  
Sbjct: 178 LGLYRGFVPSVLGIIVYRGLYFGLYDSFKPVLLT--GALEGSFVASFLLGWVITMGASTA 235

Query: 128 VVPFELVKIRLQDASSS---YKGPVDVVRKIVAREG--------------------VLAM 164
             P + V+ R+   S     Y G +D +RKIV +EG                    V+++
Sbjct: 236 SYPLDTVRRRMMMTSGQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFRGVAAAGVISL 295

Query: 165 YNGLE 169
           Y+ L+
Sbjct: 296 YDQLQ 300

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 83.2 bits (204), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 80/324 (24%), Positives = 143/324 (44%), Gaps = 50/324 (15%)

Query: 2   SSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGA--------GP---- 49
           S  + K +     F AG + G++  +V  P DVVKTR+Q  V   A        GP    
Sbjct: 43  SQQNIKEVKPWVHFVAGGIGGMAGAVVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQAN 102

Query: 50  -------HYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQA 102
                  H+      +  +   EG   L+KG+   ++   P R+  F      +++Y + 
Sbjct: 103 VIAQGVRHFKETFGIISNVYRNEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKT 162

Query: 103 FGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQ----DASSSYKGPVDVVRKIVAR 158
               + +  + ++A A+AG   +    P  LVK RLQ      +  YK   D ++ +V +
Sbjct: 163 LNNGQEAVWIHLMAAATAGWATSTATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQK 222

Query: 159 EGVLAMYNGLESTLWRHALWNGGYFGI-----------IFQARALLPAAH-NKTQCITND 206
           EG+L +Y GL ++      + G   GI           I + R++    + ++ +  T+D
Sbjct: 223 EGILGLYKGLSAS------YLGSVEGILQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSD 276

Query: 207 LI------SDSIGCS--IGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREE 258
            I      S S G +  +  +++ P +VV++R++   +  G + KY   + S+  I +EE
Sbjct: 277 KIKEWCQRSGSAGLAKFVASIITYPHEVVRTRLRQAPLENGKL-KYTGLVQSIRVIIKEE 335

Query: 259 GFRALYKGFVPKVLRLGPGGGILL 282
           G  ++Y G  P +LR  P   I+ 
Sbjct: 336 GLASMYGGLTPHLLRTVPNSIIMF 359

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 81.6 bits (200), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 82/292 (28%), Positives = 131/292 (44%), Gaps = 41/292 (14%)

Query: 11  FLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRL 70
           F     +GA AG S  LV +P+D +KTR  LQ +GG                A  G   +
Sbjct: 4   FFLSLLSGAAAGTSTDLVFFPIDTIKTR--LQAKGG--------------FFANGGYKGI 47

Query: 71  YKGISSPILMEAPKRATKFACNDEFQ--------KLYKQAFGVEKLSQPLSMLAGASAGC 122
           Y+G+ S ++  AP  +  F   D  +        KLY Q  G E+L    + +  +S G 
Sbjct: 48  YRGLGSAVVASAPGASLFFISYDYMKVKSRPYISKLYSQ--GSEQLIDTTTHMLSSSIGE 105

Query: 123 VEAFVV-VPFELVKIRLQ--DASSSYKGPVDVVRKIVAREGVLA-MYNGLESTLWRHALW 178
           + A +V VP E+VK R Q    +SS++    ++R    +EG+   +Y G  +T+ R   +
Sbjct: 106 ICACLVRVPAEVVKQRTQVHSTNSSWQTLQSILRN-DNKEGLRKNLYRGWSTTIMREIPF 164

Query: 179 NGGYFGIIFQARALLPAAHNKTQCIT-NDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVI 237
               F +    +     A+ ++Q       I  SI   I    +TP D +K+R+      
Sbjct: 165 TCIQFPLYEYLKKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRL------ 218

Query: 238 PGVVRKYNWSLPS-LLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGV 288
             ++ K   SL S ++ IYREEG    + G  P+ + +  GG I L ++  V
Sbjct: 219 --MLNKTTASLGSVIIRIYREEGPAVFFSGVGPRTMWISAGGAIFLGMYETV 268

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/288 (26%), Positives = 129/288 (44%), Gaps = 42/288 (14%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPH--YTGVVDCLKKIVAGEGVGRLYK 72
           F AG +A    + V  P++VVK RMQLQ +  A     YT     +  +   EG+  L K
Sbjct: 22  FTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQK 81

Query: 73  GISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQP-----LSMLAGASAGCVEAFV 127
           G+ +  + +     ++    +  + +  + F  ++ S       +++ AGA++G + A +
Sbjct: 82  GLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVM 141

Query: 128 VVPFELVKIRLQDASSS--------YKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWN 179
             P  LVK RLQ  S++        Y G  + ++ I   EGV  ++ G+++ + R    +
Sbjct: 142 GSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGS 201

Query: 180 GGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-----------PFDVVK 228
                I   A+  L         + ND++ D  G S+    ST           P+DV+ 
Sbjct: 202 SVQLPIYNTAKNFL---------LRNDIMED--GPSLHLTASTISGLGVAVVMNPWDVIL 250

Query: 229 SRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
           +RI N     G +  Y   +  L+   + EG  ALYKGF  +V R+GP
Sbjct: 251 TRIYNQ---KGDL--YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293

 Score = 70.9 bits (172), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 88/206 (42%), Gaps = 15/206 (7%)

Query: 101 QAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQ-------DASSSYKGPVDVVR 153
           Q    +K+S+  S  AG  A C+   V  P E+VKIR+Q            Y  P   + 
Sbjct: 9   QKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMG 68

Query: 154 KIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAA------HNKTQCITNDL 207
            +   EG+  +  GL +        NG   G     RA++          +K Q +  ++
Sbjct: 69  VVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINV 128

Query: 208 ISDSIGCSIGCMLSTPFDVVKSRIQN--TAVIPGVVRKYNWSLPSLLTIYREEGFRALYK 265
            + +    IG ++ +P  +VK+R+Q+   A+  G    Y      L TIY  EG + L++
Sbjct: 129 FAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFR 188

Query: 266 GFVPKVLRLGPGGGILLVVFTGVLDF 291
           G    +LR G G  + L ++    +F
Sbjct: 189 GIDAAILRTGAGSSVQLPIYNTAKNF 214

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/285 (23%), Positives = 123/285 (43%), Gaps = 9/285 (3%)

Query: 10  PFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGR 69
           P  +Q  AGA AG+ E  VM+P+D +KTR  +Q           ++  +  I   EG   
Sbjct: 32  PLYHQLIAGAFAGIMEHSVMFPIDALKTR--IQSANAKSLSAKNMLSQISHISTSEGTLA 89

Query: 70  LYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVV 129
           L+KG+ S IL   P  A  F   +  +K    +   +      + ++GA A      ++ 
Sbjct: 90  LWKGVQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTHHPFKTAISGACATTASDALMN 149

Query: 130 PFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQA 189
           PF+ +K R+Q  +S+        ++I   EG+ A Y    +TL  +  +    F I   +
Sbjct: 150 PFDTIKQRIQLNTSA--SVWQTTKQIYQSEGLAAFYYSYPTTLVMNIPFAAFNFVIYESS 207

Query: 190 RALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQ---NTAVIPGVVRKYNW 246
              L  ++     I    +  SI  S    ++TP D +K+ +Q   +  V   ++RK + 
Sbjct: 208 TKFLNPSNEYNPLI--HCLCGSISGSTCAAITTPLDCIKTVLQIRGSQTVSLEIMRKADT 265

Query: 247 SLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDF 291
              +   IY+  G++  ++G+ P+++   P   I    +     F
Sbjct: 266 FSKAASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAYECAKHF 310

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 55/139 (39%), Gaps = 10/139 (7%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKK 60
           + SSDT++        +GA A  +   +M P D +K R+QL            V    K+
Sbjct: 120 IDSSDTQTHHPFKTAISGACATTASDALMNPFDTIKQRIQLNTSA-------SVWQTTKQ 172

Query: 61  IVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASA 120
           I   EG+   Y    + ++M  P  A  F   +   K    +     L   +  L G+ +
Sbjct: 173 IYQSEGLAAFYYSYPTTLVMNIPFAAFNFVIYESSTKFLNPSNEYNPL---IHCLCGSIS 229

Query: 121 GCVEAFVVVPFELVKIRLQ 139
           G   A +  P + +K  LQ
Sbjct: 230 GSTCAAITTPLDCIKTVLQ 248

>Kwal_23.3529
          Length = 395

 Score = 82.0 bits (201), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/284 (27%), Positives = 128/284 (45%), Gaps = 36/284 (12%)

Query: 28  VMYPLDVVKTRMQLQVQGGA--GPHYTGVVDCLKKIVAGEGVGR-LYKGISSPILMEAPK 84
           VM+ LD VKTR Q     GA   P Y  ++   +KI   EG+ R LY G ++ +L   P 
Sbjct: 102 VMHSLDTVKTRQQ-----GAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPS 156

Query: 85  RATKFACNDEFQKLYKQAFGV-EKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQ---- 139
            A  F   +  ++     +GV E LS    + AG S   V + V VP E++K RLQ    
Sbjct: 157 AAIFFGTYELTKRKLIDDWGVNETLSH---LTAGLSGDLVSSVVYVPSEVLKTRLQLQGC 213

Query: 140 ------DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALL 193
                  +  +Y+   D +  IV  EG   ++ G ++TL R   ++   F    + R   
Sbjct: 214 YNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQWA 273

Query: 194 PAAHNKTQC----ITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPG--------VV 241
                KT      + N+L++ +    +  +++TP DV+K+RIQ    +P         +V
Sbjct: 274 FTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQ--MPSTVASDSTRLV 331

Query: 242 RKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
           R  N  +  L  +YR EG    + G  P+ +       I+L+++
Sbjct: 332 RIENSLIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLLY 375

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 80.5 bits (197), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 83/295 (28%), Positives = 131/295 (44%), Gaps = 37/295 (12%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKK 60
           M+++D K    L +    A AG+ EI V +P+D +  R+       A       V  + +
Sbjct: 1   MTTNDKKQ-SGLARVLGSASAGILEIGVFHPVDTISKRLMSNHTKIASTSQLNSV--IFR 57

Query: 61  IVAGEGVGR----LYKGISSPILMEAPKRATKFA--------CNDEFQKLYKQAFGVEKL 108
             A E +GR    L+ G+      +  +R  K+          N  F+  + QAFG EK 
Sbjct: 58  DFASEPLGRRLLSLFPGLGYAAAYKILQRVYKYGGQPFANEFLNKNFKGDFDQAFG-EKT 116

Query: 109 SQPL-SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNG 167
            + L S  AG+  G  E  V++P +++KI+ Q    S+KG      KI+  EG   +Y G
Sbjct: 117 GKALRSATAGSLIGIGE-IVLLPLDVLKIKRQTNPESFKG--RGFLKIIKDEG-FGLYRG 172

Query: 168 LESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCI-TNDLISDSIGCSIGCMLSTPFDV 226
              T  R+A  +   FG    A+  +    +  Q   + + +S  +G S   ++S P DV
Sbjct: 173 WGWTAARNAPGSFALFGGNAFAKEYILGLKDYGQATWSQNFVSSIVGASASLIVSAPLDV 232

Query: 227 VKSRIQNTAVIPGVVRKYNWSLPS-----LLTIYREEGFRALYKGFVPKVLRLGP 276
           +K+RIQN           N+  P      +    + EGF A +KG  PK+L  GP
Sbjct: 233 IKTRIQNR----------NFDNPESGFKIIKNTLKNEGFTAFFKGLTPKLLTTGP 277

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 14  QFFAGAVAGVS-EILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYK 72
           Q F  ++ G S  ++V  PLDV+KTR+Q +        +  + + LK     EG    +K
Sbjct: 211 QNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKIIKNTLKN----EGFTAFFK 266

Query: 73  GISSPILMEAPKRATKFAC 91
           G++  +L   PK    FA 
Sbjct: 267 GLTPKLLTTGPKLVFSFAL 285

>Kwal_33.14050
          Length = 314

 Score = 80.5 bits (197), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 123/288 (42%), Gaps = 18/288 (6%)

Query: 10  PFLYQFFAGAVAGVSEILVMYPLDVVKTRMQ-----LQVQGGAGPHYTGVVDCLKKIVAG 64
           P  +Q  AGA AG+ E  +M+P+D +KTRMQ     +     A    + +V  + +I   
Sbjct: 15  PLTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTT 74

Query: 65  EGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY---KQAFGVEKLSQPLSMLAGASAG 121
           EG   L+KG+ S IL   P  A  FA   E  K Y    Q F   +  QPL   A   A 
Sbjct: 75  EGSMALWKGVQSVILGAGPAHAVYFATY-EMCKSYLIDPQDF---QTHQPLKTAASGIAA 130

Query: 122 CVEA-FVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNG 180
            V A  ++ PF+ +K R+Q  + S      V  +I   EG+ A +    +T+  +  +  
Sbjct: 131 TVAADLLMNPFDTIKQRMQLRTFSKDRMWSVASRIYRNEGLAAFFYSYPTTIAMNIPFAA 190

Query: 181 GYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQ---NTAVI 237
             F I   A       +     I    +   I  +    ++TP D +K+ +Q   + +V+
Sbjct: 191 FNFAIYESATKFFNPENTYNPLI--HCLCGGISGATCAAITTPLDCIKTVLQVRGSESVV 248

Query: 238 PGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
             + R+ +    +   I +  G+   ++G  P+++   P   I    +
Sbjct: 249 DPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATAISWTAY 296

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 80.1 bits (196), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 122/278 (43%), Gaps = 22/278 (7%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPH--YTGVVDCLKKIVAGEGVGRLYK 72
           F AG +A    + V  P ++VKTRMQLQ +  A     Y      L  I   EGV  L +
Sbjct: 27  FIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEGVKGLQR 86

Query: 73  GISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPL-----SMLAGASAGCVEAFV 127
           G+ S  + +     ++    +  + +  + F  E     L     ++ AGA++G + A V
Sbjct: 87  GLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTAGATSGIIGAIV 146

Query: 128 VVPFELVKIRLQDASSS--------YKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWN 179
             P  LVK R+Q  S++        Y    + +  I  +EGVL ++ G+++ + R    +
Sbjct: 147 GSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAILRTGAGS 206

Query: 180 GGYFGIIFQARALLPAAHNKTQCITNDLISDSI-GCSIGCMLSTPFDVVKSRIQNTAVIP 238
                I    +  L       +     L+S ++ G  +G +++ P+DVV +R+ N     
Sbjct: 207 SVQLPIYNTTKNFLLQNDIMKEGTALHLLSSTVTGLGVGIVMN-PWDVVLTRVYNQK--- 262

Query: 239 GVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
                Y   +  +    + EG  ALYKGF  ++ R+ P
Sbjct: 263 --GNTYKGPIDCMFKTIKIEGIGALYKGFGAQLFRIAP 298

 Score = 74.7 bits (182), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 93/201 (46%), Gaps = 15/201 (7%)

Query: 106 EKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQ---DASSS----YKGPVDVVRKIVAR 158
           +K+S+  S +AG  A C+   V  PFELVK R+Q   + S++    Y+ P   +  I   
Sbjct: 19  QKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKN 78

Query: 159 EGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAH------NKTQCITNDLISDSI 212
           EGV  +  GL S        NG   G     R +L          +K Q +  ++ + + 
Sbjct: 79  EGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTAGAT 138

Query: 213 GCSIGCMLSTPFDVVKSRIQ--NTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPK 270
              IG ++ +P  +VK+R+Q  + A+  G    Y      L TI+++EG   L++G    
Sbjct: 139 SGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAA 198

Query: 271 VLRLGPGGGILLVVFTGVLDF 291
           +LR G G  + L ++    +F
Sbjct: 199 ILRTGAGSSVQLPIYNTTKNF 219

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 43/93 (46%), Gaps = 7/93 (7%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
              +  V G+   +VM P DVV TR+  Q     G  Y G +DC+ K +  EG+G LYKG
Sbjct: 233 HLLSSTVTGLGVGIVMNPWDVVLTRVYNQ----KGNTYKGPIDCMFKTIKIEGIGALYKG 288

Query: 74  ISSPILMEAPKRATKFACNDEFQKLYKQAFGVE 106
             + +   AP       C    ++  K  + VE
Sbjct: 289 FGAQLFRIAPH---TILCLTFMEQTMKLVYAVE 318

>Scas_645.9
          Length = 391

 Score = 80.5 bits (197), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 119/256 (46%), Gaps = 27/256 (10%)

Query: 50  HYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLS 109
            + G ++   KI   EG+  L++GIS  +LM  P     F   +  +     A      +
Sbjct: 128 RFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLRDNSPLATSSPTFN 187

Query: 110 QPLSMLAGASAGCVEAFVVVPFELVKIRLQD------ASSSY---KGPVDVVRKIVAREG 160
            PL  + GA A  + A  V P EL+K +LQ       +++S+   K  +   R+ +   G
Sbjct: 188 -PL--MCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMRISG 244

Query: 161 VL-AMYNGLESTLWRHALWNGGYFGIIFQARALL----PAAHNKTQCITNDLISDSIGCS 215
              A++ GLE TLWR   ++  Y+G     +  L      +H+      N  I  SI  +
Sbjct: 245 ASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFINSFIGGSISGT 304

Query: 216 IGCMLSTPFDVVKSRIQ-------NTAVI--PGVVRKYNWSLPSLLTIYREEGFRALYKG 266
           I  +++ PFDV K+R Q       + +V+  P + +  N     L  I++ EG+ ALY G
Sbjct: 305 IAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKN-MFKFLRNIWKLEGWGALYTG 363

Query: 267 FVPKVLRLGPGGGILL 282
            VP+++++ P   I++
Sbjct: 364 LVPRMVKIAPSCAIMI 379

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 42/99 (42%), Gaps = 9/99 (9%)

Query: 11  FLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDC---------LKKI 61
           F+  F  G+++G    LV +P DV KTR Q+   G          D          L+ I
Sbjct: 292 FINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNI 351

Query: 62  VAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYK 100
              EG G LY G+   ++  AP  A   +  +  ++L+ 
Sbjct: 352 WKLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKRLFN 390

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 76/185 (41%), Gaps = 26/185 (14%)

Query: 8   SLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQ-LQVQGGAGPHYTGVVDCLKKI----- 61
           S P       GA+A +     + PL+++KT++Q +     +   +  V + LK+      
Sbjct: 182 SSPTFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMR 241

Query: 62  VAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPL----SMLAG 117
           ++G     L+KG+   +  + P  A  +  + EF K +      +  S       S + G
Sbjct: 242 ISGAS-NALFKGLEITLWRDVPFSAIYWG-SYEFCKTHLWMDTSKSHSNLTFFINSFIGG 299

Query: 118 ASAGCVEAFVVVPFELVKIRLQ------DASSSYKGP--------VDVVRKIVAREGVLA 163
           + +G + A V  PF++ K R Q      +  S  K P           +R I   EG  A
Sbjct: 300 SISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWGA 359

Query: 164 MYNGL 168
           +Y GL
Sbjct: 360 LYTGL 364

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 70/167 (41%), Gaps = 16/167 (9%)

Query: 135 KIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLP 194
           ++  +++S  + G ++   KI   EG+  ++ G+   L      N  YF      R   P
Sbjct: 119 ELNCKNSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLRDNSP 178

Query: 195 AAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRK-YNWSL-PSLL 252
            A   +    N L+  +I   +      P +++K+++Q+   IP V +   +W +   LL
Sbjct: 179 LA--TSSPTFNPLMCGAIARILAASTVAPLELLKTKLQS---IPRVSKSTTSWMMVKELL 233

Query: 253 TIYREE-----GFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCRA 294
              R+E        AL+KG    + R  P   I    + G  +FC+ 
Sbjct: 234 KETRQEMRISGASNALFKGLEITLWRDVPFSAI----YWGSYEFCKT 276

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 79.3 bits (194), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 86/291 (29%), Positives = 130/291 (44%), Gaps = 34/291 (11%)

Query: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTR-MQLQVQGGAGPHYTGVV------D 56
           S+ K    L +    A AG+ EI V +P+D +  R M    + G+      V+      +
Sbjct: 2   SNDKKQSGLARVLGSASAGILEIGVFHPVDTISKRLMSNHTKIGSSSQLNSVIFREHAAE 61

Query: 57  CLKKIV----AGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPL 112
            L K V     G G    YK +           A +F  N  F+  +   FG EK  + L
Sbjct: 62  PLSKRVFTLFPGLGYAATYKILQRVYKYGGQPFANEF-LNRNFKADFDNTFG-EKTGKAL 119

Query: 113 -SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLEST 171
            S  AG+  G  E  V++P +++KI+ Q    ++KG   V  KI+  EG L +Y G   T
Sbjct: 120 RSATAGSMIGIGE-IVLLPLDVLKIKRQTNPEAFKGRGFV--KILKDEG-LGLYRGWGWT 175

Query: 172 LWRHALWNGGYFGIIFQARALLPAAHNKTQCI-TNDLISDSIGCSIGCMLSTPFDVVKSR 230
             R+A  +   FG    A+  +    + +Q   + + +S  +G S   ++S P DV+K+R
Sbjct: 176 AARNAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFVSSIVGASASLIISAPLDVIKTR 235

Query: 231 IQNTAVIPGVVRKYNWSLP-SLLTI----YREEGFRALYKGFVPKVLRLGP 276
           IQN           N+  P S  TI     + EGF A +KG  PK+L  GP
Sbjct: 236 IQNK----------NFENPESGFTIVKNTLKNEGFSAFFKGLTPKLLTTGP 276

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 39/79 (49%), Gaps = 5/79 (6%)

Query: 14  QFFAGAVAGVSEILVMY-PLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYK 72
           Q F  ++ G S  L++  PLDV+KTR+Q +        +T V + LK     EG    +K
Sbjct: 210 QNFVSSIVGASASLIISAPLDVIKTRIQNKNFENPESGFTIVKNTLKN----EGFSAFFK 265

Query: 73  GISSPILMEAPKRATKFAC 91
           G++  +L   PK    FA 
Sbjct: 266 GLTPKLLTTGPKLVFSFAL 284

>Scas_667.4
          Length = 308

 Score = 79.3 bits (194), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 132/297 (44%), Gaps = 21/297 (7%)

Query: 1   MSSSD--TKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQ----VQGGAGPHYTGV 54
           MSS +   K   F   F  G V+         P++ VK  +Q Q     QG     Y G+
Sbjct: 1   MSSKEEVKKESNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYKGI 60

Query: 55  VDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKL--YKQAFGVEKLSQPL 112
           ++C ++    EG+   ++G ++ ++   P +A  FA  D+ + +  +K+  G  K     
Sbjct: 61  IECFQRTAKTEGIIAFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYGKWFAG- 119

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRL-QDASSS-------YKGPVDVVRKIVAREGVLAM 164
           ++ +G +AG +    V   +  + RL  DA SS       YKG +DV ++ +A +G+  +
Sbjct: 120 NLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGL 179

Query: 165 YNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPF 224
           Y G   ++    ++ G YFG+    +  +     +   + + L+   I  +     S P 
Sbjct: 180 YRGFLPSVVGIIVYRGLYFGLYDSLKPAVLTGSLEGSFLASFLLG-WIVTTGASTASYPL 238

Query: 225 DVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGIL 281
           D V+ R+  T+   G   KY+ +      +   EG  +L+KG    +LR   G G++
Sbjct: 239 DTVRRRMMMTS---GQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILRGVAGAGVI 292

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 72/183 (39%), Gaps = 28/183 (15%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQG---GAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
           +G  AG   +L +Y LD  +TR+    +    G    Y G++D  K+ +A +G+  LY+G
Sbjct: 123 SGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRG 182

Query: 74  ISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFEL 133
               ++     R   F   D  +       G  + S   S L G       +    P + 
Sbjct: 183 FLPSVVGIIVYRGLYFGLYDSLKPAVLT--GSLEGSFLASFLLGWIVTTGASTASYPLDT 240

Query: 134 VKIRLQDASSS---YKGPVDVVRKIVAREGV--------------------LAMYNGLES 170
           V+ R+   S     Y G  D  RK+VA EGV                    ++MY+ L+ 
Sbjct: 241 VRRRMMMTSGQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILRGVAGAGVISMYDQLQM 300

Query: 171 TLW 173
            ++
Sbjct: 301 IMF 303

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 78.6 bits (192), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/285 (24%), Positives = 122/285 (42%), Gaps = 38/285 (13%)

Query: 18  GAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGR-LYKGISS 76
           G+VAG    ++ YP D VK R+Q Q        Y     C++     EG+ +  Y+GI+S
Sbjct: 14  GSVAGAIGKVIEYPFDTVKVRLQTQ----PAHLYPTTWSCIRSTYTDEGIWKGFYQGIAS 69

Query: 77  PILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKI 136
           P+   A + A  F   ++      +   ++ L++  ++ +GA AG   +F++ P ELVK 
Sbjct: 70  PLFGAALENAVLFVSFNQCTNFLDEFTQLKPLTK--TIYSGAFAGACASFILTPVELVKC 127

Query: 137 RLQ--------DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRH----ALWNGGYFG 184
           +LQ          ++ +      ++ ++  +G+L ++ G  ST  R     A+W   Y  
Sbjct: 128 KLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTYEI 187

Query: 185 IIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST---PFDVVKSRIQNTAV-IPGV 240
           +  +  +L PA   K       L+S   G S G + +    P D VKS  Q   V I   
Sbjct: 188 MKMKFASLHPA--EKENHTWELLVS---GASAGVLFNASVFPADTVKSVCQTEHVSIVNA 242

Query: 241 VRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
           ++K          + R  G    Y+G    ++R  P    +   +
Sbjct: 243 LKK----------VLRTHGITGFYRGLGITLIRAAPANATVFYTY 277

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 8/83 (9%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           +GA AGV     ++P D VK+  Q +        +  +V+ LKK++   G+   Y+G+  
Sbjct: 210 SGASAGVLFNASVFPADTVKSVCQTE--------HVSIVNALKKVLRTHGITGFYRGLGI 261

Query: 77  PILMEAPKRATKFACNDEFQKLY 99
            ++  AP  AT F   +  +K++
Sbjct: 262 TLIRAAPANATVFYTYETLKKMF 284

 Score = 35.8 bits (81), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 6/87 (6%)

Query: 206 DLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEG-FRALY 264
           D+   S+  +IG ++  PFD VK R+Q     P  +    WS   + + Y +EG ++  Y
Sbjct: 10  DIAYGSVAGAIGKVIEYPFDTVKVRLQTQ---PAHLYPTTWS--CIRSTYTDEGIWKGFY 64

Query: 265 KGFVPKVLRLGPGGGILLVVFTGVLDF 291
           +G    +        +L V F    +F
Sbjct: 65  QGIASPLFGAALENAVLFVSFNQCTNF 91

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 80.1 bits (196), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 84/314 (26%), Positives = 132/314 (42%), Gaps = 54/314 (17%)

Query: 16  FAGAVAGVSEILVMYPLDVVKTRMQ---LQVQGG------------AGPHYTGVVDCLKK 60
            +GA+AG    +++ PLDV KTR+Q   LQ+ G              G +Y+G+   L  
Sbjct: 108 LSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTT 167

Query: 61  IVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAF-GVEKLSQPLSMLAGAS 119
           IV  E +  LYKGI   +L   P     F+  +  +  Y + F   E LS  +S L   +
Sbjct: 168 IVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEFLSHSMSAL---T 224

Query: 120 AGCVEAFVVVPFELVKIRLQDAS-------SSYKGPVDVVRKIVAREGVLAMYNGLESTL 172
           AG +   +  P  +VK RL   S       + YK  +D   KI   EG+ + Y+GL  +L
Sbjct: 225 AGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSGLIPSL 284

Query: 173 WRHALWNGGYFGIIFQARALL--------------------PAAHNKTQCITNDLISDSI 212
           +   L    +F +  + + +L                    P     T      LI  S 
Sbjct: 285 F-GLLHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRLIVASC 343

Query: 213 GCS-IGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKV 271
           G   I   L+ P +++++R+Q  + +   ++        + T Y +EG R  Y GF+  +
Sbjct: 344 GSKMIASTLTYPHEILRTRLQLKSDMKPSIKSI------IRTTYAKEGIRGFYSGFLTNM 397

Query: 272 LRLGPGGGILLVVF 285
            R  P   I LV F
Sbjct: 398 FRTVPASAITLVSF 411

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 82/185 (44%), Gaps = 24/185 (12%)

Query: 112 LSMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVD--------------------V 151
           ++ L+GA AG +   +V P ++ K RLQ       GPV                      
Sbjct: 105 ITALSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGT 164

Query: 152 VRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDS 211
           +  IV  E +  +Y G+   +  +      YF +  + +   P   N ++ +++ + + +
Sbjct: 165 LTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEFLSHSMSALT 224

Query: 212 IGCSIGCMLSTPFDVVKSR--IQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVP 269
            G +I   L+ P  VVK+R  +Q+   I G+   Y  +L + + IY+ EG ++ Y G +P
Sbjct: 225 AG-AISTTLTNPIWVVKTRLMLQSGKNIKGMTH-YKNTLDAFIKIYKVEGIKSFYSGLIP 282

Query: 270 KVLRL 274
            +  L
Sbjct: 283 SLFGL 287

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 77/188 (40%), Gaps = 27/188 (14%)

Query: 11  FLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQ----VQGGAGPHYTGVVDCLKKIVAGEG 66
           FL    +   AG     +  P+ VVKTR+ LQ    ++G    HY   +D   KI   EG
Sbjct: 215 FLSHSMSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMT--HYKNTLDAFIKIYKVEG 272

Query: 67  VGRLYKGISSPILMEAPKRATKFACNDEFQKLY---------KQAFGVEKLSQP------ 111
           +   Y G+  P L      A  F   ++ +K+          ++   V   S P      
Sbjct: 273 IKSFYSGLI-PSLFGLLHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGST 331

Query: 112 ---LSMLAGASAGC--VEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYN 166
              L  L  AS G   + + +  P E+++ RLQ  S        ++R   A+EG+   Y+
Sbjct: 332 NFQLGRLIVASCGSKMIASTLTYPHEILRTRLQLKSDMKPSIKSIIRTTYAKEGIRGFYS 391

Query: 167 GLESTLWR 174
           G  + ++R
Sbjct: 392 GFLTNMFR 399

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/73 (21%), Positives = 32/73 (43%), Gaps = 5/73 (6%)

Query: 28  VMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRAT 87
           + YP ++++TR+QL+           +   ++   A EG+   Y G  + +    P  A 
Sbjct: 352 LTYPHEILRTRLQLKSD-----MKPSIKSIIRTTYAKEGIRGFYSGFLTNMFRTVPASAI 406

Query: 88  KFACNDEFQKLYK 100
                + F+K +K
Sbjct: 407 TLVSFEYFRKHFK 419

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 78.6 bits (192), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/281 (25%), Positives = 124/281 (44%), Gaps = 29/281 (10%)

Query: 12  LYQFFAGAVAGVSEILVMYPLDVVKTR-MQLQVQGGAGPHYTGVV--DCLKKIVAGEGVG 68
           L +    A AG+ EI V +P+D +  R M    +  +G     V+  D   + + G+ + 
Sbjct: 11  LARLLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHFSEPL-GKRLF 69

Query: 69  RLYKGISSPILMEAPKRATKFA----CNDEFQKLYKQAFGV---EKLSQPLSMLAGASAG 121
            L+ G+      +  +R  K+      N+   K YK+ F     EK  + +   A  S  
Sbjct: 70  TLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSAAAGSLI 129

Query: 122 CVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGG 181
            +   V++P +++KI+ Q    S+KG   +  KI+  EG+  +Y G   T  R+A  +  
Sbjct: 130 GIGEIVLLPLDVLKIKRQTNPESFKGRGFI--KILRDEGLFNLYRGWGWTAARNAPGSFA 187

Query: 182 YFGIIFQARALLPAAHNKTQCI-TNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGV 240
            FG    A+  +    + +Q   + + IS  +G     ++S P DV+K+RIQN       
Sbjct: 188 LFGGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQNR------ 241

Query: 241 VRKYNWSLPS-----LLTIYREEGFRALYKGFVPKVLRLGP 276
               N+  P      +    + EG  A +KG  PK+L  GP
Sbjct: 242 ----NFDNPESGLRIVKNTLKNEGVTAFFKGLTPKLLTTGP 278

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 4/78 (5%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
            F +  V   S ++V  PLDV+KTR  +Q +    P     +  +K  +  EGV   +KG
Sbjct: 213 NFISSIVGACSSLIVSAPLDVIKTR--IQNRNFDNPESG--LRIVKNTLKNEGVTAFFKG 268

Query: 74  ISSPILMEAPKRATKFAC 91
           ++  +L   PK    FA 
Sbjct: 269 LTPKLLTTGPKLVFSFAL 286

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/283 (27%), Positives = 128/283 (45%), Gaps = 42/283 (14%)

Query: 13  YQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYK 72
           Y ++ G  AG+   +V +PLD+ K R+    Q    P  T +   L+ I+A EGV  LY 
Sbjct: 15  YPWWYGGAAGIFATMVTHPLDLAKVRL----QAAPMPKPT-LFRMLESILANEGVVGLYS 69

Query: 73  GISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQ-----PLSMLAGASAGCVEAFV 127
           G+S+ +L +      +F   D    L +     E+L+      P SM +GA  G    F 
Sbjct: 70  GLSAAVLRQCTYTTVRFGAYD---LLKENVIPREQLTNMAYLLPCSMFSGAIGGLAGNFA 126

Query: 128 VVPFELVKIRLQDASS-------SYKGPVDVVRKIVAREGVL-AMYNGLESTLWRHALWN 179
               ++V IR+Q+ S+       +YK  +D V KI   EG L  ++ G +  + R  L  
Sbjct: 127 ----DVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMT 182

Query: 180 GGY------FGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQN 233
                    F      +    A+ N T  +T  L++  +  ++ C   +P DV+K+RI N
Sbjct: 183 ASQVVTYDVFKNYLVTKLDFDASKNYTH-LTASLLAGLVATTV-C---SPADVMKTRIMN 237

Query: 234 TAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
            +        +  +L  L    R+EG   +++G++P   RLGP
Sbjct: 238 GS------GDHQPALKILADAVRKEGPSFMFRGWLPSFTRLGP 274

>Kwal_14.2210
          Length = 315

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/293 (24%), Positives = 127/293 (43%), Gaps = 18/293 (6%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74
           F AG +AG     V+ P + VK  +Q+Q    A  H  G+   +K++   EGV  L +G 
Sbjct: 21  FCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNH--GLFRAVKQVYLEEGVPGLLRGN 78

Query: 75  SSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELV 134
               +   P  A +F   +  +K + Q      +     +++GA  G        P +LV
Sbjct: 79  GLNCIRIFPYSAVQFLVYEFCKKQWFQQNPDTVVLNWHRLVSGALCGGCSVLATYPLDLV 138

Query: 135 KIRLQDASSSYK--------------GPVDVVRKIVAREG-VLAMYNGLESTLWRHALWN 179
           + RL   +++                G  +++RK   +EG +  +Y G+  T      + 
Sbjct: 139 RTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVVPYV 198

Query: 180 GGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPG 239
              F +  Q R  +PA+ +        L   +I   +   ++ PFD+++ R Q  A+   
Sbjct: 199 ALNFAVYEQLREYIPASFDPASASLYKLSIGAISGGVAQTITYPFDLLRRRFQVLAMGQS 258

Query: 240 VVRKYNWSLP-SLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDF 291
            +  +  S+P +L+TI R EGF+  YKG    + ++ P   +  VV+  V D+
Sbjct: 259 ELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYETVRDY 311

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 82/180 (45%), Gaps = 20/180 (11%)

Query: 13  YQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYT---------GVVDCLKKIVA 63
           ++  +GA+ G   +L  YPLD+V+TR+ +Q    A  H           GV + L+K   
Sbjct: 116 HRLVSGALCGGCSVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYT 175

Query: 64  GE-GVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLA-GASAG 121
            E G+  LY+G+    +   P  A  FA  ++ ++    +F  +  S  L  L+ GA +G
Sbjct: 176 QEGGIFGLYRGVWPTSIGVVPYVALNFAVYEQLREYIPASF--DPASASLYKLSIGAISG 233

Query: 122 CVEAFVVVPFELVKIRLQ-------DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWR 174
            V   +  PF+L++ R Q       +    YK   D +  I   EG    Y GL + L++
Sbjct: 234 GVAQTITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFK 293

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGA--GPHYTGVVDCLKKIVAGEGVGR 69
           LY+   GA++G     + YP D+++ R Q+   G +  G HY  V D L  I   EG   
Sbjct: 223 LYKLSIGAISGGVAQTITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKG 282

Query: 70  LYKGISSPILMEAPKRATKF 89
            YKG+++ +    P  A  +
Sbjct: 283 YYKGLTANLFKVVPSTAVSW 302

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 85/199 (42%), Gaps = 19/199 (9%)

Query: 112 LSMLAGASAGCVEAFVVVPFELVKIRLQDASSSY---KGPVDVVRKIVAREGVLAMYNGL 168
           ++  AG  AG V   VV PFE VKI LQ  SS++    G    V+++   EGV  +  G 
Sbjct: 19  IAFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRGN 78

Query: 169 ESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITN--DLISDSI--GCSIGCMLSTPF 224
                R   ++   F ++++         N    + N   L+S ++  GCS+  + + P 
Sbjct: 79  GLNCIRIFPYSAVQF-LVYEFCKKQWFQQNPDTVVLNWHRLVSGALCGGCSV--LATYPL 135

Query: 225 DVVKSRIQ----NTAVIPGVVRKYNWSLPSLLTIYR-----EEGFRALYKGFVPKVLRLG 275
           D+V++R+     N A +           P +  + R     E G   LY+G  P  + + 
Sbjct: 136 DLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVV 195

Query: 276 PGGGILLVVFTGVLDFCRA 294
           P   +   V+  + ++  A
Sbjct: 196 PYVALNFAVYEQLREYIPA 214

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 125/288 (43%), Gaps = 42/288 (14%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQ--VQGGAGPHYTGVVDCLKKIVAGEGVGRLYK 72
           F AG +A    + V  P++++K RMQLQ  +   A   Y   +  +  I   EG+  L K
Sbjct: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQK 85

Query: 73  GISSPILMEAPKRATKFACNDEFQKLYKQAFGVEK-----LSQPLSMLAGASAGCVEAFV 127
           G+++  + +     ++    +  +    Q F  ++      S  +++ +GA++G + A +
Sbjct: 86  GLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIGAVI 145

Query: 128 VVPFELVKIRLQDAS--------SSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWN 179
             P  LVK RLQ  S        + Y G  + +  I   EGV  ++ G+++ + R    +
Sbjct: 146 GSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGS 205

Query: 180 GGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-----------PFDVVK 228
                I   A+ +L         + NDL+ D  G ++    ST           P+DV+ 
Sbjct: 206 SVQLPIYNTAKNIL---------VKNDLMKD--GPALHLTASTISGLGVAVVMNPWDVIL 254

Query: 229 SRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
           +RI N          Y   +  L+   R EG  ALYKGF  +V R+ P
Sbjct: 255 TRIYNQKG-----DLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297

 Score = 75.1 bits (183), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 91/196 (46%), Gaps = 15/196 (7%)

Query: 106 EKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQ-------DASSSYKGPVDVVRKIVAR 158
           +K+S+  S +AG  A C+   V  P EL+KIR+Q        A+  YK P+  +  I   
Sbjct: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77

Query: 159 EGVLAMYNGLESTLWRHALWNGGYFGIIFQARALL------PAAHNKTQCITNDLISDSI 212
           EG+  +  GL +        NG   G     R+ L          +K Q +  ++ S + 
Sbjct: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAA 137

Query: 213 GCSIGCMLSTPFDVVKSRIQNTA--VIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPK 270
              IG ++ +P  +VK+R+Q+ +  +  G    Y      L+TI++ EG + L++G    
Sbjct: 138 SGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAA 197

Query: 271 VLRLGPGGGILLVVFT 286
           +LR G G  + L ++ 
Sbjct: 198 ILRTGAGSSVQLPIYN 213

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/304 (23%), Positives = 128/304 (42%), Gaps = 30/304 (9%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74
           F AG +AG     V+ P + VK  + LQVQ     +  G+ D + ++   E +  L++G 
Sbjct: 27  FLAGGIAGAISRTVVSPFERVK--ILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGN 84

Query: 75  SSPILMEAPKRATKFACNDEFQKLYKQAFGV------EKLSQPLSMLAGASAGCVEAFVV 128
               +   P  A +F     F+   K  F V      E+L+    + +GA  G       
Sbjct: 85  GLNCIRVFPYSAVQFVV---FEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141

Query: 129 VPFELVKIRLQDASSSYK--------------GPVDVVRKIVAREG-VLAMYNGLESTLW 173
            P +LV+ RL   +++                G   ++ K  A EG ++ +Y G+  T  
Sbjct: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSL 201

Query: 174 RHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST---PFDVVKSR 230
               +    F +  Q +  +P+  N    + + L   S+G   G +  T   PFD+++ R
Sbjct: 202 GIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRR 261

Query: 231 IQNTAVIPGVVR-KYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVL 289
            Q  A+    +   YN    +L+TI + EGF+  YKG    + ++ P   +  +V+    
Sbjct: 262 FQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELTW 321

Query: 290 DFCR 293
           D+ +
Sbjct: 322 DYMK 325

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 78/180 (43%), Gaps = 19/180 (10%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYT---------GVVDCLKKIVAG 64
           + F+GA+ G   ++  YPLD+V+TR+ +Q    +    +         GV   L K  A 
Sbjct: 126 RLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAE 185

Query: 65  E-GVGRLYKGISSPILMEAPKRATKFACNDEFQKLY-KQAFGVEKLSQPLSMLA-GASAG 121
           E G+  LY+G+    L   P  A  FA  ++ ++       G   +   L  L+ GA +G
Sbjct: 186 EGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISG 245

Query: 122 CVEAFVVVPFELVKIRLQ-------DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWR 174
            V   +  PF+L++ R Q       +    Y    D +  I   EG    Y GL + L++
Sbjct: 246 GVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFK 305

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGA--GPHYTGVVDCLKKIVAGEGVGR 69
           LY+   GA++G     + YP D+++ R Q+   GG   G HY  V D L  I   EG   
Sbjct: 235 LYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKG 294

Query: 70  LYKGISSPILMEAPKRATKF 89
            YKG+++ +    P  A  +
Sbjct: 295 YYKGLTANLFKVVPSTAVSW 314

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 88/211 (41%), Gaps = 36/211 (17%)

Query: 107 KLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSY---KGPVDVVRKIVAREGVLA 163
           K    ++ LAG  AG +   VV PFE VKI LQ  SS+    KG  D + ++   E +  
Sbjct: 20  KQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKG 79

Query: 164 MYNGLESTLWRHALWNGGYFGIIFQA---RALLPAAHNKTQCITN--DLISDSI--GCSI 216
           ++ G      R   ++   F ++F+             K + + N   L S ++  GCS+
Sbjct: 80  LFRGNGLNCIRVFPYSAVQF-VVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSV 138

Query: 217 GCMLSTPFDVV---------------KSRIQNTAVIPGVVRKYNWSLPSLLTIYREE-GF 260
             + + P D+V               KSR  + A  PGV     W L  L   Y EE G 
Sbjct: 139 --VATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGV-----WKL--LSKAYAEEGGI 189

Query: 261 RALYKGFVPKVLRLGPGGGILLVVFTGVLDF 291
             LY+G  P  L + P   +   V+  + +F
Sbjct: 190 MGLYRGVWPTSLGIVPYVALNFAVYEQLKEF 220

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 127/291 (43%), Gaps = 24/291 (8%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQ-VQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGIS 75
           AG+V+GV   +   P+D VK R QLQ VQ      Y G+   ++ I+  EG+  L+KG  
Sbjct: 24  AGSVSGVFARMATAPMDTVKIRYQLQPVQEDK---YKGIASTVRTIMKEEGLRALWKGNI 80

Query: 76  SPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQP-LSMLAGASAGCVEAFVVVPFELV 134
               M     A +F     F  ++   F   + SQ   ++  GA AG   + V  P +L+
Sbjct: 81  PATAMYVVYGAVQFGSYSWFNNVWSAKF--PRFSQQGQTLTVGALAGMTSSVVSYPLDLL 138

Query: 135 KIRLQDASSSYKGPV-DVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALL 193
           + RL    +S++  V +  R++   EGV   + G+ + +    L     F + ++   ++
Sbjct: 139 RTRLIANRTSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTLSTAIMF-LTYETVNIV 197

Query: 194 PAAHNKTQCITNDLISDSIGCSIGCMLST---PFDVVKSRIQ--------NTAVIPGVVR 242
              H K     +  +S S G   G +  T   P D ++ R+Q        +    P V  
Sbjct: 198 CENHEKE--FWSRPVSASSGIIAGFVSKTMVFPIDTLRRRMQVMNSKRTVHFTKFPAVYH 255

Query: 243 KYNW--SLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDF 291
           +Y +  S   +  I R+EG  ALY+G    + +  P   I L V+   +D 
Sbjct: 256 EYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTAISLFVYERTMDL 306

 Score = 40.4 bits (93), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 205 NDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALY 264
           N +I+ S+      M + P D VK R Q   + P    KY     ++ TI +EEG RAL+
Sbjct: 20  NSVIAGSVSGVFARMATAPMDTVKIRYQ---LQPVQEDKYKGIASTVRTIMKEEGLRALW 76

Query: 265 KGFVP 269
           KG +P
Sbjct: 77  KGNIP 81

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/190 (20%), Positives = 70/190 (36%), Gaps = 8/190 (4%)

Query: 106 EKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQ---DASSSYKGPVDVVRKIVAREGVL 162
           E +S   S++AG+ +G        P + VKIR Q        YKG    VR I+  EG+ 
Sbjct: 14  ETVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKYKGIASTVRTIMKEEGLR 73

Query: 163 AMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST 222
           A++ G       + ++    FG       +  A   +       L   ++      ++S 
Sbjct: 74  ALWKGNIPATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQGQTLTVGALAGMTSSVVSY 133

Query: 223 PFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILL 282
           P D++++R+     I                ++  EG R  + G    +  +     I+ 
Sbjct: 134 PLDLLRTRL-----IANRTSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTLSTAIMF 188

Query: 283 VVFTGVLDFC 292
           + +  V   C
Sbjct: 189 LTYETVNIVC 198

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 77.8 bits (190), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 71/269 (26%), Positives = 120/269 (44%), Gaps = 20/269 (7%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           AGA+   +    M P+DVVKTR+QL+       + +G+V   +KIV  EG   L  G   
Sbjct: 21  AGAIGCGATHSAMVPIDVVKTRIQLEPL----KYSSGMVGSFRKIVGEEGAAALLTGFGP 76

Query: 77  PILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVV---PFEL 133
            +L  + + A KF   + F+K +  A G E   Q  + +   SA   E F  +   P E 
Sbjct: 77  TLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPLEA 136

Query: 134 VKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQ--ARA 191
            +IRL    +   G V    +I+  EG+ + YNG    L++   +N   F ++F+  A A
Sbjct: 137 TRIRLVSQPTFANGLVGGFARILKEEGIGSFYNGFTPILFKQIPYNIAKF-VVFEHAANA 195

Query: 192 LLPAAHNKTQCITN-----DLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNW 246
               A +K    T      +L++         ++S P D + S++  T   PG       
Sbjct: 196 YFGLAGSKENLSTTAATGINLLAGLTAGLAAAVISQPADTLLSKVNKTKKAPG-----QS 250

Query: 247 SLPSLLTIYREEGFRALYKGFVPKVLRLG 275
           +   L+ + ++ GF   + G   +++ +G
Sbjct: 251 TFGLLMQLAKQLGFVGSFAGLPTRLVMVG 279

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 72/177 (40%), Gaps = 13/177 (7%)

Query: 115 LAGASAGCVEAFVVVPFELVKIRLQDASSSYK-GPVDVVRKIVAREGVLAMYNGLESTLW 173
           LAGA         +VP ++VK R+Q     Y  G V   RKIV  EG  A+  G   TL 
Sbjct: 20  LAGAIGCGATHSAMVPIDVVKTRIQLEPLKYSSGMVGSFRKIVGEEGAAALLTGFGPTLL 79

Query: 174 RHALWNGGYFG--IIFQARALLPAAHNKTQCITNDLI---SDSIGCSIGCMLSTPFDVVK 228
            +++     FG   +F+ +A + A   +T C     I   S +I      +   P +  +
Sbjct: 80  GYSMQGAFKFGGYEVFK-KAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPLEATR 138

Query: 229 SRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
            R+ +           N  +     I +EEG  + Y GF P + +  P      VVF
Sbjct: 139 IRLVSQPTFA------NGLVGGFARILKEEGIGSFYNGFTPILFKQIPYNIAKFVVF 189

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 77.4 bits (189), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 68/293 (23%), Positives = 123/293 (41%), Gaps = 42/293 (14%)

Query: 18  GAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPH-YTGVVDCLKKIVAGEGVGR-LYKGIS 75
           G++AG    ++ YP D VK R+Q Q     G H +     C+      EG+ +  ++GI+
Sbjct: 20  GSIAGALGKVIEYPFDTVKVRLQTQ-----GRHVFPDTWSCITYTYKNEGIIKGFFQGIA 74

Query: 76  SPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVK 135
           SP+   A + A  F   ++  K  +    V  L+  L  ++GA AG   +FV+ P EL+K
Sbjct: 75  SPLAGAAIENAALFLSYNQCSKFLQHYTNVSDLTNIL--ISGAFAGSCASFVLTPVELIK 132

Query: 136 IRLQ---------------DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNG 180
            +LQ                 +  +   +  ++ ++   G + ++ G   T  R +    
Sbjct: 133 CKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRESFGGV 192

Query: 181 GYFGIIFQARALLPAAHN-KTQCITNDLISDSI---GCSIGCMLST---PFDVVKSRIQN 233
            +F      +  L + HN +   + ND  +  +   G S G   +    P D VKS +Q 
Sbjct: 193 AWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPADTVKSMMQT 252

Query: 234 TAV-IPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
             + +   ++K          I+ E+G R  Y+G    ++R  P    +  V+
Sbjct: 253 EHLGLKTAIKK----------IFVEKGLRGFYRGLGITLIRAIPANATVFYVY 295

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 76/176 (43%), Gaps = 12/176 (6%)

Query: 114 MLAGASAGCVEAFVVVPFELVKIRLQDASSS-YKGPVDVVRKIVAREGVL-AMYNGLEST 171
           +L G+ AG +   +  PF+ VK+RLQ      +      +      EG++   + G+ S 
Sbjct: 17  ILYGSIAGALGKVIEYPFDTVKVRLQTQGRHVFPDTWSCITYTYKNEGIIKGFFQGIASP 76

Query: 172 LWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRI 231
           L   A+ N   F    Q    L    N +  +TN LIS +   S    + TP +++K ++
Sbjct: 77  LAGAAIENAALFLSYNQCSKFLQHYTNVSD-LTNILISGAFAGSCASFVLTPVELIKCKL 135

Query: 232 Q--NTAVIP-------GVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGG 278
           Q  N   +P        V  ++   +P++  + +  GF  L++G     +R   GG
Sbjct: 136 QVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRESFGG 191

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 45/95 (47%), Gaps = 11/95 (11%)

Query: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVA 63
           +D K+   L    +GA AG++    ++P D VK+ MQ +        + G+   +KKI  
Sbjct: 218 NDNKTWELLA---SGASAGLAFNASIFPADTVKSMMQTE--------HLGLKTAIKKIFV 266

Query: 64  GEGVGRLYKGISSPILMEAPKRATKFACNDEFQKL 98
            +G+   Y+G+   ++   P  AT F   +   KL
Sbjct: 267 EKGLRGFYRGLGITLIRAIPANATVFYVYETLSKL 301

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 77.8 bits (190), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 68/268 (25%), Positives = 118/268 (44%), Gaps = 18/268 (6%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           AGA+   S    M P+DVVKTR+QL+       +  G+V   K+I+AGEG G L  G   
Sbjct: 23  AGAIGCGSTHSSMVPIDVVKTRIQLEPT----VYNKGMVGSFKQIIAGEGAGALLTGFGP 78

Query: 77  PILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQ---PLSMLAGASAGCVEAFVVVPFEL 133
            +L  + + A KF   + F+K +    G +  S+    + M + A A  +    + P E 
Sbjct: 79  TLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEA 138

Query: 134 VKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARAL- 192
            +IRL        G V    +I+  EG+ + Y+G    L++   +N   F +  +A    
Sbjct: 139 TRIRLVSQPQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFERASEFY 198

Query: 193 --LPAAHNKTQCITNDLISDSIGCSIG---CMLSTPFDVVKSRIQNTAVIPGVVRKYNWS 247
                   K    +  L++   G + G    ++S P D + S++  T   PG       +
Sbjct: 199 YGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPG-----QST 253

Query: 248 LPSLLTIYREEGFRALYKGFVPKVLRLG 275
           +  L  + ++ GF   + G   +++ +G
Sbjct: 254 VGLLAQLAKQLGFFGSFAGLPTRLVMVG 281

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 7/66 (10%)

Query: 208 ISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSL-PSLLTIYREEGFRALYKG 266
           ++ +IGC        P DVVK+RIQ    +      YN  +  S   I   EG  AL  G
Sbjct: 22  LAGAIGCGSTHSSMVPIDVVKTRIQLEPTV------YNKGMVGSFKQIIAGEGAGALLTG 75

Query: 267 FVPKVL 272
           F P +L
Sbjct: 76  FGPTLL 81

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 77.4 bits (189), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 69/278 (24%), Positives = 123/278 (44%), Gaps = 28/278 (10%)

Query: 13  YQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYK 72
           Y ++ G  AG+  ++  +PLD+ K R+Q        P  T +V  L+ I+  EG+  LY 
Sbjct: 8   YPWWYGGAAGIFAVMNTHPLDLTKVRLQ----AAPIPKPT-IVQMLRSILKNEGIVGLYA 62

Query: 73  GISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPL-----SMLAGASAGCVEAFV 127
           G+S+ +L +      +F   D    L +     +KL+        SM++GA  G    F 
Sbjct: 63  GLSASLLRQCTYTTARFGMYDA---LKEHVIPRDKLTNMWYLLGASMVSGALGGLAGNFA 119

Query: 128 VVPFELVKIRLQDASS-------SYKGPVDVVRKIVAREGVLAMY-NGLESTLWRHALWN 179
               +L+ IR+Q+ S+       +YK  +D + KI   EG  +++  G +  + R  L  
Sbjct: 120 ----DLINIRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMT 175

Query: 180 GGYFGIIFQARALLPAAHN-KTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIP 238
                     +  L   +N   +  +  L S  +   +   + +P DV+K+ + N    P
Sbjct: 176 ASQVVTYDMFKNFLVTKYNMDPKKNSTHLTSSLLAGFVATTVCSPADVIKTIVMNAHKKP 235

Query: 239 GVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
           G    ++ S   L+    +EG   +++G+VP   RL P
Sbjct: 236 G--HNHDSSFKILMEAINKEGPSFMFRGWVPSFTRLAP 271

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 77.4 bits (189), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 127/283 (44%), Gaps = 16/283 (5%)

Query: 7   KSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHY---TGVVDCLKKIVA 63
           ++ P +YQ  AGA AG+ E  +M+P+D +KTRMQ     G+       + ++  + KI  
Sbjct: 13  ENAPLVYQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKIST 72

Query: 64  GEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVE--KLSQPL-SMLAGASA 120
            EG   L+KG+ S +L   P  A  FA    ++    +    E  +  QPL + L+G  A
Sbjct: 73  TEGSLALWKGVQSVVLGAGPAHAVYFAT---YEMCKSRLIDPEDRQTHQPLKTALSGTLA 129

Query: 121 GCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNG 180
                 ++ PF+ +K RLQ   S       V  ++  REG+ A +    +T+  +  +  
Sbjct: 130 TVAADALMNPFDTIKQRLQLHPSDSMTKCAV--RMYQREGIAAFFYSYPTTIAMNIPFAA 187

Query: 181 GYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQ---NTAVI 237
             F I   +  +   ++N    I    +   I  +    ++TP D VK+ +Q     +V 
Sbjct: 188 LNFVIYESSTKIFNPSNNYNPWI--HCLCGGISGATCAAITTPLDCVKTVLQIRGADSVQ 245

Query: 238 PGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGI 280
             + ++ +    +   I++  G+   ++G  P+++   P   I
Sbjct: 246 SQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATAI 288

 Score = 29.3 bits (64), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 28/65 (43%), Gaps = 2/65 (3%)

Query: 223 PFDVVKSRIQ--NTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGI 280
           P D +K+R+Q  +T       R  +  L  +  I   EG  AL+KG    VL  GP   +
Sbjct: 37  PIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALWKGVQSVVLGAGPAHAV 96

Query: 281 LLVVF 285
               +
Sbjct: 97  YFATY 101

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 77.4 bits (189), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 121/268 (45%), Gaps = 18/268 (6%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           AGA+   S    M P+DVVKTR+QL+       +  G+V   +KI+A EG G L  G   
Sbjct: 19  AGAIGCGSTHSSMVPIDVVKTRIQLEPT----VYNKGMVGSFRKIIAEEGAGALLTGFGP 74

Query: 77  PILMEAPKRATKFACNDEFQKLYKQAFGVE---KLSQPLSMLAGASAGCVEAFVVVPFEL 133
            +L  + + A KF   + F+K +    G +   +    + + + A+A  +    + P E 
Sbjct: 75  TLLGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEA 134

Query: 134 VKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQAR--- 190
            +IRL    +   G V    +I+  EGV + Y+G    L++   +N   F +  +A    
Sbjct: 135 TRIRLVSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASELY 194

Query: 191 -ALLPAAH--NKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWS 247
            +L P     ++T     +L+S         ++S P D + S++  T+  PG       +
Sbjct: 195 FSLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLSKVNKTSKAPG-----QST 249

Query: 248 LPSLLTIYREEGFRALYKGFVPKVLRLG 275
           +  L  + ++ GF   + G   +++ +G
Sbjct: 250 VGLLFQLAKQLGFVGSFAGLPTRLVMVG 277

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 73/169 (43%), Gaps = 15/169 (8%)

Query: 115 LAGASAGCVEAFV-VVPFELVKIRLQDASSSY-KGPVDVVRKIVAREGVLAMYNGLESTL 172
           LAGA  GC      +VP ++VK R+Q   + Y KG V   RKI+A EG  A+  G   TL
Sbjct: 18  LAGA-IGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFRKIIAEEGAGALLTGFGPTL 76

Query: 173 WRHALWNGGYFG--IIFQARALLPAAHNKTQCITNDLISDSIGCS--IGCMLSTPFDVVK 228
             +++     FG   +F+   +    ++      N +   S   +  +  +   P +  +
Sbjct: 77  LGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATR 136

Query: 229 SR-IQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
            R +       G+V  ++        I +EEG  + Y GF P + +  P
Sbjct: 137 IRLVSQPTFANGLVGGFSR-------ILKEEGVGSFYSGFTPILFKQIP 178

>Scas_718.24
          Length = 337

 Score = 77.0 bits (188), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 128/293 (43%), Gaps = 19/293 (6%)

Query: 3   SSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQ----VQGGAGPHYTGVVDCL 58
           S++     F   F  G V+         P++ VK  +Q Q     QG     Y G+VDC 
Sbjct: 34  STEKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDCF 93

Query: 59  KKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKL--YKQAFGVEKLSQPLSMLA 116
           ++    EG+   ++G ++ ++   P +A  FA  D+ + +  +K+  G  K     ++ +
Sbjct: 94  RRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEDGYGKWFAG-NLAS 152

Query: 117 GASAGCVEAFVVVPFELVKIRL-QDASSSYKGP-------VDVVRKIVAREGVLAMYNGL 168
           G +AG +    V   +  + RL  D+ SS KG        +DV +K +  +GV  +Y G 
Sbjct: 153 GGAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGF 212

Query: 169 ESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVK 228
             ++    ++ G YFG+    + +L     +   + + L+   +  +     S P D V+
Sbjct: 213 LPSVVGIIVYRGLYFGLYDSIKPVLLTGSLEGSFLASFLLGWVV-TTGASTCSYPLDTVR 271

Query: 229 SRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGIL 281
            ++  T+   G   KY  +      I   EG  +L+KG    +LR   G G++
Sbjct: 272 RKMMMTS---GQAVKYKGAFDCFKKIVAAEGVASLFKGCGANILRGVAGAGVI 321

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 73/183 (39%), Gaps = 28/183 (15%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQG---GAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
           +G  AG   +L +Y LD  +TR+    +    G    + G++D  KK +  +GV  LY+G
Sbjct: 152 SGGAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRG 211

Query: 74  ISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFEL 133
               ++     R   F   D  + +     G  + S   S L G       +    P + 
Sbjct: 212 FLPSVVGIIVYRGLYFGLYDSIKPVLLT--GSLEGSFLASFLLGWVVTTGASTCSYPLDT 269

Query: 134 VKIRLQDASSS---YKGPVDVVRKIVAREGV--------------------LAMYNGLES 170
           V+ ++   S     YKG  D  +KIVA EGV                    ++MY+ L+ 
Sbjct: 270 VRRKMMMTSGQAVKYKGAFDCFKKIVAAEGVASLFKGCGANILRGVAGAGVISMYDQLQM 329

Query: 171 TLW 173
            L+
Sbjct: 330 ILF 332

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 76.3 bits (186), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 117/276 (42%), Gaps = 23/276 (8%)

Query: 18  GAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGR-LYKGISS 76
           G VAG    LV YP D VK R+Q Q    +   +     C+      EG+ R  Y+G++S
Sbjct: 15  GGVAGSLGKLVEYPFDTVKVRLQTQ----SAALFPTTWSCVSHTYKQEGLWRGFYQGMAS 70

Query: 77  PILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKI 136
           P+     + A  F   +  Q + +  +    L +   + AGA AG   ++V+ P ELVK 
Sbjct: 71  PVFGAFLEHAVLFVSFNRAQAVLENCYSCGPLEK--VVFAGAIAGACTSYVLTPVELVKC 128

Query: 137 RLQDASSS------YKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQAR 190
           +LQ ++ +      Y   +  +R IV + G+  ++ G   T  R +     +F      +
Sbjct: 129 KLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAGGAVWFTAYEVLK 188

Query: 191 ALLPAAHNKTQCITNDLISDSIGCSIGCMLST-PFDVVKSRIQNTAVIPGVVRKYNWSLP 249
             L      T+    +L++   G       S  P D VKS +Q   +  G         P
Sbjct: 189 GWLARRRGSTENTVWELLASGAGAGAAFHASIFPADTVKSTMQTEHLGLG---------P 239

Query: 250 SLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
           ++ T+ ++ G    Y+G    +LR  P   ++  V+
Sbjct: 240 AVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVY 275

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 76/161 (47%), Gaps = 6/161 (3%)

Query: 16  FAGAVAGVSEILVMYPLDVVKTRMQL-QVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74
           FAGA+AG     V+ P+++VK ++Q+  + G +GP YT V+  L+ IV   G+G L++G 
Sbjct: 107 FAGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQ 166

Query: 75  SSPILMEAPKRATKFACNDEFQK-LYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFEL 133
           S   + E+   A  F   +  +  L ++    E     L      +     A  + P + 
Sbjct: 167 SGTFIRESAGGAVWFTAYEVLKGWLARRRGSTENTVWELLASGAGAGAAFHA-SIFPADT 225

Query: 134 VKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWR 174
           VK  +Q   + + G    VR ++ + G    Y G+  TL R
Sbjct: 226 VKSTMQ---TEHLGLGPAVRTVLKKHGPTGFYRGVGITLLR 263

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 80/176 (45%), Gaps = 7/176 (3%)

Query: 114 MLAGASAGCVEAFVVVPFELVKIRLQDASSS-YKGPVDVVRKIVAREGVL-AMYNGLEST 171
           +L G  AG +   V  PF+ VK+RLQ  S++ +      V     +EG+    Y G+ S 
Sbjct: 12  LLYGGVAGSLGKLVEYPFDTVKVRLQTQSAALFPTTWSCVSHTYKQEGLWRGFYQGMASP 71

Query: 172 LWRHALWNGGYFGIIFQARALLPAAHNKTQC--ITNDLISDSIGCSIGCMLSTPFDVVKS 229
           ++   L +   F    +A+A+L    N   C  +   + + +I  +    + TP ++VK 
Sbjct: 72  VFGAFLEHAVLFVSFNRAQAVL---ENCYSCGPLEKVVFAGAIAGACTSYVLTPVELVKC 128

Query: 230 RIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
           ++Q + +      +Y   LP+L  I ++ G   L++G     +R   GG +    +
Sbjct: 129 KLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAGGAVWFTAY 184

 Score = 35.8 bits (81), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 43/94 (45%), Gaps = 13/94 (13%)

Query: 205 NDLISDSIGCSIGCMLSTPFDVVKSRI--QNTAVIPGVVRKYNWSLPSLLTIYREEG-FR 261
            DL+   +  S+G ++  PFD VK R+  Q+ A+ P       WS  S    Y++EG +R
Sbjct: 10  KDLLYGGVAGSLGKLVEYPFDTVKVRLQTQSAALFP-----TTWSCVS--HTYKQEGLWR 62

Query: 262 ALYKGFVPKVLRLGPGGGILLVVFT---GVLDFC 292
             Y+G    V        +L V F     VL+ C
Sbjct: 63  GFYQGMASPVFGAFLEHAVLFVSFNRAQAVLENC 96

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 77.0 bits (188), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 81/286 (28%), Positives = 131/286 (45%), Gaps = 31/286 (10%)

Query: 28  VMYPLDVVKTRMQLQVQGGAGP-HYTGVVDCLKKIVAGEGVGR-LYKGISSPILMEAPKR 85
           VM+ LD VKTR Q    G  G   Y  ++   + +   EGV R LY G  + +L   P  
Sbjct: 70  VMHSLDTVKTRQQ----GAPGEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSA 125

Query: 86  ATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVV-VPFELVKIRLQ----- 139
           A  F     ++ + +Q     ++ +  S LA    G + + VV VP E++K RLQ     
Sbjct: 126 AVFFGT---YEWVKRQMINEWQIHETYSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCY 182

Query: 140 -----DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGII--FQARAL 192
                 +  +Y+G  D VR IV  EGV A++ G ++TL R   ++   F     F+  A 
Sbjct: 183 NNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRKWAF 242

Query: 193 LPAAH--NKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQN----TAVIPGVV--RKY 244
           L      +     T ++++ +    +  +++TP DVVK+RIQ     +A  P      + 
Sbjct: 243 LLERKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDASAPARL 302

Query: 245 NWSL-PSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVL 289
           N S+  SLL + R EG    + G  P+ +       I+L+++   L
Sbjct: 303 NGSIFRSLLVVLRYEGLGGAFSGVGPRFIWTSIQSSIMLLLYQTAL 348

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 72/146 (49%), Gaps = 14/146 (9%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQ-----VQGGAGPHYTGVVDCLKKIVAGEGVGRLY 71
           AG +  +   +V  P +V+KTR+QLQ         +G +Y G+ D ++ IV  EGV  L+
Sbjct: 154 AGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEGVSALF 213

Query: 72  KGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEK------LSQPLSMLAGASAGCVEA 125
            G  + +  + P  A +FA  + F+K    AF +E+      LS    ++ GASAG +  
Sbjct: 214 FGYKATLSRDLPFSALQFAFYERFRKW---AFLLERKPVDGHLSFTAEVVTGASAGGLAG 270

Query: 126 FVVVPFELVKIRLQDASSSYKGPVDV 151
            +  P ++VK R+Q       G  D 
Sbjct: 271 IITTPLDVVKTRIQTQPRGSAGTPDA 296

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 24/40 (60%)

Query: 9   LPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAG 48
           L F  +   GA AG    ++  PLDVVKTR+Q Q +G AG
Sbjct: 253 LSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAG 292

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 76.6 bits (187), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 67/269 (24%), Positives = 119/269 (44%), Gaps = 20/269 (7%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           AGA+   +    M P+DVVKTR+QL+       +  G++   K+I++ EG G L  G   
Sbjct: 19  AGAIGCGTTHSAMVPIDVVKTRIQLEPT----VYNKGMISSFKQIISSEGAGALLTGFGP 74

Query: 77  PILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVV---PFEL 133
            +L  + + + KF   + F+KL+    G ++     + +   SA   E F  +   P E 
Sbjct: 75  TLLGYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEA 134

Query: 134 VKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALL 193
            +IRL    +   G V    +I+  EG  + YNG    L++   +N   F ++F+  A +
Sbjct: 135 TRIRLVSQPTFANGLVGGFSRILKEEGAGSFYNGFTPILFKQIPYNIAKF-LVFERAAEV 193

Query: 194 ------PAAHNKTQCITN-DLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNW 246
                 P     T   T  +L+S         ++S P D + S++  T   PG       
Sbjct: 194 YFGMAGPKESLSTASTTGINLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPG-----QS 248

Query: 247 SLPSLLTIYREEGFRALYKGFVPKVLRLG 275
           ++  L  + ++ GF   + G   +++ +G
Sbjct: 249 TIGLLAQLAKQLGFVGSFAGLPTRLVMVG 277

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 72/168 (42%), Gaps = 13/168 (7%)

Query: 115 LAGASAGCVEAFVVVPFELVKIRLQDASSSY-KGPVDVVRKIVAREGVLAMYNGLESTLW 173
           LAGA         +VP ++VK R+Q   + Y KG +   ++I++ EG  A+  G   TL 
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLL 77

Query: 174 RHALWNGGYFG--IIFQARALLPAAHNKTQCITNDLI--SDSIGCSIGCMLSTPFDVVKS 229
            ++L     FG   +F+   +    +++     N +   S +I      +   P +  + 
Sbjct: 78  GYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRI 137

Query: 230 R-IQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
           R +       G+V  ++        I +EEG  + Y GF P + +  P
Sbjct: 138 RLVSQPTFANGLVGGFSR-------ILKEEGAGSFYNGFTPILFKQIP 178

>Scas_669.6
          Length = 373

 Score = 77.0 bits (188), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 128/298 (42%), Gaps = 44/298 (14%)

Query: 29  MYPLDVVKTRMQLQVQGGA--GPHYTGVVDCLKKIVAGEGVGR-LYKGISSPILMEAPKR 85
           M+ LD VKTR Q     GA   P Y  +    + I   EG+ R LY G  + +L   P  
Sbjct: 69  MHSLDTVKTRQQ-----GAPMTPKYKNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSA 123

Query: 86  ATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQ------ 139
           A  F   +  ++      G       LS  AG     V +FV VP E++K RLQ      
Sbjct: 124 AIFFGTYEWCKRKMIGDLGFNDTVSHLS--AGLLGDFVSSFVYVPSEVLKTRLQLQGRVN 181

Query: 140 ----DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGII--FQARALL 193
                +  +Y+     +R IV  EGV A++ G ++TL R   ++   FG    F+  A  
Sbjct: 182 NPFFQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFRQTAFK 241

Query: 194 PAAHNKTQ---CITNDLISDSIGCSIGCMLSTPFDVVKSRIQ--------NTAVIPGVV- 241
               + T+    I N++ + +I   +  +++TP DV+K+R+Q        N+A   G + 
Sbjct: 242 LEKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQADINPNSATTVGAIS 301

Query: 242 -RKYNWSLP---------SLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVL 289
            +    S P         SL  +Y+ EG    + G  P+ +       I+L+++   L
Sbjct: 302 AKTNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGPRFVWTSVQSSIMLLLYQMTL 359

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCL 58
           + F GA+AG    ++  P+DV+KTR+Q Q Q    P+    V  +
Sbjct: 257 EIFTGAIAGGLAGIITTPMDVIKTRLQTQ-QADINPNSATTVGAI 300

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 77.0 bits (188), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 86/317 (27%), Positives = 137/317 (43%), Gaps = 38/317 (11%)

Query: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPH-YTGVVDCLKKIV 62
            D +  P  + F AG V G+     M+ LD VKTR Q    G    H Y  ++   + + 
Sbjct: 46  DDYEHSPIWHCFLAGGVGGIIGDSAMHSLDTVKTRQQ----GAPNVHKYKHMLQAYRTMF 101

Query: 63  AGEGVGR-LYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSML-AGASA 120
             EG  R LY G  + +L   P  A  F+   EF K  +       L+   S L AG   
Sbjct: 102 IEEGFRRGLYGGYCAAMLGSFPSAAIFFSTY-EFTK--RTMINDYHLNDTFSHLTAGFLG 158

Query: 121 GCVEAFVVVPFELVKIRLQ----------DASSSYKGPVDVVRKIVAREGVLAMYNGLES 170
               +FV VP E++K RLQ          ++  +YK   + +  I   EGV A++ G ++
Sbjct: 159 DFFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKA 218

Query: 171 TLWRHALWNGGYFGII--FQARALL---PAAHNKTQCITNDLISDSIGCSIGCMLSTPFD 225
           TL R   ++   F     F+  A L      +     I+N++++ +    +  +L+TP D
Sbjct: 219 TLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILTTPLD 278

Query: 226 VVKSRIQ-----------NTAV--IPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVL 272
           VVK+R+Q           +T +  +   V   N    SL T+Y  EGF   + G  P+ +
Sbjct: 279 VVKTRVQTQLPSQIDISTDTKIKNVSKPVTLTNSIFKSLRTVYTSEGFFGFFSGVGPRFV 338

Query: 273 RLGPGGGILLVVFTGVL 289
                  I+L+++   L
Sbjct: 339 WTSVQSSIMLLLYQMAL 355

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 76.3 bits (186), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 66/287 (22%), Positives = 123/287 (42%), Gaps = 34/287 (11%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGR---- 69
               G V G++  +V+ P D++KTR+Q           T +   LK+I + + + R    
Sbjct: 10  HLIGGFVGGLTSAIVLQPFDLLKTRLQQNKD-------TTLWGTLKEIRSPKQLWRGALP 62

Query: 70  --LYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFV 127
             L   I S + +             + Q L   +  + +L+   ++ +GA    V  F+
Sbjct: 63  SSLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVGFI 122

Query: 128 VVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIF 187
            +P  ++K+R +    SYK   +  R I + EG+   +NG  +T+ R A + G Y  +  
Sbjct: 123 TMPITIIKVRYESTMYSYKSLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGLYVLLYE 182

Query: 188 QARALLPAA--------------HNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQN 233
           +A+ L+P                   T  + N  IS  +  S+   +++PFD +K+R+Q 
Sbjct: 183 KAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNS-ISAFMSASLATTITSPFDTIKTRMQL 241

Query: 234 TAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGI 280
                    K++    +L+ I  +E F+ L+ G   ++ R     GI
Sbjct: 242 DPT------KFSGFYKTLVLIVSKEKFKNLFDGLTLRLTRKAFSAGI 282

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/178 (20%), Positives = 73/178 (41%), Gaps = 31/178 (17%)

Query: 27  LVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRA 86
            +  P+ ++K R +  +       Y  + +  + I + EG+   + G  + ++ +AP   
Sbjct: 121 FITMPITIIKVRYESTMYS-----YKSLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAG 175

Query: 87  TKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAG-----------CVEAF--------V 127
                   +  LY++A  +  +  P S ++   AG            + AF        +
Sbjct: 176 L-------YVLLYEKAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTI 228

Query: 128 VVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGI 185
             PF+ +K R+Q   + + G    +  IV++E    +++GL   L R A   G  +GI
Sbjct: 229 TSPFDTIKTRMQLDPTKFSGFYKTLVLIVSKEKFKNLFDGLTLRLTRKAFSAGIAWGI 286

 Score = 35.0 bits (79), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 38/185 (20%), Positives = 75/185 (40%), Gaps = 27/185 (14%)

Query: 114 MLAGASAGCVEAFVVVPFELVKIRL-QDASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172
           ++ G   G   A V+ PF+L+K RL Q+  ++  G +  +R          ++ G   + 
Sbjct: 11  LIGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTLWGTLKEIR------SPKQLWRGALPSS 64

Query: 173 WRHALWNGGYFGIIFQARALLPAAHNKTQCIT------------NDLISDSIGCSIGCML 220
            R ++ +  Y   +   R  +  A  KTQ +              +L S +    +   +
Sbjct: 65  LRTSIGSALYLSTLNVFRTAM--AKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVGFI 122

Query: 221 STPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGI 280
           + P  ++K R ++T      +  Y     +   IY  EG R  + G    V+R  P  G+
Sbjct: 123 TMPITIIKVRYEST------MYSYKSLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGL 176

Query: 281 LLVVF 285
            ++++
Sbjct: 177 YVLLY 181

>Kwal_27.11626
          Length = 299

 Score = 75.9 bits (185), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 79/291 (27%), Positives = 128/291 (43%), Gaps = 34/291 (11%)

Query: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTR-MQLQVQGGAGPHYTGVVDCLKKIV 62
           S+ K    + +    A AG+ EI V +P+D V  R M    +  +      V+    +  
Sbjct: 2   SNDKKQSGIARVLGSASAGILEIGVFHPVDTVSKRLMSNHTKISSSAQLNSVIF---REH 58

Query: 63  AGEGVGR----LYKGISSPILMEAPKRATKFA--------CNDEFQKLYKQAFGVEKLSQ 110
           AGE +G+    L+ G+      +  +R  K+          N  F+  +  AFG EK  +
Sbjct: 59  AGEALGKRLFTLFPGLGYAASYKILQRVYKYGGQPFANEFLNKNFKADFDNAFG-EKTGK 117

Query: 111 PL-SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLE 169
            L S  AG+  G  E  V++P +++KI+ Q    S+KG   +  KI+  EG   +Y G  
Sbjct: 118 ALRSATAGSLIGIGE-IVLLPLDVLKIKRQTNPESFKGRGFI--KILKDEG-FGLYRGWG 173

Query: 170 STLWRHALWNGGYFG-IIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVK 228
            T  R+A  +   FG   F    +L      +   + + +S  +G S   ++S P DV+K
Sbjct: 174 WTAARNAPGSFALFGGNAFAKEYILGLKDYSSATWSQNFVSSIVGASASLIVSAPLDVIK 233

Query: 229 SRIQNTAVIPGVVRKYNWSLPSLLTI---YREEGFRALYKGFVPKVLRLGP 276
           +RIQN        R ++        +    + EG  A +KG  PK+L  GP
Sbjct: 234 TRIQN--------RHFDNPESGFRIVQNTLKNEGITAFFKGLTPKLLTTGP 276

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 4/87 (4%)

Query: 5   DTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAG 64
           D  S  +   F +  V   + ++V  PLDV+KTR+Q +        +  V + LK     
Sbjct: 202 DYSSATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRHFDNPESGFRIVQNTLKN---- 257

Query: 65  EGVGRLYKGISSPILMEAPKRATKFAC 91
           EG+   +KG++  +L   PK    FA 
Sbjct: 258 EGITAFFKGLTPKLLTTGPKLVFSFAL 284

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 75.1 bits (183), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 133/290 (45%), Gaps = 39/290 (13%)

Query: 11  FLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRL 70
           FL    +GA AG S  LV +P+D +KTR  LQ +GG                   G   +
Sbjct: 5   FLISLLSGAAAGTSTDLVFFPIDTLKTR--LQAKGG--------------FFRNGGYRGV 48

Query: 71  YKGISSPILMEAPKRATKF----ACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAF 126
           Y+G+ S ++  AP  +  F     C  E +  ++       ++  ++ +  +S G + A 
Sbjct: 49  YRGLGSAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSSMGEIAAC 108

Query: 127 VV-VPFELVKIRLQDASSSYKGPVDVVRKIVARE---GVL-AMYNGLESTLWRHALWNGG 181
           +V VP E+VK R Q  +S      + +R+I+  E   GV   +Y G  +T+ R   +   
Sbjct: 109 MVRVPAEVVKQRSQTHAS--HSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCI 166

Query: 182 YFGIIFQARALLPAAHNKTQCIT--NDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPG 239
            F + ++    + A  +++  +      +  SI   I    +TP D +K+R+        
Sbjct: 167 QFPL-YEYMKKVWAELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRL-------- 217

Query: 240 VVRKYNWSLPSLL-TIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGV 288
           ++ K +  L +L+ TIY+EEGF+  + G  P+ + +  GG I L ++  V
Sbjct: 218 MLCKKSIPLGTLVSTIYKEEGFKVFFSGVGPRTMWISAGGAIFLGIYETV 267

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/289 (24%), Positives = 119/289 (41%), Gaps = 40/289 (13%)

Query: 31  PLDVVKTRMQLQVQGGAGP---------------HYTGVVDCLKKIVAGEGVGRLYKGIS 75
           P DVVKTR+Q  V  GA                 H+   V  ++ +   EG   L+KG+ 
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 76  SPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVK 135
             ++   P R+  F      +    +     + +  +  LAGA+AG   +    P  LVK
Sbjct: 129 PNLVGVIPARSINFFTYGVTKDTASRLLNDGQEAPWIHFLAGATAGWATSTATNPIWLVK 188

Query: 136 IRLQ------DASSSYKGPVDVVRKIVAREGVLAMYNGLEST-------LWRHALWNGGY 182
            RLQ        S  YK   D ++ ++  EG+L +Y GL ++       + +  L+    
Sbjct: 189 TRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYLGSVESILQWVLYE--Q 246

Query: 183 FGIIFQARALLP----AAHNKTQCITNDLISDSIGCS-----IGCMLSTPFDVVKSRIQN 233
              I + R++      +  NKT  +         G +        +L+ P +VV++R++ 
Sbjct: 247 MKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYPHEVVRTRLRQ 306

Query: 234 TAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILL 282
                G + KY     S   I +EEGF ++Y G  P ++R  P   I+ 
Sbjct: 307 APKENGKL-KYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSIIMF 354

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 1/75 (1%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           AGA    + IL  YP +VV+TR++   +      YTG+      I+  EG   +Y G++ 
Sbjct: 283 AGAAKLFASILT-YPHEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTP 341

Query: 77  PILMEAPKRATKFAC 91
            ++   P     F  
Sbjct: 342 HLMRTVPNSIIMFGT 356

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 75.1 bits (183), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 126/286 (44%), Gaps = 11/286 (3%)

Query: 10  PFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGR 69
           P   Q  AGA AG+ E  +M+P+D +KTR  +Q  G      TG++  + KI   EG   
Sbjct: 22  PLHSQLLAGAFAGIMEHSLMFPIDALKTR--VQAAGLNKAASTGMISQISKISTMEGSMA 79

Query: 70  LYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPL-SMLAGASAGCVEAFVV 128
           L+KG+ S IL   P  A  F    EF K    +    +  QP+ + L+G  A      ++
Sbjct: 80  LWKGVQSVILGAGPAHAVYFG-TYEFCKARLISPEDMQTHQPMKTALSGTIATIAADALM 138

Query: 129 VPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQ 188
            PF+ VK RLQ  ++      +V ++I   EG  A Y    +TL  +  +    F +I++
Sbjct: 139 NPFDTVKQRLQLDTNLRVW--NVTKQIYQNEGFAAFYYSYPTTLAMNIPFAAFNF-MIYE 195

Query: 189 ARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQ---NTAVIPGVVRKYN 245
           + +      N    + + L     G +    L+TP D +K+ +Q   +  V   +++  N
Sbjct: 196 SASKFFNPQNSYNPLIHCLCGGISGATCAA-LTTPLDCIKTVLQVRGSETVSIEIMKDAN 254

Query: 246 WSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDF 291
               +   I    G++  ++G  P+++   P   I    +     F
Sbjct: 255 TFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYECAKHF 300

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 74.7 bits (182), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 119/286 (41%), Gaps = 37/286 (12%)

Query: 18  GAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGR-LYKGISS 76
           G++AG    ++ +P D VK R+Q Q    A   +     C+K     EG+ R  ++GI+S
Sbjct: 20  GSIAGACGKVIEFPFDTVKVRLQTQ----ASNVFPTTWSCIKFTYQNEGIARGFFQGIAS 75

Query: 77  PILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKI 136
           P++    + AT F   ++  K  ++   V  L Q L  ++G  AG   + V+ P ELVK 
Sbjct: 76  PLVGACLENATLFVSYNQCSKFLEKHTNVFPLGQIL--ISGGVAGSCASLVLTPVELVKC 133

Query: 137 RLQ-------DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQA 189
           +LQ        A + +   +  ++ I+   G+  ++ G   T  R +     +F      
Sbjct: 134 KLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVAWFATYEIV 193

Query: 190 RALLPAAHN------KTQCITNDLISDSIGCSIGCMLST---PFDVVKSRIQNTAV-IPG 239
           +  L   H+          I   LIS   G S G   +    P D VKS +Q   + +  
Sbjct: 194 KKSLKDRHSLDDPKRDESKIWELLIS---GGSAGLAFNASIFPADTVKSVMQTEHISLTN 250

Query: 240 VVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
            V+K          I+ + G +  Y+G    + R  P    +  +F
Sbjct: 251 AVKK----------IFGKFGLKGFYRGLGITLFRAVPANAAVFYIF 286

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 85/195 (43%), Gaps = 12/195 (6%)

Query: 6   TKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQ---LQVQGGAGPHYTGVVDCLKKIV 62
           T   P      +G VAG    LV+ P+++VK ++Q   LQV      H T V+  +K I+
Sbjct: 102 TNVFPLGQILISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKH-TKVLPTIKAII 160

Query: 63  AGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLS-----MLAG 117
              G+  L++G S   + E+      FA  +  +K  K    ++   +  S     +++G
Sbjct: 161 TERGLAGLWQGQSGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISG 220

Query: 118 ASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHAL 177
            SAG      + P + VK  +Q    S     + V+KI  + G+   Y GL  TL+R   
Sbjct: 221 GSAGLAFNASIFPADTVKSVMQTEHISL---TNAVKKIFGKFGLKGFYRGLGITLFRAVP 277

Query: 178 WNGGYFGIIFQARAL 192
            N   F I     AL
Sbjct: 278 ANAAVFYIFETLSAL 292

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 73/170 (42%), Gaps = 4/170 (2%)

Query: 112 LSMLAGASAGCVEAFVVVPFELVKIRLQ-DASSSYKGPVDVVRKIVAREGVL-AMYNGLE 169
           L ++ G+ AG     +  PF+ VK+RLQ  AS+ +      ++     EG+    + G+ 
Sbjct: 15  LDIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTWSCIKFTYQNEGIARGFFQGIA 74

Query: 170 STLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKS 229
           S L    L N   F    Q    L   H     +   LIS  +  S   ++ TP ++VK 
Sbjct: 75  SPLVGACLENATLFVSYNQCSKFLE-KHTNVFPLGQILISGGVAGSCASLVLTPVELVKC 133

Query: 230 RIQNTAV-IPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGG 278
           ++Q   + +     K+   LP++  I  E G   L++G     +R   GG
Sbjct: 134 KLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGG 183

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 71/256 (27%), Positives = 112/256 (43%), Gaps = 25/256 (9%)

Query: 51  YTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQ 110
           + G ++   KI + EG+  L++GIS  +LM  P     F+  +  + +   A     L+ 
Sbjct: 102 FNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIRDVSPIASTYPTLN- 160

Query: 111 PLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGP---------VDVVRKIVAREG- 160
           PL    GA A    A  + P ELVK +LQ    S K           ++  R+ +   G 
Sbjct: 161 PL--FCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVGP 218

Query: 161 VLAMYNGLESTLWRHALWNGGYFGI--IFQARALLPAAHNKTQ-----CITNDLISDSIG 213
             A++ GLE TLWR   ++  Y+    + + R  L +    ++        N   S  I 
Sbjct: 219 SRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFINSFASGCIS 278

Query: 214 CSIGCMLSTPFDVVKSRIQ----NTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVP 269
             I  + + PFDV K+R Q    N +   G  R  N     L TI+R EG  ALY G   
Sbjct: 279 GMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRN-MFKFLETIWRTEGLAALYTGLAA 337

Query: 270 KVLRLGPGGGILLVVF 285
           +V+++ P   I++  +
Sbjct: 338 RVIKIRPSCAIMISSY 353

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 53/113 (46%), Gaps = 9/113 (7%)

Query: 2   SSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGP----HYTGVVDC 57
           +S D   + F+  F +G ++G+   +  +P DV KTR Q+ +   + P        +   
Sbjct: 259 ASKDANWVHFINSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKF 318

Query: 58  LKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQ 110
           L+ I   EG+  LY G+++ ++   P  A   +  +    + K+ FG  KL Q
Sbjct: 319 LETIWRTEGLAALYTGLAARVIKIRPSCAIMISSYE----ISKKVFG-NKLHQ 366

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 75/182 (41%), Gaps = 26/182 (14%)

Query: 10  PFLYQFFAGAVAGVSEILVMYPLDVVKTRMQ-LQVQGGAGPHYTGVVDCLKKI---VAGE 65
           P L   F GA+A V     + PL++VKT++Q +     +   +  V D L +    +   
Sbjct: 157 PTLNPLFCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMV 216

Query: 66  GVGR-LYKGISSPILMEAPKRATKFA----CN-----DEFQKLYKQAFGVEKLSQPLSML 115
           G  R L+KG+   +  + P  A  ++    C      D  +   K A  V  ++   S  
Sbjct: 217 GPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFIN---SFA 273

Query: 116 AGASAGCVEAFVVVPFELVKIRLQDASSSYKGP---------VDVVRKIVAREGVLAMYN 166
           +G  +G + A    PF++ K R Q +  +   P            +  I   EG+ A+Y 
Sbjct: 274 SGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGLAALYT 333

Query: 167 GL 168
           GL
Sbjct: 334 GL 335

 Score = 34.7 bits (78), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 62/288 (21%), Positives = 107/288 (37%), Gaps = 57/288 (19%)

Query: 1   MSSSDT-KSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLK 59
           MS  +T  SL    +  +     V   L++ P+DVV+ R+Q Q           + DC  
Sbjct: 1   MSDRNTSNSLTLKERMLSAGAGSVLTSLILTPMDVVRIRLQQQQM---------IPDC-- 49

Query: 60  KIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGAS 119
              + +G   +   +SS   M+             F  +  Q     K+           
Sbjct: 50  ---SCDGAAEVPNAVSSGSKMKT------------FTNVGGQNLNNAKIFW--------E 86

Query: 120 AGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWN 179
           + C +          ++  +++S  + G ++   KI + EG+ +++ G+  TL      N
Sbjct: 87  SACFQ----------ELHCKNSSLKFNGTLEAFTKIASVEGITSLWRGISLTLLMAIPAN 136

Query: 180 GGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPG 239
             YF      R + P A   T    N L   +I          P ++VK+++Q+   IP 
Sbjct: 137 MVYFSGYEYIRDVSPIA--STYPTLNPLFCGAIARVFAATSIAPLELVKTKLQS---IPR 191

Query: 240 VVRKY-NWSL-PSLLTIYREE-----GFRALYKGFVPKVLRLGPGGGI 280
             +    W +   LL   R+E       RAL+KG    + R  P   I
Sbjct: 192 SSKSTKTWMMVKDLLNETRQEMKMVGPSRALFKGLEITLWRDVPFSAI 239

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 74/321 (23%), Positives = 132/321 (41%), Gaps = 43/321 (13%)

Query: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPH---YTGVVDCLKK 60
           SD    P  +   +G + G      M+ LD VKTR Q        P+   Y  ++   + 
Sbjct: 46  SDEDLSPIWHCVVSGGIGGKIGDSAMHSLDTVKTRQQ------GAPNVKKYRNMISAYRT 99

Query: 61  IVAGEGVGR-LYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGAS 119
           I   EGV R LY G  + +L   P  A  F   +  ++   + + +      LS  AG  
Sbjct: 100 IWLEEGVRRGLYGGYMAAMLGSFPSAAIFFGTYEYTKRTMIEDWQINDTITHLS--AGFL 157

Query: 120 AGCVEAFVVVPFELVKIRLQ----------DASSSYKGPVDVVRKIVAREGVLAMYNGLE 169
              + +FV VP E++K RLQ           +  +Y    + ++ ++  EG  +++ G +
Sbjct: 158 GDFISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYK 217

Query: 170 STLWRHALWNGGYFGIIFQARALLPAAHNKTQ-----CITNDLISDSIGCSIGCMLSTPF 224
           +TL R   ++   F    + R L      K        I N++++ +    +  +++TP 
Sbjct: 218 ATLARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAGIITTPM 277

Query: 225 DVVKSRIQNTAVIPGVVRKYNWSLP----------------SLLTIYREEGFRALYKGFV 268
           DVVK+R+Q         + Y+ + P                SL T+Y+ EG    + G  
Sbjct: 278 DVVKTRVQTQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSGVG 337

Query: 269 PKVLRLGPGGGILLVVFTGVL 289
           P+ +       I+L+++   L
Sbjct: 338 PRFVWTSVQSSIMLLLYQMTL 358

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 74.3 bits (181), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 126/297 (42%), Gaps = 23/297 (7%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74
           F AG +AG     V+ P + VK  + LQVQ     +  G+V  ++++   EG   L++G 
Sbjct: 26  FLAGGLAGAVSRTVVSPFERVK--ILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGN 83

Query: 75  SSPILMEAPKRATKF----ACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVP 130
               +   P  A +F    AC   F  +   + G E+L     + +GA  G        P
Sbjct: 84  GLNCIRIFPYSAVQFVVYEACKKHFFHV-DGSKGREQLQNWQRLFSGALCGGCSVLATYP 142

Query: 131 FELVKIRL--QDAS------------SSYKGPVDVVRKIVAREG-VLAMYNGLESTLWRH 175
            +LV+ RL  Q A+            S   G  D++ +    EG +  +Y G+  T    
Sbjct: 143 LDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGV 202

Query: 176 ALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTA 235
             +    F +  Q +  +P   + T      L   ++   +   ++ PFD+++ R Q  A
Sbjct: 203 VPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLA 262

Query: 236 VIPGVVR-KYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDF 291
           +    +  +Y   + +L+TI + EGFR  YKG    + ++ P   +  +V+  V D 
Sbjct: 263 MGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDL 319

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 80/178 (44%), Gaps = 18/178 (10%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQG-----GAGPHYT----GVVDCLKKIVAG 64
           + F+GA+ G   +L  YPLD+V+TR+ +Q         +  H      GV D L +    
Sbjct: 125 RLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKE 184

Query: 65  E-GVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCV 123
           E G+  LY+G+    L   P  A  FA  ++F++   +      L+    +  GA +G V
Sbjct: 185 EGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTD-NTLANFYKLSIGALSGGV 243

Query: 124 EAFVVVPFELVKIRLQ-------DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWR 174
              V  PF+L++ R Q       +    YK  +D +  I   EG    Y GL + L++
Sbjct: 244 AQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFK 301

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 99/204 (48%), Gaps = 22/204 (10%)

Query: 107 KLSQPLSMLAGASAGCVEAFVVVPFELVKI--RLQDASSSY-KGPVDVVRKIVAREGVLA 163
           K    ++ LAG  AG V   VV PFE VKI  ++Q+++++Y +G V  VR++   EG   
Sbjct: 19  KNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPG 78

Query: 164 MYNGLESTLWRHALWNGGYFGIIFQA--RALLPAAHNKTQCITND---LISDSI--GCSI 216
           ++ G      R   ++   F ++++A  +       +K +    +   L S ++  GCS+
Sbjct: 79  LFRGNGLNCIRIFPYSAVQF-VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSV 137

Query: 217 GCMLSTPFDVVKSRIQ-NTAVIPGV--VRKYNWSLPS-----LLTIYREE-GFRALYKGF 267
             + + P D+V++R+   TA +  +   R +N S P      L   Y+EE G + LY+G 
Sbjct: 138 --LATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGV 195

Query: 268 VPKVLRLGPGGGILLVVFTGVLDF 291
            P  L + P   +   V+    +F
Sbjct: 196 WPTSLGVVPYVALNFAVYEQFKEF 219

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 2/91 (2%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGA--GPHYTGVVDCL 58
           M      +L   Y+   GA++G     V YP D+++ R Q+   GG   G  Y  V+D L
Sbjct: 220 MPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDAL 279

Query: 59  KKIVAGEGVGRLYKGISSPILMEAPKRATKF 89
             I   EG    YKG+++ +    P  A  +
Sbjct: 280 ITIGKTEGFRGYYKGLTANLFKVIPSTAVSW 310

>Kwal_27.12081
          Length = 369

 Score = 74.3 bits (181), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 69/296 (23%), Positives = 127/296 (42%), Gaps = 47/296 (15%)

Query: 27  LVMYPLDVVKTRMQL----------------QVQGGAGPHYTGVVDCLKKIVAGEGVGRL 70
           +V  P DVVKTR+Q                  V      H+      +  +   EG   L
Sbjct: 68  IVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSL 127

Query: 71  YKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVP 130
           +KG+   ++   P R+  F      +++Y +AF   + +  + +++ A+AG   +    P
Sbjct: 128 FKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEAPWIHLISAATAGWATSTATNP 187

Query: 131 FELVKIRLQ----DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGII 186
             L+K RLQ      +  YK   D ++ I+ +EG   +Y GL ++      + G   GI+
Sbjct: 188 IWLIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGLSAS------YLGSVEGIL 241

Query: 187 -----------FQARALLPAAH-NKTQCITNDLI------SDSIGCS--IGCMLSTPFDV 226
                       + R++    H ++ +  T++ I      S S G +  +  +++ P +V
Sbjct: 242 QWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAGLAKFLASIVTYPHEV 301

Query: 227 VKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILL 282
           V++R++  A +     KY   + S   I +EEG  ++Y G  P +LR  P   I+ 
Sbjct: 302 VRTRLRQ-APLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHLLRTVPNSIIMF 356

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 3/74 (4%)

Query: 21  AGVSEIL---VMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSP 77
           AG+++ L   V YP +VV+TR++          YTG++   + I+  EG+  +Y G++  
Sbjct: 285 AGLAKFLASIVTYPHEVVRTRLRQAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPH 344

Query: 78  ILMEAPKRATKFAC 91
           +L   P     F  
Sbjct: 345 LLRTVPNSIIMFGT 358

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 41/82 (50%), Gaps = 15/82 (18%)

Query: 219 MLSTPFDVVKSRIQN---------------TAVIPGVVRKYNWSLPSLLTIYREEGFRAL 263
           +++ PFDVVK+R+Q+               + V+   +R +  +   +  +Y+ EGFR+L
Sbjct: 68  IVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSL 127

Query: 264 YKGFVPKVLRLGPGGGILLVVF 285
           +KG  P ++ + P   I    +
Sbjct: 128 FKGLGPNLVGVIPARSINFFTY 149

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 73.9 bits (180), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 65/272 (23%), Positives = 123/272 (45%), Gaps = 22/272 (8%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74
             AGAV+G+    +  P+D +K R+QL    G  P  + V++  + ++  EG+   +KG 
Sbjct: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79

Query: 75  SSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELV 134
               L+     + +F+    F + Y   FG+E  ++  S++ GA AG   + V  PF+++
Sbjct: 80  IPGSLLYVTYGSAQFSSYSLFNR-YLTPFGLE--ARLHSLVVGAFAGITSSIVSYPFDVL 136

Query: 135 KIRLQDASSSYKGPVD-VVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARAL- 192
           + RL   +  +   +   VR I   EG+   + G  +++    L     FG     R   
Sbjct: 137 RTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYC 196

Query: 193 -----LPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQ-----------NTAV 236
                  AAH K +  T +  + +IG  I  +++ P + ++ R+Q             + 
Sbjct: 197 DENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSS 256

Query: 237 IPGVVRKYNWSLPSLLTIYREEGFRALYKGFV 268
           + G  + Y ++    L I ++EG  +LY+G +
Sbjct: 257 VYGSYKGYGFARIG-LQILKQEGVSSLYRGIL 287

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 78/181 (43%), Gaps = 31/181 (17%)

Query: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLY 71
           L+    GA AG++  +V YP DV++TR+    Q     H   +   ++ I   EG+   +
Sbjct: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQ----MHSMSITREVRDIWKLEGLPGFF 168

Query: 72  KGISSPI--------LMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCV 123
           KG  + +        +M       +  C DE +K    A    +L+  L+  AG   G +
Sbjct: 169 KGSIASMTTITLTASIMFGTYETIRIYC-DENEKT-TAAHKKWELA-TLNHSAGTIGGVI 225

Query: 124 EAFVVVPFELVKIRLQDASS--------------SYKGP--VDVVRKIVAREGVLAMYNG 167
              +  P E ++ R+Q  +S              SYKG     +  +I+ +EGV ++Y G
Sbjct: 226 AKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRG 285

Query: 168 L 168
           +
Sbjct: 286 I 286

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/188 (19%), Positives = 80/188 (42%), Gaps = 18/188 (9%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGP-----VDVVRKIVAREGVLAMYNG 167
           ++LAGA +G +   +  P + +KIRLQ   ++   P     ++V R ++  EG+ + + G
Sbjct: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78

Query: 168 -LESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDV 226
            +  +L      +  +       R L P      +   + L+  +       ++S PFDV
Sbjct: 79  NIPGSLLYVTYGSAQFSSYSLFNRYLTPFG---LEARLHSLVVGAFAGITSSIVSYPFDV 135

Query: 227 VKSRI--QNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVV 284
           +++R+   N      + R+       +  I++ EG    +KG +  +  +     I+   
Sbjct: 136 LRTRLVANNQMHSMSITRE-------VRDIWKLEGLPGFFKGSIASMTTITLTASIMFGT 188

Query: 285 FTGVLDFC 292
           +  +  +C
Sbjct: 189 YETIRIYC 196

>Scas_673.17
          Length = 314

 Score = 73.9 bits (180), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 103/232 (44%), Gaps = 13/232 (5%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           AGA+   +    + P+DVVKTR+QL+       +  G+V   KKI+A EG G L  G   
Sbjct: 26  AGAIGCGTTHSSLVPVDVVKTRIQLEPT----VYNKGMVGSFKKIIADEGAGALLTGFGP 81

Query: 77  PILMEAPKRATKFACNDEFQKLYKQAFGVEK---LSQPLSMLAGASAGCVEAFVVVPFEL 133
            +L  + + A KF   + F+KL     G E        + M + A A  +    + P E 
Sbjct: 82  TLLGYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEA 141

Query: 134 VKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARAL- 192
            +IRL    +   G V    +I+  EGV + Y+G    L++   +N   F +  +A  + 
Sbjct: 142 TRIRLVSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASEVY 201

Query: 193 --LPAAHNKTQCITNDLISDSIGCSIG---CMLSTPFDVVKSRIQNTAVIPG 239
             +  A      +TN  I+   G + G     +S P D + S++  T   PG
Sbjct: 202 YGIVGAKETLSDMTNTGINLLSGLTAGFAAAFVSQPADTLLSKVNKTKKAPG 253

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 70/167 (41%), Gaps = 11/167 (6%)

Query: 115 LAGASAGCVEAFVVVPFELVKIRLQDASSSY-KGPVDVVRKIVAREGVLAMYNGLESTLW 173
           LAGA         +VP ++VK R+Q   + Y KG V   +KI+A EG  A+  G   TL 
Sbjct: 25  LAGAIGCGTTHSSLVPVDVVKTRIQLEPTVYNKGMVGSFKKIIADEGAGALLTGFGPTLL 84

Query: 174 RHALWNGGYFG--IIFQARALLPAAHNKTQCITNDLI--SDSIGCSIGCMLSTPFDVVKS 229
            +++     FG   +F+  ++    +       N +   S ++   +  +   P +  + 
Sbjct: 85  GYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRI 144

Query: 230 RIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
           R+ +           N  +     I +EEG  + Y GF P + +  P
Sbjct: 145 RLVSQPTFA------NGLVGGFSRILKEEGVGSFYSGFTPILFKQIP 185

>Scas_721.129
          Length = 323

 Score = 73.6 bits (179), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 71/289 (24%), Positives = 124/289 (42%), Gaps = 44/289 (15%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPH--YTGVVDCLKKIVAGEGVGRLYK 72
           F AG +A    +    P+++VK RMQLQ +  A     Y   +  +  I   EG+  L K
Sbjct: 25  FIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIRGLQK 84

Query: 73  GISSPILMEAPKRATKF--------ACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVE 124
           G+ +  + +     ++         A N  F    +++  ++K+S  +++ AGAS+G + 
Sbjct: 85  GLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYP-NEESHKIQKVS--INVAAGASSGIIG 141

Query: 125 AFVVVPFELVKIRLQDAS--------SSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHA 176
           A +  P  LVK R+Q  S        + Y+   + +  I   EG   ++ G+++ + R  
Sbjct: 142 AVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAILRTG 201

Query: 177 LWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGC---------MLSTPFDVV 227
             +     I   A+  L         + NDL+ D  G  +           ++  P+DV+
Sbjct: 202 AGSSVQLPIYNTAKNFL---------LKNDLMKDGPGLHLTASTISGLGVAVVMNPWDVI 252

Query: 228 KSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
            +RI N          Y   +   +   R EG  ALYKGF  ++LR+ P
Sbjct: 253 LTRIYNQKG-----NLYKGPVDCFVKTVRTEGISALYKGFQAQILRIAP 296

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 93/211 (44%), Gaps = 15/211 (7%)

Query: 96  QKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQ-------DASSSYKGP 148
           QK   +    +K+S+  S +AG  A C+      P ELVKIR+Q            Y+ P
Sbjct: 7   QKKEIEKTAAQKVSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNP 66

Query: 149 VDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAA------HNKTQC 202
           +  +  I   EG+  +  GL +        NG   G     R  L +        +K Q 
Sbjct: 67  IQGMGVIFRNEGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQK 126

Query: 203 ITNDLISDSIGCSIGCMLSTPFDVVKSRIQN--TAVIPGVVRKYNWSLPSLLTIYREEGF 260
           ++ ++ + +    IG ++ +P  +VK+R+Q+   A+  G    Y      L TI R EGF
Sbjct: 127 VSINVAAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGF 186

Query: 261 RALYKGFVPKVLRLGPGGGILLVVFTGVLDF 291
           + L++G    +LR G G  + L ++    +F
Sbjct: 187 KGLFRGIDAAILRTGAGSSVQLPIYNTAKNF 217

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 43/90 (47%), Gaps = 7/90 (7%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           A  ++G+   +VM P DV+ TR+  Q     G  Y G VDC  K V  EG+  LYKG  +
Sbjct: 234 ASTISGLGVAVVMNPWDVILTRIYNQ----KGNLYKGPVDCFVKTVRTEGISALYKGFQA 289

Query: 77  PILMEAPKRATKFACNDEFQKLYKQAFGVE 106
            IL  AP       C    ++  K  + VE
Sbjct: 290 QILRIAPH---TIICLTFMEQTMKLVYSVE 316

>Scas_721.27
          Length = 374

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/303 (22%), Positives = 126/303 (41%), Gaps = 54/303 (17%)

Query: 27  LVMYPLDVVKTRMQLQVQGG-----------------------AGPHYTGVVDCLKKIVA 63
           +V  P D+VKTR+Q  +                          AG H+      L  +  
Sbjct: 68  VVTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYK 127

Query: 64  GEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCV 123
            EG   L+KG+   ++   P R+  F      +++Y +AF   + +  + +++ A+AG  
Sbjct: 128 REGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNGQETPLIHLMSAATAGWA 187

Query: 124 EAFVVVPFELVKIRLQ----DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWN 179
            +    P  ++K R+Q      +  YK   D ++ ++  EG+  +Y GL ++      + 
Sbjct: 188 TSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRGLSAS------YL 241

Query: 180 GGYFGII-----------FQARALLPAAHNK--TQCITNDLI-----SDSIGCS--IGCM 219
           G   GI+            + R++    H    T+  T  +      S S G +  I  +
Sbjct: 242 GSIEGILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKFIASI 301

Query: 220 LSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGG 279
           ++ P +VV++R++   +  G   KY   + S   I +EEG  ++Y G  P ++R  P   
Sbjct: 302 VTYPHEVVRTRLRQMPMENGKP-KYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSI 360

Query: 280 ILL 282
           I+ 
Sbjct: 361 IMF 363

 Score = 62.0 bits (149), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 83/182 (45%), Gaps = 21/182 (11%)

Query: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLY 71
           L    + A AG +      P+ ++KTR+QL  + G    Y    DCLK ++  EG+  LY
Sbjct: 175 LIHLMSAATAGWATSTATNPIWMIKTRVQLD-KAGTTRKYKNSWDCLKTVLKSEGIYGLY 233

Query: 72  KGISSPILMEAPKRATKFACNDEFQKLYKQ----AFG---------VEKLSQPLSMLAGA 118
           +G+S+  L  + +   ++   ++ + L KQ     FG          EK+ +       A
Sbjct: 234 RGLSASYL-GSIEGILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSA 292

Query: 119 S-AGCVEAFVVVPFELVKIRL-----QDASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172
             A  + + V  P E+V+ RL     ++    Y G V   R I+  EG+ +MY+GL   L
Sbjct: 293 GVAKFIASIVTYPHEVVRTRLRQMPMENGKPKYTGLVQSFRVIIKEEGLASMYSGLTPHL 352

Query: 173 WR 174
            R
Sbjct: 353 MR 354

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 21  AGVSEIL---VMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSP 77
           AGV++ +   V YP +VV+TR++        P YTG+V   + I+  EG+  +Y G++  
Sbjct: 292 AGVAKFIASIVTYPHEVVRTRLRQMPMENGKPKYTGLVQSFRVIIKEEGLASMYSGLTPH 351

Query: 78  ILMEAPKRATKFAC 91
           ++   P     F  
Sbjct: 352 LMRTVPNSIIMFGT 365

>Kwal_23.4731
          Length = 314

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 80/307 (26%), Positives = 128/307 (41%), Gaps = 36/307 (11%)

Query: 10  PFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIV----AGE 65
           P   +  AG  AG    +  +PLD+VK R+QL V      H  G  + +K I+    A  
Sbjct: 12  PLQREIIAGLAAGTLTTIATHPLDLVKLRLQLLVN---TTHSHGYKEVIKTIIRDSKADS 68

Query: 66  GVGR-LYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQP------------- 111
            V R  Y+G+   ++  +      F     F K     +GV ++  P             
Sbjct: 69  NVFREAYRGLGVNLIGNSIAWGLYFGLY-RFTKDMVYRYGVAQMKTPTQSSFQKDKAMGP 127

Query: 112 -LSMLAGASAGCVEAFVVVPFELVKIRLQDASSS----YKGPVDVVRKIVAREGVLAMYN 166
            L + + A +G   A +  P  ++K R+   SS     YK   D +RK+ A EG    + 
Sbjct: 128 SLYLASAALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGFWR 187

Query: 167 GLESTLWRHALWNGG-YFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST--- 222
           GL  +L+  A   G  YF I    R    A    T+      + +    S+  MLS    
Sbjct: 188 GLVPSLFGVA--QGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVTAV 245

Query: 223 -PFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGIL 281
            PF ++KS +Q+ A +        W+L  + +I+++EG + LYKG    +LR  P   I 
Sbjct: 246 YPFQLLKSNLQSFAAVEKRDSYRFWNL--VKSIHQKEGLQGLYKGLSANLLRAIPSTCIT 303

Query: 282 LVVFTGV 288
             ++  +
Sbjct: 304 FCIYENL 310

>Scas_558.2
          Length = 289

 Score = 72.4 bits (176), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 120/291 (41%), Gaps = 41/291 (14%)

Query: 11  FLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRL 70
           F+    +GA AG S  LV +P+D +KTR  LQ +GG                   G   +
Sbjct: 6   FVMSLLSGAAAGTSTDLVFFPIDTLKTR--LQAKGG--------------FFQNGGYHGI 49

Query: 71  YKGISSPILMEAPKRATKFACNDEFQKLYK----QAFGVEKLSQPLS------MLAGASA 120
           Y+G+ S ++  AP  +  F   D  +   +    +         P S      M+A +  
Sbjct: 50  YRGLGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMG 109

Query: 121 GCVEAFVVVPFELVKIRLQ-DASSSYKGPVDVVRKIVAREGVL-AMYNGLESTLWRHALW 178
                 V VP E++K R Q  +++S       + K   +EG++  +Y G  +T+ R   +
Sbjct: 110 ELAACLVRVPAEVIKQRTQVHSTNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMREIPF 169

Query: 179 NGGYFGIIFQARALLPAAHNKTQCIT--NDLISDSIGCSIGCMLSTPFDVVKSRIQ-NTA 235
               F +    +       N+   +      I  SI   I    +TP D +K+R+  N  
Sbjct: 170 TCIQFPLYEFMKKEWALYDNEVGHLKPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNKD 229

Query: 236 VIPGVVRKYNWSLPSLL-TIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
            IP         + SL+  IY+EEGF+  + G  P+ + +  GG I L V+
Sbjct: 230 SIP---------IKSLIRNIYKEEGFKIFFSGIYPRTMWISAGGAIFLGVY 271

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 72.0 bits (175), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 130/288 (45%), Gaps = 35/288 (12%)

Query: 11  FLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRL 70
           FL    +GA AG S  +V +P+D +KTR  LQ +GG                   G   +
Sbjct: 5   FLASLVSGAAAGTSTDVVFFPIDTLKTR--LQAKGG--------------FFHNGGYRGI 48

Query: 71  YKGISSPILMEAPKRATKFACNDEFQKLYKQAFG----VEKLSQPLSMLAGASAGCVEA- 125
           Y+G+ S ++  AP  +  F   D  ++  +   G     E+L++ L+ +  +S G + A 
Sbjct: 49  YRGLGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSAC 108

Query: 126 FVVVPFELVKIRLQ--DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYF 183
            V VP E++K R Q    +SS +    ++R       V  +Y G  +T+ R   +    F
Sbjct: 109 LVRVPAEVIKQRTQTHHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQF 168

Query: 184 GIIFQARALLPAAHNKTQCIT--NDLISDSIGCSIGCMLSTPFDVVKSRIQ-NTAVIPGV 240
            + ++      AA+ + + ++     +  S+   I    +TP DV+K+R+  +   +P  
Sbjct: 169 PL-YEYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERRVP-- 225

Query: 241 VRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGV 288
                  L    T++REEG R  ++G  P+ + +  GG I L V+  V
Sbjct: 226 ------MLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFLGVYEAV 267

>Kwal_33.15597
          Length = 305

 Score = 72.0 bits (175), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/269 (24%), Positives = 118/269 (43%), Gaps = 20/269 (7%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           AGA+   +    M P+DVVKTR+QL+       +  G++   K+I++ EG G L  G   
Sbjct: 19  AGAIGCGTTHSAMVPIDVVKTRIQLEPT----VYNKGMISSFKQIISSEGAGALLTGFGP 74

Query: 77  PILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVV---PFEL 133
            +L  + + + KF   + F+KL+    G ++     + +   SA   E F  +   P E 
Sbjct: 75  TLLGYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEA 134

Query: 134 VKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQ--ARA 191
            +IRL    +   G V    +I+  EG+ + YNG    L++   +N   F ++F+  A  
Sbjct: 135 TRIRLVSQPTFANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYNIAKF-LVFERAAEV 193

Query: 192 LLPAAHNK-----TQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNW 246
               A  K     +     +L+S         ++S P D + S++      PG       
Sbjct: 194 YFGMAGPKETLSTSTTTGLNLLSGLTAGLAAAIVSQPADTLLSKVNKAKKAPG-----QS 248

Query: 247 SLPSLLTIYREEGFRALYKGFVPKVLRLG 275
           ++  L  + +E GF   + G   +++ +G
Sbjct: 249 TIGLLGQLAKELGFVGSFAGLPTRLVMVG 277

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 72/168 (42%), Gaps = 13/168 (7%)

Query: 115 LAGASAGCVEAFVVVPFELVKIRLQDASSSY-KGPVDVVRKIVAREGVLAMYNGLESTLW 173
           LAGA         +VP ++VK R+Q   + Y KG +   ++I++ EG  A+  G   TL 
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLL 77

Query: 174 RHALWNGGYFG--IIFQARALLPAAHNKTQCITNDLI--SDSIGCSIGCMLSTPFDVVKS 229
            ++L     FG   +F+   +    +++     N +   S +I      +   P +  + 
Sbjct: 78  GYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRI 137

Query: 230 R-IQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
           R +       G+V  ++        I +EEG  + Y GF P + +  P
Sbjct: 138 RLVSQPTFANGLVGGFSR-------ILKEEGLSSFYNGFTPILFKQIP 178

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 72.0 bits (175), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 128/304 (42%), Gaps = 55/304 (18%)

Query: 27  LVMYPLDVVKTRMQLQVQGG------------------------AGPHYTGVVDCLKKIV 62
           +V  P D+VKTR+Q  +                           A  H+   V  +  + 
Sbjct: 72  VVTCPFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVY 131

Query: 63  AGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGC 122
             EG   L+KG+   ++   P R+  F      + +Y +AF   + +  + ++A A+AG 
Sbjct: 132 RQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNNGQEAPWIHLMAAATAGW 191

Query: 123 VEAFVVVPFELVKIRLQ----DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALW 178
             A    P  +VK R+Q      + +YK   D ++ I+  EG+  +Y GL ++      +
Sbjct: 192 ATATATNPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSAS------Y 245

Query: 179 NGGYFGII-----FQARALLP-------AAHNKTQCITNDLISDSIGCS--------IGC 218
            G   GI+      Q + L+         AH+++   T D I      S        +  
Sbjct: 246 LGSVEGILQWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMAS 305

Query: 219 MLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGG 278
           +++ P +VV++R++ + +  G V KY   + S   I +EEG  ++Y G  P ++R  P  
Sbjct: 306 IVTYPHEVVRTRLRQSPLENGKV-KYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNS 364

Query: 279 GILL 282
            I+ 
Sbjct: 365 IIMF 368

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 70.5 bits (171), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 81/294 (27%), Positives = 129/294 (43%), Gaps = 40/294 (13%)

Query: 8   SLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGV 67
           S  FL    +GA AG S  L  +P+D +KTR  LQ +GG                A  G 
Sbjct: 3   SSSFLVSLASGAAAGTSTDLAFFPIDTLKTR--LQAKGG--------------FFANGGY 46

Query: 68  GRLYKGISSPILMEAPKRATKFACNDEFQKLY------KQAFGVEKLSQPLSMLAGASAG 121
             +Y+G+ S ++  AP  +  F   D   K+Y      K      +++  LS +  +S G
Sbjct: 47  KGVYRGLGSAVIASAPSASLFFVSYDSM-KVYSKPVISKYVTSNNQMADTLSHMFSSSIG 105

Query: 122 CVEAFVV-VPFELVKIRLQ--DASSSYKGPVDVVRKIVAREGVL-AMYNGLESTLWRHAL 177
            V A +V VP E++K R Q    +SS++    +++     EGVL  +Y G  +T+ R   
Sbjct: 106 EVSACLVRVPAEVIKQRTQTHKTNSSWQTFTKILQNENG-EGVLRNLYRGWNTTIMREIP 164

Query: 178 WNGGYFGIIFQARALLPAAHNKTQCIT--NDLISDSIGCSIGCMLSTPFDVVKSRIQ-NT 234
           +    F  +++      A  N    +      +  S+  +I    +TP DV+K+R+  + 
Sbjct: 165 FTCIQFP-LYEFLKKTWAKRNGQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRLMLSH 223

Query: 235 AVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGV 288
             IP      N        IY EEGF+  + G  P+ + +  GG I L V+  V
Sbjct: 224 KSIPVAQLAKN--------IYAEEGFKVFFSGVGPRTMWISAGGAIFLGVYETV 269

>Kwal_27.11419
          Length = 298

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 123/294 (41%), Gaps = 45/294 (15%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
            F  G V G++  +++ P D++KTR+Q           + ++D ++ I   E  G+L+KG
Sbjct: 10  HFIGGFVGGLTSAVILQPFDLLKTRLQQN-------KSSNLLDVVRSI---ETPGQLWKG 59

Query: 74  ISSPILMEAPKRA--------TKFACNDEFQKLYKQAFGVEKLSQPLSM----LAGASAG 121
                L  +   A         + A  D+  K      G       LSM    ++GA   
Sbjct: 60  TLPSALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITR 119

Query: 122 CVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGG 181
                  +P  ++K+R +    +YK   +    I   EG+  +++G  +T+ R A + G 
Sbjct: 120 AAVGVATMPITVLKVRFESTMYNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAGL 179

Query: 182 YFGIIFQARALLP-------AAHN-------KTQCITNDLISDSIGCSIGCMLSTPFDVV 227
           Y     Q++  LP         HN       KT  I N + + S   S+   +++PFD +
Sbjct: 180 YVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFS-SASLATTITSPFDTI 238

Query: 228 KSRIQ-NTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGI 280
           K+R+Q N +   G ++ +        +I R E  R L+ G   ++ R     GI
Sbjct: 239 KTRMQLNPSQYYGFIQTFK-------SIIRYERPRNLFDGLSLRLSRKALSAGI 285

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 81/197 (41%), Gaps = 19/197 (9%)

Query: 2   SSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKI 61
           SSS    L       +GA+   +  +   P+ V+K R +  +      +Y  + +    I
Sbjct: 99  SSSFLPQLSMYENLISGAITRAAVGVATMPITVLKVRFESTMY-----NYKSLGEAATHI 153

Query: 62  VAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY-----------KQAFGV--EKL 108
              EG+  L+ G  + ++ +AP  A  +    E  KL                GV   K 
Sbjct: 154 YRSEGIRGLFSGCGATVMRDAPY-AGLYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKT 212

Query: 109 SQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGL 168
           S  ++ +A  S+  +   +  PF+ +K R+Q   S Y G +   + I+  E    +++GL
Sbjct: 213 STIINSIAAFSSASLATTITSPFDTIKTRMQLNPSQYYGFIQTFKSIIRYERPRNLFDGL 272

Query: 169 ESTLWRHALWNGGYFGI 185
              L R AL  G  +GI
Sbjct: 273 SLRLSRKALSAGIAWGI 289

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 82/186 (44%), Gaps = 28/186 (15%)

Query: 115 LAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWR 174
           + G   G   A ++ PF+L+K RLQ   SS    +DVVR I   E    ++ G   +  R
Sbjct: 12  IGGFVGGLTSAVILQPFDLLKTRLQQNKSS--NLLDVVRSI---ETPGQLWKGTLPSALR 66

Query: 175 HALWNGGYFGIIFQARALLP-------AAHNKTQC------ITNDLISDSIGCSIGCMLS 221
            ++ +  +   +   R+ +        A  N +        +  +LIS +I  +   + +
Sbjct: 67  TSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAVGVAT 126

Query: 222 TPFDVVKSRIQNTAVIPGVVRKYNW-SLPSLLT-IYREEGFRALYKGFVPKVLRLGPGGG 279
            P  V+K R ++T         YN+ SL    T IYR EG R L+ G    V+R  P  G
Sbjct: 127 MPITVLKVRFESTM--------YNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAG 178

Query: 280 ILLVVF 285
           + ++ +
Sbjct: 179 LYVLFY 184

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 68.2 bits (165), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 133/311 (42%), Gaps = 39/311 (12%)

Query: 5   DTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIV-- 62
           D +  P   +  +G  AG    LV++PLD++K R+QL        HY G    +K+I+  
Sbjct: 3   DHQWTPLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHY-GPFMVIKEIIRS 61

Query: 63  ---AGEGV-GRLYKGISSPILMEAPKRATKFACNDEFQKL-YK--------QAFGV---E 106
              +G  V   LY+G+S  +   A      F      ++L YK        Q  GV    
Sbjct: 62  SANSGRSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDH 121

Query: 107 KLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASS----SYKGPVDVVRKIVAREGVL 162
           K++  + + AGAS+G + A +  P  ++K R+   S     +Y    + V++++  +G  
Sbjct: 122 KMNSLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGFQ 181

Query: 163 AMYNGLESTLW---RHALWNGGYFGI--IFQARALLPAAHNKTQCITNDLIS---DSIGC 214
            ++ GL   L+   + AL    YF +    + R L     N       +L +    S+G 
Sbjct: 182 GLWKGLVPALFGVSQGAL----YFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGK 237

Query: 215 SIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRL 274
            +   L  PF ++KS +Q+        R +    P +  I   +GF  LYKG    ++R 
Sbjct: 238 MVSVTLVYPFQLLKSNLQSFRANEQKFRLF----PLIKLIIANDGFVGLYKGLSANLVRA 293

Query: 275 GPGGGILLVVF 285
            P   I   V+
Sbjct: 294 IPSTCITFCVY 304

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 68.2 bits (165), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 61/285 (21%), Positives = 123/285 (43%), Gaps = 25/285 (8%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
               G   G+S  + + PLD++KTR Q Q +GG        +D   ++  G     +   
Sbjct: 7   HLIGGFAGGLSSAVALQPLDLLKTRFQ-QTKGGTLWQTVKSLDTPWQLWRGTLPSAIRTS 65

Query: 74  ISSPILMEAPK-RATKFACNDEFQK----LYKQAFGVEKLSQPLSMLAGASAGCVEAFVV 128
           + S + + +     T  A   +F      +  ++  + +LS   +++ GA A     ++ 
Sbjct: 66  VGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARGTVGYIT 125

Query: 129 VPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQ 188
           +P  ++K+R +    +YK   +  + I A+EG+   + G   T  R A ++G Y  +  +
Sbjct: 126 MPITIIKVRYESTLYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLYVLLYEK 185

Query: 189 ARALLPA----------AHNKTQCITNDLISDS---IGCSIGCMLSTPFDVVKSRIQNTA 235
            +  LP           +  +    T+  I+ +   +  S+   ++ PFD +K+R+Q   
Sbjct: 186 LKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTRMQ--- 242

Query: 236 VIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGI 280
           + P   + + WS  +L TI  +E    ++ G   ++ R     GI
Sbjct: 243 LEPTKFKTF-WS--TLTTIVTQEHPIKIFSGLSMRLTRKALSAGI 284

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 75/195 (38%), Gaps = 17/195 (8%)

Query: 3   SSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIV 62
           SS+   L        GA A  +   +  P+ ++K R +  +      +Y  + +  K I 
Sbjct: 99  SSNLPQLSMYENLVTGAFARGTVGYITMPITIIKVRYESTLY-----NYKSIAEAAKSIA 153

Query: 63  AGEGVGRLYKGISSPILMEAP------------KRATKFACNDEFQKLYKQAFGVEKLSQ 110
           A EG+   ++G     L +AP            K            +L  +       S 
Sbjct: 154 AQEGIRGFFRGFGPTCLRDAPYSGLYVLLYEKLKHTLPTILPKSLLQLDSEGRYTAYTST 213

Query: 111 PLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLES 170
            ++  +   +  +   V  PF+ +K R+Q   + +K     +  IV +E  + +++GL  
Sbjct: 214 AINSTSAILSASMATTVTAPFDTIKTRMQLEPTKFKTFWSTLTTIVTQEHPIKIFSGLSM 273

Query: 171 TLWRHALWNGGYFGI 185
            L R AL  G  +GI
Sbjct: 274 RLTRKALSAGIAWGI 288

 Score = 31.6 bits (70), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 34/188 (18%), Positives = 73/188 (38%), Gaps = 28/188 (14%)

Query: 114 MLAGASAGCVEAFVVVPFELVKIRLQDASSS---------------YKGPV-DVVRKIVA 157
           ++ G + G   A  + P +L+K R Q                    ++G +   +R  V 
Sbjct: 8   LIGGFAGGLSSAVALQPLDLLKTRFQQTKGGTLWQTVKSLDTPWQLWRGTLPSAIRTSVG 67

Query: 158 REGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIG 217
               L+  N + + L +   ++     ++    + LP        +T      ++G    
Sbjct: 68  SALYLSSLNLMRTALAKRKQFDTAD-SVVTGKSSNLPQLSMYENLVTGAFARGTVG---- 122

Query: 218 CMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPG 277
             ++ P  ++K R ++T      +  Y     +  +I  +EG R  ++GF P  LR  P 
Sbjct: 123 -YITMPITIIKVRYEST------LYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPY 175

Query: 278 GGILLVVF 285
            G+ ++++
Sbjct: 176 SGLYVLLY 183

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 68.2 bits (165), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 62/261 (23%), Positives = 107/261 (40%), Gaps = 28/261 (10%)

Query: 29  MYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATK 88
           M P+DVVKTR+QL+       +  G+V   K+I++ EG G L  G    +L  + + + K
Sbjct: 31  MVPIDVVKTRIQLEPT----VYNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGSFK 86

Query: 89  FACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVV---PFELVKIRLQDASSSY 145
           F   + F+KL     G +      + +   SA   E F  +   P E  +IRL    +  
Sbjct: 87  FGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATRIRLVSQPTFA 146

Query: 146 KGPVDVVRKIVAREGVLAMYNGLESTLWRHALWN-----------GGYFGIIFQARALLP 194
            G      +I+  EGV + YNG    L++   +N             YFG+      +  
Sbjct: 147 NGLFGGFSRILKEEGVGSFYNGFTPILFKQIPYNIAKFFVFEHAANAYFGLAGPKETMSE 206

Query: 195 AAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTI 254
             H        +L +         ++S P D + S++  T   PG       ++  L  +
Sbjct: 207 TTHTAI-----NLAAGLTAGLAAAVVSQPADTLLSKVNKTKKAPG-----QSTIGLLAQL 256

Query: 255 YREEGFRALYKGFVPKVLRLG 275
            ++ GF   + G   +++ +G
Sbjct: 257 AKQLGFVGSFTGLPTRLVMVG 277

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 70/167 (41%), Gaps = 11/167 (6%)

Query: 115 LAGASAGCVEAFVVVPFELVKIRLQDASSSY-KGPVDVVRKIVAREGVLAMYNGLESTLW 173
           LAGA    +    +VP ++VK R+Q   + Y KG V   ++I++ EG  A+  G   TL 
Sbjct: 18  LAGAIGCGITHSSMVPIDVVKTRIQLEPTVYNKGMVSSFKQIISSEGAGALLTGFGPTLL 77

Query: 174 RHALWNGGYFG--IIFQARALLPAAHNKTQCITNDLI--SDSIGCSIGCMLSTPFDVVKS 229
            ++L     FG   +F+  A+    ++      N +   S +I      +   P +  + 
Sbjct: 78  GYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATRI 137

Query: 230 RIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
           R+ +           N        I +EEG  + Y GF P + +  P
Sbjct: 138 RLVSQPTFA------NGLFGGFSRILKEEGVGSFYNGFTPILFKQIP 178

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 67.8 bits (164), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 72/305 (23%), Positives = 131/305 (42%), Gaps = 37/305 (12%)

Query: 10  PFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVA------ 63
           P   +  +G  AG    +  +PLD+VK R+QL +     P   G  D +K+IV       
Sbjct: 7   PVQKEMISGLTAGTITTVSTHPLDLVKVRLQL-LATNKKPQ--GYYDVVKRIVKDSKQHS 63

Query: 64  -------GEGVGRLYKGISSPI---LMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLS 113
                  G GV  L   ++  +   L  A K      CN + ++        ++++  + 
Sbjct: 64  FFRETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMY 123

Query: 114 MLAGASAGCVEAFVVVPFELVKIRLQDA----SSSYKGPVDVVRKIVAREGVLAMYNGLE 169
           +LA A +G   + +  P  ++K R+       S SY+  VD ++K+   EG+   + GL 
Sbjct: 124 LLAAAMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWRGLV 183

Query: 170 STLWRHALWNGGYFGIIFQA--RALLPAAH-NKTQCITN-DLIS-DSIGCSIGCMLSTPF 224
            +L+   +  G  +  ++         A H +K + ++N + I+  S+   +      P 
Sbjct: 184 PSLF--GVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAVYPL 241

Query: 225 DVVKSRIQ----NTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGI 280
            ++KS +Q    +T + P    +  W L  + TIY  +G   LYKG +  ++R  P   I
Sbjct: 242 QLLKSNLQSFEVSTVINPKTSHRV-WKL--ITTIYVRDGVTGLYKGLLANLIRAVPSTCI 298

Query: 281 LLVVF 285
              V+
Sbjct: 299 TFCVY 303

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 80/181 (44%), Gaps = 12/181 (6%)

Query: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVA 63
           ++ K +  L    A A++GV+  ++  P+ V+KTR+ +         Y   VD +KK+  
Sbjct: 113 NNDKEMTSLMYLLAAAMSGVATSVLTNPIWVIKTRI-MSTSFVDSRSYRSTVDGIKKLYR 171

Query: 64  GEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVE---KLSQPLSMLAGASA 120
            EG+   ++G+  P L    + A  F   D  +  Y  A  V+   KLS    +   + +
Sbjct: 172 IEGLAGFWRGL-VPSLFGVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLS 230

Query: 121 GCVEAFVVVPFELVKIRLQDAS-SSYKGP------VDVVRKIVAREGVLAMYNGLESTLW 173
             V    V P +L+K  LQ    S+   P        ++  I  R+GV  +Y GL + L 
Sbjct: 231 KMVSVTAVYPLQLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLI 290

Query: 174 R 174
           R
Sbjct: 291 R 291

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 41/92 (44%), Gaps = 2/92 (2%)

Query: 7   KSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQ-LQVQGGAGPHYTG-VVDCLKKIVAG 64
           K L  L      +++ +  +  +YPL ++K+ +Q  +V     P  +  V   +  I   
Sbjct: 216 KKLSNLEYITITSLSKMVSVTAVYPLQLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVR 275

Query: 65  EGVGRLYKGISSPILMEAPKRATKFACNDEFQ 96
           +GV  LYKG+ + ++   P     F   + F+
Sbjct: 276 DGVTGLYKGLLANLIRAVPSTCITFCVYENFR 307

>Scas_702.10
          Length = 302

 Score = 67.0 bits (162), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 128/289 (44%), Gaps = 31/289 (10%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVV-DCLK 59
           M+ S TK +   Y ++ G  AG+   ++ +PLD+ K R+Q      A P     +   L 
Sbjct: 1   MTDSPTKQIK--YPWWYGGAAGIFACVMTHPLDLAKVRLQ------AAPLPKPTLGRMLT 52

Query: 60  KIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQ--PLSMLAG 117
            I+  E V  LY G+S+ +L +      +F   D  ++       +  +    P SM +G
Sbjct: 53  TILRNENVMGLYSGLSAAVLRQCTYTTVRFGAYDLMKENLIPQGHINDMVYLLPCSMFSG 112

Query: 118 ASAGCVEAFVVVPFELVKIRLQDASS-------SYKGPVDVVRKIVARE-GVLAMYNGLE 169
           A  G V  F     ++V IR+Q+ S+       +Y+  +D V KI   E G+  +  G +
Sbjct: 113 AIGGLVGNFA----DVVNIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWK 168

Query: 170 STLWRHALWNGGYFGI--IFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVV 227
             + R  L          +F+   +   + +  +  T+ L +  +   +   + +P DV+
Sbjct: 169 PNMVRGVLMTASQVVTYDVFKNYLVTKLSFDPKKNSTH-LSASLLAGLVATTICSPADVI 227

Query: 228 KSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
           K+RI N         +   ++  L +  ++EG   +++G++P   RLGP
Sbjct: 228 KTRIMNAHKT-----ESESAIKILTSAIKKEGPSFMFRGWLPIFTRLGP 271

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 66.2 bits (160), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 79/295 (26%), Positives = 130/295 (44%), Gaps = 36/295 (12%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGR-LYK 72
           +  +G  AG    +  +PLD++K R+QL     A   YTG++   + I   +  GR LY+
Sbjct: 11  EVISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTGLI---RDIFERQQWGRELYR 67

Query: 73  GISSPILMEAPKRATKFACNDEFQKLYKQAFGVE--------KLSQPLSMLAGASAGCVE 124
           G+   +L  +   A  F C    + +  +  G E        +L     MLA  S+G   
Sbjct: 68  GLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGSSGIAT 127

Query: 125 AFVVVPFELVKIRLQDASSS--YKGPVDVVRKIVAREGVLAMYNGLESTLW---RHALWN 179
           A +  P  ++K R+   S +  YK   D V K+   EGVLA + G+  +L    + A++ 
Sbjct: 128 AVLTNPIWVIKTRIMATSRAGPYKSTFDGVYKLYQTEGVLAFWRGVVPSLLGVSQGAIYF 187

Query: 180 GGYFGIIFQARALLPAAHNKTQCITNDL-ISDSIGCS-IGCMLST----PFDVVKSRIQN 233
             Y  + F         H+ T      L +S+ IG + I  M+S     PF ++KS++Q+
Sbjct: 188 ALYDTLKFH------YLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPFQLLKSKLQD 241

Query: 234 TAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGV 288
                G+ +        + T+Y  EG R  Y+G    +LR  P   I   V+  +
Sbjct: 242 FGAPSGITQL-------VQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYENI 289

 Score = 62.0 bits (149), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 82/172 (47%), Gaps = 10/172 (5%)

Query: 7   KSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEG 66
           + LP      A   +G++  ++  P+ V+KTR+    +  AGP Y    D + K+   EG
Sbjct: 109 RRLPAHAYMLAAGSSGIATAVLTNPIWVIKTRIMATSR--AGP-YKSTFDGVYKLYQTEG 165

Query: 67  VGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAF 126
           V   ++G+  P L+   + A  FA  D  +  Y  +   +K  + LS+       C+   
Sbjct: 166 VLAFWRGV-VPSLLGVSQGAIYFALYDTLKFHYLHS-STDKAERRLSVSEIIGITCISKM 223

Query: 127 V----VVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWR 174
           +    V PF+L+K +LQD  +   G   +V+ + +REG+   Y GL + L R
Sbjct: 224 ISVTSVYPFQLLKSKLQDFGAP-SGITQLVQTVYSREGIRGFYRGLSANLLR 274

 Score = 28.9 bits (63), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 84/190 (44%), Gaps = 24/190 (12%)

Query: 104 GVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRL-----QDASSSYKGPVDVVRKIVAR 158
           G E  S    +++G +AG +      P +L+K+RL       A+++Y G   ++R I  R
Sbjct: 2   GHELTSLQREVISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTG---LIRDIFER 58

Query: 159 EGV-LAMYNGLESTLWRHALWNGGYFGIIFQAR--ALLPAAHNKTQCITND--------L 207
           +     +Y GL   L  +++    YFG    A+  AL    +     I +         L
Sbjct: 59  QQWGRELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYML 118

Query: 208 ISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGF 267
            + S G +   +L+ P  V+K+RI  T+        Y  +   +  +Y+ EG  A ++G 
Sbjct: 119 AAGSSGIAT-AVLTNPIWVIKTRIMATS----RAGPYKSTFDGVYKLYQTEGVLAFWRGV 173

Query: 268 VPKVLRLGPG 277
           VP +L +  G
Sbjct: 174 VPSLLGVSQG 183

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 66.2 bits (160), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 125/282 (44%), Gaps = 46/282 (16%)

Query: 19  AVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDC--LKKIVAGEGVGR------- 69
           A AG+ EI V +P+D +  R+          ++T + +   L  +V  E   +       
Sbjct: 17  ASAGILEIGVFHPVDTISKRLM--------SNHTKITNAQQLNDVVFREHASKPFGQRLF 68

Query: 70  -LYKGISSPILMEAPKRATKFA--------CNDEFQKLYKQAFGVEKLSQPL-SMLAGAS 119
            L+ G+      +  +R  K+          N  F+  +  AFG EK  + L S  AG+ 
Sbjct: 69  TLFPGLGYAATYKIFQRVYKYGGQPFANEFLNKHFKADFDGAFG-EKTGKALRSATAGSL 127

Query: 120 AGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWN 179
            G  E  V++P +++KI+ Q    S++G   +  +I+  EG + +Y G   T  R+A  +
Sbjct: 128 IGIGE-IVLLPLDVLKIKRQTNPESFRGRGFL--RILRDEG-MGLYRGWGWTAARNAPGS 183

Query: 180 GGYFGIIFQARALLPAAHNKTQCI-TNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIP 238
              FG    A+  +    + +Q     + +S   G S   ++S P DV+K+RIQ+     
Sbjct: 184 FALFGGNAFAKEYILGLKDYSQATWGQNFVSSIFGASASLIVSAPLDVIKTRIQS----- 238

Query: 239 GVVRKYNWSLPSLLTI----YREEGFRALYKGFVPKVLRLGP 276
              R +  S  S  TI     + EG  A +KG  PK+L  GP
Sbjct: 239 ---RNFE-SAESGFTIVKNTLKNEGATAFFKGLTPKLLTTGP 276

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 14  QFFAGAVAGVS-EILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYK 72
           Q F  ++ G S  ++V  PLDV+KTR+Q +    A   +T V + LK     EG    +K
Sbjct: 210 QNFVSSIFGASASLIVSAPLDVIKTRIQSRNFESAESGFTIVKNTLKN----EGATAFFK 265

Query: 73  GISSPILMEAPKRATKFAC 91
           G++  +L   PK    FA 
Sbjct: 266 GLTPKLLTTGPKLVFSFAI 284

>Scas_662.12
          Length = 308

 Score = 66.2 bits (160), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 67/299 (22%), Positives = 127/299 (42%), Gaps = 26/299 (8%)

Query: 10  PFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPH---YTGVVDCL---KKIVA 63
           P   +  +G  AG    L+++PLD++K R+QL        H   YT +++ L    K + 
Sbjct: 6   PIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMG 65

Query: 64  GEG-----VGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGA 118
            +G     +   Y+G+   +L  A   +  F   +  +    Q   +   +  + + +G 
Sbjct: 66  SQGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTIFLTSGL 125

Query: 119 SAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRK----IVAREGVLAMYNGLESTLWR 174
            +G     +  P  ++K R+   S  +K     +R     ++ +EG  A++ GL  +L  
Sbjct: 126 ISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGLLPSLL- 184

Query: 175 HALWNGG-YFGIIFQARALLPAAHNKTQCITND------LISDSIGCSIGCMLSTPFDVV 227
             +  G  YF I    +       NK++    +      LIS S+   +  M   PF ++
Sbjct: 185 -GVSQGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLIS-SLSKMLSVMSVYPFQLL 242

Query: 228 KSRIQNTAVIPGVVRKYNWSLPSLL-TIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
           KS +Q    +   + + ++   +L+  IYR+ G + LYKG    +LR  P   I   ++
Sbjct: 243 KSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTCITFCIY 301

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/81 (20%), Positives = 38/81 (46%), Gaps = 2/81 (2%)

Query: 18  GAVAGVSEILVMYPLDVVKTRMQL--QVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGIS 75
            +++ +  ++ +YP  ++K+ +Q    V      +    +  ++KI    G+  LYKG+S
Sbjct: 225 SSLSKMLSVMSVYPFQLLKSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLS 284

Query: 76  SPILMEAPKRATKFACNDEFQ 96
           + +L   P     F   + F+
Sbjct: 285 ANLLRAIPSTCITFCIYENFK 305

>Scas_715.45
          Length = 305

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 119/259 (45%), Gaps = 26/259 (10%)

Query: 31  PLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFA 90
           PLD++K R+Q+        + +G++  LKK    EG+G+L+ G+ +  +  + + A K+ 
Sbjct: 36  PLDLIKCRLQVDPTLYRS-NTSGIIQILKK----EGLGKLFTGVGATCIGYSLQGAGKYG 90

Query: 91  CNDEFQKLY-----KQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSY 145
             + F++LY     K      K    + +L+ A+A      ++ PFE +K++ Q     +
Sbjct: 91  GYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPW 150

Query: 146 -KGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFG----IIFQARALLPAAHNKT 200
               ++  +K+ A+EG+   Y G+     R   +    F     I+    A LP   ++ 
Sbjct: 151 CNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEM 210

Query: 201 ---QCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLP-SLLTIYR 256
              Q I+   +   +   +  ++S P DV+ S+I N        RK N S+  +L  IY 
Sbjct: 211 SALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNE-------RKVNESMNVALKRIYS 263

Query: 257 EEGFRALYKGFVPKVLRLG 275
             GF  L+ G   ++L +G
Sbjct: 264 RIGFVGLWNGLPVRILMIG 282

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 71/160 (44%), Gaps = 10/160 (6%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74
             + A A     +++ P + +K + Q  +     P    V++  KK+ A EG+   YKGI
Sbjct: 119 LLSSATAEFFADIMLCPFEAIKVKQQTTMP----PWCNNVIEGWKKMYAKEGLNGFYKGI 174

Query: 75  SSPILMEAPKRATKFACNDE-----FQKLYKQAFGVEKLSQ-PLSMLAGASAGCVEAFVV 128
           +     + P    KF   +      + +L  +   +  L Q  +S + G  AG + A V 
Sbjct: 175 TPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVS 234

Query: 129 VPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGL 168
            P +++  ++ +     +     +++I +R G + ++NGL
Sbjct: 235 HPADVMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGL 274

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 65/155 (41%), Gaps = 11/155 (7%)

Query: 128 VVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIF 187
           V P +L+K RLQ   + Y+     + +I+ +EG+  ++ G+ +T   ++L   G +G   
Sbjct: 34  VTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYE 93

Query: 188 QARALLPAAHNKTQCITND------LISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVV 241
             + L      K +           L+S +       ++  PF+ +K + Q T + P   
Sbjct: 94  LFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVK-QQTTMPPWC- 151

Query: 242 RKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
              N  +     +Y +EG    YKG  P   R  P
Sbjct: 152 ---NNVIEGWKKMYAKEGLNGFYKGITPLWCRQIP 183

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/274 (22%), Positives = 115/274 (41%), Gaps = 25/274 (9%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
              +G   G++ +  + PLD++KTR+Q Q Q  +       V   +++  G     L   
Sbjct: 11  HLVSGFFGGLASVCALQPLDLLKTRLQ-QAQASSLRSVLREVRTTRELWRGTLPSALRTS 69

Query: 74  ISSPILMEAPKRA-TKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFE 132
           I S + +     + +  A   E +    ++  + +L    ++L GA +      V +P  
Sbjct: 70  IGSALYLSLLNYSRSALARGSEART---RSSLLPRLQSYQNLLTGALSRAAVGLVTMPIT 126

Query: 133 LVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARAL 192
           ++K+R +    +Y G  +  R I   EG    + G  +T  R A + G Y  +  QA+ +
Sbjct: 127 VIKVRYESTLYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVLLYEQAKEM 186

Query: 193 LPAAHNKTQCITNDL-------------ISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPG 239
           LP A   T    ++              +S  +  S+   L+ PFD +K+R+Q  +   G
Sbjct: 187 LPRALPATLLGADESGKLTAPASAMVNGVSAFLSASLATTLTAPFDTIKTRMQLQSHPVG 246

Query: 240 VVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLR 273
            V+       +L  I  EE  R L+ G   ++ R
Sbjct: 247 FVQ-------TLRHIVCEERARTLFDGLSLRLCR 273

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 88/193 (45%), Gaps = 23/193 (11%)

Query: 2   SSSDTKS--LPFL--YQ-FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVD 56
           S + T+S  LP L  YQ    GA++  +  LV  P+ V+K R +  +       Y G+ +
Sbjct: 90  SEARTRSSLLPRLQSYQNLLTGALSRAAVGLVTMPITVIKVRYESTLYA-----YNGLAE 144

Query: 57  CLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAF-----GVE---KL 108
             + I   EG    +KG ++  L +AP         ++ +++  +A      G +   KL
Sbjct: 145 ATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVLLYEQAKEMLPRALPATLLGADESGKL 204

Query: 109 SQPLS-MLAGASA---GCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAM 164
           + P S M+ G SA     +   +  PF+ +K R+Q  S    G V  +R IV  E    +
Sbjct: 205 TAPASAMVNGVSAFLSASLATTLTAPFDTIKTRMQLQSHPV-GFVQTLRHIVCEERARTL 263

Query: 165 YNGLESTLWRHAL 177
           ++GL   L R A+
Sbjct: 264 FDGLSLRLCRKAM 276

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 82/189 (43%), Gaps = 31/189 (16%)

Query: 111 PLSMLAGASAGCVEAFVVVPFELVKIRLQDA-SSSYKGPVDVVRKIVAREGVLAMYNGLE 169
           P  +++G   G      + P +L+K RLQ A +SS +  +  VR    RE    ++ G  
Sbjct: 9   PAHLVSGFFGGLASVCALQPLDLLKTRLQQAQASSLRSVLREVR--TTRE----LWRGTL 62

Query: 170 STLWRHALWNGGYFGIIFQARA-------------LLPAAHNKTQCITNDLISDSIGCSI 216
            +  R ++ +  Y  ++  +R+             LLP   +    +T  L   ++G   
Sbjct: 63  PSALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAAVG--- 119

Query: 217 GCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
             +++ P  V+K R ++T      +  YN    +   I+R EG R  +KG     LR  P
Sbjct: 120 --LVTMPITVIKVRYEST------LYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAP 171

Query: 277 GGGILLVVF 285
             G+ ++++
Sbjct: 172 YAGLYVLLY 180

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 65.5 bits (158), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 115/280 (41%), Gaps = 26/280 (9%)

Query: 25  EILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPK 84
           E  V YP +  KTR+QL  Q G+G     +V  L +    +G G LY G  + ++    K
Sbjct: 24  EGCVTYPFEFAKTRLQL-AQQGSGESRNPLV-LLYRTARTQGAGALYVGCPAFVVGNTCK 81

Query: 85  RATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEA-FVVVPFELVKIRLQDASS 143
              +F   D  ++  +   G   LS P  MLAG  AG +E+   V PFE VK  L D   
Sbjct: 82  AGVRFLGFDALRRALQDERGA--LSGPRGMLAGLGAGLLESVLAVTPFEAVKTALIDDRQ 139

Query: 144 SYKGPVDVVRKIVAREGVLAMYNGLESTL--------WRHALWNGGYFGIIFQAR----- 190
           + +       +  AR   L +       L         R A      FG   Q +     
Sbjct: 140 AARPRYQHNGRGAARNYALLLRELGLRGLYGGLVPVALRQASNQAVRFGCYTQLKQAVQR 199

Query: 191 -ALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLP 249
            A  PA  ++        +  ++   +    + P D VK+R+Q          +Y  ++ 
Sbjct: 200 YAGTPA--DQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQALDAA-----RYGSTVG 252

Query: 250 SLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVL 289
               + REEG RAL++G  P++ RL   GGI+   +  +L
Sbjct: 253 CFRAVVREEGVRALWRGATPRLGRLVLSGGIVFTAYEKLL 292

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 83/199 (41%), Gaps = 30/199 (15%)

Query: 15  FFAGAVAGVSE-ILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
             AG  AG+ E +L + P + VKT + +  +  A P Y            G G  R Y  
Sbjct: 109 MLAGLGAGLLESVLAVTPFEAVKTAL-IDDRQAARPRYQH---------NGRGAARNYAL 158

Query: 74  ISS------------PI-LMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPL----SMLA 116
           +              P+ L +A  +A +F C  + ++  ++  G     QPL    + L 
Sbjct: 159 LLRELGLRGLYGGLVPVALRQASNQAVRFGCYTQLKQAVQRYAGTPA-DQPLGSGQTFLV 217

Query: 117 GASAGCVEAFVVVPFELVKIRLQDASSS-YKGPVDVVRKIVAREGVLAMYNGLESTLWRH 175
           GA +G V  +  +P + VK R+Q   ++ Y   V   R +V  EGV A++ G    L R 
Sbjct: 218 GALSGIVTVYATMPVDTVKTRMQALDAARYGSTVGCFRAVVREEGVRALWRGATPRLGRL 277

Query: 176 ALWNGGYFGIIFQARALLP 194
            L  G  F    +   LLP
Sbjct: 278 VLSGGIVFTAYEKLLVLLP 296

 Score = 28.1 bits (61), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 3/48 (6%)

Query: 123 VEAFVVVPFELVKIRLQDA---SSSYKGPVDVVRKIVAREGVLAMYNG 167
           +E  V  PFE  K RLQ A   S   + P+ ++ +    +G  A+Y G
Sbjct: 23  IEGCVTYPFEFAKTRLQLAQQGSGESRNPLVLLYRTARTQGAGALYVG 70

>Kwal_0.232
          Length = 274

 Score = 65.1 bits (157), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 120/292 (41%), Gaps = 42/292 (14%)

Query: 11  FLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRL 70
           F+    AGA AG S  L  +P+D +KTR  LQ  GG                A  G   +
Sbjct: 6   FITSLLAGAAAGTSTDLFFFPIDTLKTR--LQAAGG--------------FFANGGYLGV 49

Query: 71  YKGISSPILMEAPKRATKFACNDEFQKLYKQAFG-----VEKLSQPLSMLAGASAGCVEA 125
           Y+G+ S ++  AP  +  F   D  +   +  F       +++++  + +  +SAG + A
Sbjct: 50  YRGLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEIAA 109

Query: 126 FVV-VPFELVKIRLQDASSSYKGPVDVVRKIVAREG----VLAMYNGLESTLWRHALWNG 180
            +V VP E++K R Q   S     +  ++K++  E        +Y G  +T+ R   +  
Sbjct: 110 CMVRVPAEVIKQRTQTHKS--DSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPFTC 167

Query: 181 GYFGII-FQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPG 239
             F +  F  +    +   +            +   I    +TP DV+K+R+  +     
Sbjct: 168 IQFPLYEFLKKQWAISGGREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSHT--- 224

Query: 240 VVRKYNWSLPSL---LTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGV 288
                  S+P L     IY  EG++  + G  P+ + +  GG I L V+  V
Sbjct: 225 -------SVPVLHLARQIYATEGWKVFFSGVGPRTVWISAGGAIFLGVYETV 269

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 65.9 bits (159), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 85/184 (46%), Gaps = 15/184 (8%)

Query: 5   DTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAG 64
           DTK L  L  F AG +AGV     +YP+D +K RMQ             ++   K++   
Sbjct: 314 DTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTE 373

Query: 65  EGVGRLYKGISSPILMEAPKRA---------TKFACNDEFQKLYKQAFGVEKLSQPLSML 115
            G+   Y+G++  +L   P  A          K+  + + +KL K+   VE LS  + + 
Sbjct: 374 GGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVE-LSNLVVLP 432

Query: 116 AGASAGCVEAFVVVPFELVKIRLQDASS-----SYKGPVDVVRKIVAREGVLAMYNGLES 170
            GA +G   A VV P  L++ RLQ   +      Y G  DV+ K + REG   ++ GL  
Sbjct: 433 MGAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVP 492

Query: 171 TLWR 174
           TL +
Sbjct: 493 TLAK 496

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 41/83 (49%)

Query: 18  GAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSP 77
           GA +G     V+YP+++++TR+Q Q        Y G  D L K +  EG   L+KG+   
Sbjct: 434 GAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPT 493

Query: 78  ILMEAPKRATKFACNDEFQKLYK 100
           +    P  +  + C +  +KL K
Sbjct: 494 LAKVCPAVSISYLCYENLKKLMK 516

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/240 (20%), Positives = 104/240 (43%), Gaps = 18/240 (7%)

Query: 66  GVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFG---VEKLSQPLSMLAGASAGC 122
           G+   Y G     L   P+ + KF   +  +KL  +       + LS+  + +AG  AG 
Sbjct: 273 GIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLSTFIAGGLAGV 332

Query: 123 VEAFVVVPFELVKIRLQDA--SSSYKGP---VDVVRKIVAREGVLAMYNGLEST---LWR 174
              F V P + +K R+Q A  ++  KG    +   +++    G+   Y G+      ++ 
Sbjct: 333 CAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLFYRGVTVGVLGIFP 392

Query: 175 HALWNGGYFGII--FQARALLPAAHNKTQCIT-NDLISDSIGC---SIGCMLSTPFDVVK 228
           +A  + G F ++  +   +     + K + +  ++L+   +G    + G  +  P ++++
Sbjct: 393 YAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGTFGATVVYPINLLR 452

Query: 229 SRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGV 288
           +R+Q         R Y+     LL   + EG+  L+KG VP + ++ P   I  + +  +
Sbjct: 453 TRLQAQGTFAHPYR-YDGFRDVLLKTIQREGYPGLFKGLVPTLAKVCPAVSISYLCYENL 511

>Kwal_23.3965
          Length = 307

 Score = 65.1 bits (157), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 72/305 (23%), Positives = 125/305 (40%), Gaps = 31/305 (10%)

Query: 7   KSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEG 66
           + +P      AG ++G+S  +V  PLD +K R+QLQ+   A   Y G++   K++V  EG
Sbjct: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEA--QYGGILVTFKRLVRQEG 67

Query: 67  VGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAF 126
           V  L+KG    + M     +T+F       KL  ++   +  +Q  + + GA +G   A 
Sbjct: 68  VRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKS---QLPAQIHTGMVGALSGTCSAI 124

Query: 127 VVVPFELVKIR-LQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGI 185
              P ++++ R + + S      +   ++I   EG    + G+ S++   A+        
Sbjct: 125 ASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSSILAT 184

Query: 186 IFQARALLPAAHNKTQCITNDLISDS--IGCSIGCMLSTPFDVVKSRIQNTAVI------ 237
               +       ++   +   L S +  I   +   +  P D V+ R Q   VI      
Sbjct: 185 YESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQ---VIDWQQLG 241

Query: 238 -PGVVRKYNWSLPSL---------LTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTG 287
            PG   K   +  S          L I  +EG  ALY G+   + +  P      VV  G
Sbjct: 242 HPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPS----TVVSLG 297

Query: 288 VLDFC 292
           V ++C
Sbjct: 298 VYEWC 302

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 65.1 bits (157), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 125/293 (42%), Gaps = 27/293 (9%)

Query: 10  PFLYQFFAGAVAGVSEILVMYPLDVVKTRMQ---------------LQVQGGAGPHYTGV 54
           P  YQ  AGA AG+ E  +M+P+D +KTRMQ                      G     +
Sbjct: 19  PLSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTL 78

Query: 55  VDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLS--QPL 112
           +  + +I + EG   L++G+ S ++   P  A  FA   EF K  +Q    +  +  QPL
Sbjct: 79  LQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATY-EFCK--EQLIDAKDFNTHQPL 135

Query: 113 -SMLAGASAGCVEAFVVVPFELVKIRLQ-DASSSYKGPVDVVRKIVAREGVLAMYNGLES 170
            + ++G +A      ++ PF+ +K RLQ  + SS      +   I   EG +A +    +
Sbjct: 136 KTAVSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFNIYKNEGPMAFFYSYPT 195

Query: 171 TLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSR 230
           TL  +  +    F +I+++        N      + L     G +    ++TP D +K+ 
Sbjct: 196 TLAMNIPFAALNF-VIYESSTKFFNPTNAYNPWIHCLCGGIAGATCAA-VTTPLDCIKTV 253

Query: 231 IQ---NTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGI 280
           +Q   +  V     +  N    +   I++  G++  ++G  P+V+   P   I
Sbjct: 254 LQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIPATAI 306

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 125/290 (43%), Gaps = 22/290 (7%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74
           F AG V G     V+ P++ VK  + LQVQ     +  G+V  +K++   EGV  L++G 
Sbjct: 20  FVAGGVGGAVSRTVVSPVERVK--ILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGN 77

Query: 75  SSPILMEAPKRATKFACNDEFQK---LYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPF 131
               L   P  A ++A   EF K    +    G E+L     ++ GA  G     V  P 
Sbjct: 78  GINCLRIFPYSAVQYAVY-EFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTYPL 136

Query: 132 ELVKIRLQDASSSYK--------------GPVDVVRKIVAREGVL-AMYNGLESTLWRHA 176
           +LV+ RL   +++                G V+++R+I   EG L   Y G+  T     
Sbjct: 137 DLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVV 196

Query: 177 LWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAV 236
            +    F +  + +AL+P  ++        L   ++   I   +  PFD+++ R Q   +
Sbjct: 197 PFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTM 256

Query: 237 IPGVVR-KYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
               +  +Y     +L TI R+EG R  YKG    ++++ P   +   V+
Sbjct: 257 GQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 76/180 (42%), Gaps = 15/180 (8%)

Query: 112 LSMLAGASAGCVEAFVVVPFELVKIRLQDASSSYK---GPVDVVRKIVAREGVLAMYNGL 168
           ++ +AG   G V   VV P E VKI LQ  SS+     G V  V+++   EGV  ++ G 
Sbjct: 18  IAFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGN 77

Query: 169 ESTLWRHALWNGGYFGI--IFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-PFD 225
                R   ++   + +    + R          Q  + + +          +L T P D
Sbjct: 78  GINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTYPLD 137

Query: 226 VVKSRIQ-NTAVIPGVVRK--YNWSLPS-----LLTIYREE-GFRALYKGFVPKVLRLGP 276
           +V++R+   TA +  + R   ++   P      L  I+REE G R  Y+G  P  L + P
Sbjct: 138 LVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVP 197

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 74/278 (26%), Positives = 114/278 (41%), Gaps = 40/278 (14%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIV----AGEGVGRL-- 70
           AGAV GV  +L  +P D++K R Q           +G VD ++KI+    A  G+  +  
Sbjct: 53  AGAVGGVCAVLTGHPFDLLKVRCQSN-------QASGTVDAVRKILVEARAQSGLSAVNM 105

Query: 71  ----YKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAF 126
               YKG+  P+L   P  A  F   D  +KL        KL+      AG  +      
Sbjct: 106 MRGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSGKLTTAQLATAGFISAIPTTL 165

Query: 127 VVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGII 186
           V+ P E VK+ LQ  S+   G     + I+A  GV +++ G  +TL R    +  YF   
Sbjct: 166 VMAPTERVKVVLQTQSNHSLG--SAAKHILATGGVRSLFRGSLATLARDGPGSALYFASY 223

Query: 187 FQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-------PFDVVKSRIQNTAVIPG 239
              +A L A     +  TN+L   ++ C  G M          P D +K+ +Q++     
Sbjct: 224 EATKAYLNA-----RSGTNELSIKNV-CLAGGMAGVSMWVGVFPIDTIKTELQSS----- 272

Query: 240 VVRKYNWSLPSLLTIYREE-GFRALYKGFVPKVLRLGP 276
                   + +   IY    G +  + G  P +LR  P
Sbjct: 273 --NTRQTMMEATRKIYNTRGGIKGFFPGIGPALLRSFP 308

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 79/193 (40%), Gaps = 21/193 (10%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIV----AREGVLA--MYN 166
           S+ AGA  G        PF+L+K+R Q   +S  G VD VRKI+    A+ G+ A  M  
Sbjct: 50  SLAAGAVGGVCAVLTGHPFDLLKVRCQSNQAS--GTVDAVRKILVEARAQSGLSAVNMMR 107

Query: 167 GLESTLWRHALWNGGYFGIIFQ----ARALLPAAHNKTQCITNDLISDSIGCSIGCMLST 222
           G    +    L     F + F      + L+    N  +  T  L       + G + + 
Sbjct: 108 GFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSGKLTTAQL------ATAGFISAI 161

Query: 223 PFDVVKSRIQNTAVIPGVVRKYNWSLPSLLT-IYREEGFRALYKGFVPKVLRLGPGGGIL 281
           P  +V +  +   V+  +  + N SL S    I    G R+L++G +  + R GPG  + 
Sbjct: 162 PTTLVMAPTERVKVV--LQTQSNHSLGSAAKHILATGGVRSLFRGSLATLARDGPGSALY 219

Query: 282 LVVFTGVLDFCRA 294
              +     +  A
Sbjct: 220 FASYEATKAYLNA 232

 Score = 32.3 bits (72), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 43/99 (43%), Gaps = 7/99 (7%)

Query: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVA 63
           S T  L       AG +AGVS  + ++P+D +KT +Q      +      +++  +KI  
Sbjct: 234 SGTNELSIKNVCLAGGMAGVSMWVGVFPIDTIKTELQ------SSNTRQTMMEATRKIYN 287

Query: 64  GE-GVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQ 101
              G+   + GI   +L   P  A  F   +    L+K+
Sbjct: 288 TRGGIKGFFPGIGPALLRSFPANAATFLGVELTHSLFKK 326

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 71/302 (23%), Positives = 121/302 (40%), Gaps = 26/302 (8%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74
           F AG VAG     V+ P + VK  + LQVQ     +  G+   ++++   EG   L++G 
Sbjct: 26  FLAGGVAGAVSRTVVSPFERVK--ILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGN 83

Query: 75  SSPILMEAPKRATKF----ACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVP 130
               +   P  A +F    AC  +   +     G E+L+    + +GA  G        P
Sbjct: 84  GLNCIRIFPYSAVQFVVYEACKKKLFHVNGNN-GQEQLTNTQRLFSGALCGGCSVVATYP 142

Query: 131 FELVKIRL-----------QDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWN 179
            +L+K RL           +  + S   P  + + +     +     GL   +W  +L  
Sbjct: 143 LDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSLGV 202

Query: 180 GGY----FGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST---PFDVVKSRIQ 232
             Y    F +  Q R     + +      ++L   +IG   G +  T   PFD+++ R Q
Sbjct: 203 VPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQ 262

Query: 233 NTAVIPGVVR-KYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDF 291
             A+    +  +Y     +L+TI R EG    YKG    + ++ P   +  +V+  V D 
Sbjct: 263 VLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVVCDS 322

Query: 292 CR 293
            R
Sbjct: 323 VR 324

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 97/204 (47%), Gaps = 22/204 (10%)

Query: 107 KLSQPLSMLAGASAGCVEAFVVVPFELVKI--RLQDASSSY-KGPVDVVRKIVAREGVLA 163
           K    ++ LAG  AG V   VV PFE VKI  ++Q +++SY +G    +R++   EG   
Sbjct: 19  KQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKG 78

Query: 164 MYNGLESTLWRHALWNGGYFGIIFQA---RALLPAAHNKTQCITND--LISDSI--GCSI 216
           ++ G      R   ++   F ++++A   +      +N  + +TN   L S ++  GCS+
Sbjct: 79  LFRGNGLNCIRIFPYSAVQF-VVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSV 137

Query: 217 GCMLSTPFDVVKSRIQ-NTAVIPGVVRKYNWSLPS-------LLTIYR-EEGFRALYKGF 267
             + + P D++K+R+   TA +  + R    S+         L   YR E G R LY+G 
Sbjct: 138 --VATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGV 195

Query: 268 VPKVLRLGPGGGILLVVFTGVLDF 291
            P  L + P   +   V+  + +F
Sbjct: 196 WPTSLGVVPYVALNFAVYEQLREF 219

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 81/185 (43%), Gaps = 29/185 (15%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYT---------GVVDCLKKIVAG 64
           + F+GA+ G   ++  YPLD++KTR+ +Q    +  + +         G+   L +    
Sbjct: 125 RLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRL 184

Query: 65  EGVGR-LYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKL-SQP------LSMLA 116
           EG  R LY+G+    L   P  A  FA  ++ ++     FGV    +QP        +  
Sbjct: 185 EGGLRGLYRGVWPTSLGVVPYVALNFAVYEQLRE-----FGVNSSDAQPSWKSNLYKLTI 239

Query: 117 GASAGCVEAFVVVPFELVKIRLQ-------DASSSYKGPVDVVRKIVAREGVLAMYNGLE 169
           GA +G V   +  PF+L++ R Q       +    Y    D +  I   EGV   Y GL 
Sbjct: 240 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLA 299

Query: 170 STLWR 174
           + L++
Sbjct: 300 ANLFK 304

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 2/80 (2%)

Query: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGA--GPHYTGVVDCLKKIVAGEGVGR 69
           LY+   GA++G     + YP D+++ R Q+   GG   G  YT V D L  I   EGV  
Sbjct: 234 LYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSG 293

Query: 70  LYKGISSPILMEAPKRATKF 89
            YKG+++ +    P  A  +
Sbjct: 294 YYKGLAANLFKVVPSTAVSW 313

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 89/359 (24%), Positives = 139/359 (38%), Gaps = 107/359 (29%)

Query: 4   SDTKSLPFLY-QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIV 62
           SDT   P LY    AG+ A V +  + +P + +KT  QL         +  +   +K   
Sbjct: 2   SDTN--PSLYSNLLAGSAAAVFQTTLSHPFEFLKTGQQLHRSLPNAEAF-NMFHHVKSYF 58

Query: 63  AGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSML----AGA 118
           AG         ++  IL+   K AT+FA  D+  +L K     E    P+S L    AG+
Sbjct: 59  AG------CSALNIGILL---KTATRFATFDKACQLLKDP---ENPEAPVSGLRLIAAGS 106

Query: 119 SAGCVEAFVVVPFELVKIRLQDA----SSSYKGPVDV----------------------- 151
             G +E+ +++PFE +K R+ +     S+ Y+  V+                        
Sbjct: 107 ITGFMESMLIIPFENIKTRMIENALILSNRYQEEVETGGKDKPRSKSVNNMETKEQIRPK 166

Query: 152 ------------------------------VRKIVAREGVLAMYNGLESTLWRHALWNGG 181
                                         VR++V   G    + G   T++R      G
Sbjct: 167 LYKQVKKEINPRYEKFLYYEKHPSTNIFTTVREMVQTRGFTTFFQGSMPTIFRQV----G 222

Query: 182 YFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCM-------LSTPFDVVKSRIQNT 234
              + F     L     K     N  +S+     IG         L+ P DVVK+R+Q+ 
Sbjct: 223 NSAVRFTTYTTL-----KQMISPNKPLSEYYAFGIGVFSSCAVVALTQPIDVVKTRMQS- 276

Query: 235 AVIPGVVRKYNWSL--PSLLTIYR---EEGFRALYKGFVPKVLRLGPGGGILLVVFTGV 288
                   KY WSL   SL  +YR   EEG  +L+KG+VP++ ++G  GG+   V+  V
Sbjct: 277 --------KYTWSLYRNSLNCVYRTFIEEGLTSLWKGWVPRLFKVGLSGGVSFGVYQYV 327

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 62.4 bits (150), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 118/288 (40%), Gaps = 33/288 (11%)

Query: 11  FLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRL 70
           F+    +GA AG S  L  +P+D +KTR  LQ +GG                A  G   +
Sbjct: 6   FIASLVSGAAAGTSTDLAFFPIDTLKTR--LQAKGG--------------FFANGGYKGV 49

Query: 71  YKGISSPILMEAPKRATKFACNDEFQKLYKQAFGV------EKLSQPLSMLAGASAGCVE 124
           Y+G+ S ++  AP  +  F   D  +   +   G       ++ +  LS +  +S G + 
Sbjct: 50  YRGLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEIS 109

Query: 125 AFVV-VPFELVKIRLQD--ASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGG 181
           A +V VP E++K R Q    +SS +    ++R          +Y G  +T+ R   +   
Sbjct: 110 ACMVRVPAEVIKQRTQTHRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREIPFTCI 169

Query: 182 YFGIIFQARALLPAAHNKTQCIT-NDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGV 240
            F +    +        K +       +   I   I    +TP DV+K+RI        +
Sbjct: 170 QFPLYEYMKKRWAEVQGKERAAPWQGSVCGCIAGGIAAAATTPLDVLKTRIM-------L 222

Query: 241 VRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGV 288
             K   +L    T+ +EEG +  + G  P+ + +  GG I L V+  V
Sbjct: 223 HHKSVSALHLAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYETV 270

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 62.0 bits (149), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 120/295 (40%), Gaps = 26/295 (8%)

Query: 10  PFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGE-GVG 68
           P   +  +G  AG    L+++PLD+ K R+QL +       Y  +     +IV  +  + 
Sbjct: 7   PLQKEVISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNL---WSEIVGSDLSLT 63

Query: 69  R-LYKGISSPILMEAPKRATKFA----CNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCV 123
           R LY+G++  ++         FA      D       +    + LS  + + A AS+G +
Sbjct: 64  RELYRGLTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGML 123

Query: 124 EAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTL---WRHALWNG 180
              +  P  ++K R+   ++S    + V+R ++  +GV  ++ GL   L    + AL   
Sbjct: 124 TTVLTNPLWVIKTRMMSKANSDLTSMKVLRDLIKNDGVQGLWKGLVPALVGVSQGAL--- 180

Query: 181 GYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST----PFDVVKSRIQNTAV 236
            +F      +  L   +  +  ITN  +      S+  MLST    PF ++KS +Q+   
Sbjct: 181 -HFTCYDTLKHKLVLKNRDSDEITN--LETIAVTSVSKMLSTSAVYPFQLLKSNLQSFQA 237

Query: 237 IPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDF 291
                +     LP    IY   G    YKG    +LR  P   I   ++     F
Sbjct: 238 SENDFKL----LPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYENFKSF 288

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 62.0 bits (149), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 118/257 (45%), Gaps = 29/257 (11%)

Query: 31  PLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFA 90
           PLD+VK R+Q+  +      YT  +   +KI+A EG  ++Y G  +  +  + + A K+ 
Sbjct: 38  PLDLVKCRLQVNPK-----LYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYG 92

Query: 91  CNDEFQKLYKQAF--GVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSY-KG 147
             + F+ LY      GV      + ++A A+A  +   ++ PFE +K++ Q     +   
Sbjct: 93  GYEYFKHLYSSWLSPGVT-----VYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNN 147

Query: 148 PVDVVRKIVAREGVL-AMYNGLESTLWRHALWNGGYF----GIIFQARALLPAAH---NK 199
            VD  +K+ A  G + A Y G+     R   +    F     I+ +  ++LP      N 
Sbjct: 148 VVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNA 207

Query: 200 TQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLP-SLLTIYREE 258
            Q I+   +   +   +   +S P DV+ S+I +        RK N S+  +   IY++ 
Sbjct: 208 LQQISVSFVGGYLAGILCAAVSHPADVMVSKINSE-------RKANESMSVASKRIYQKI 260

Query: 259 GFRALYKGFVPKVLRLG 275
           GF  L+ G + +++ +G
Sbjct: 261 GFTGLWNGLMVRIVMIG 277

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 67/150 (44%), Gaps = 8/150 (5%)

Query: 128 VVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIF 187
           + P +LVK RLQ     Y   +   RKI+A EG   +Y G  +T   ++L   G +G   
Sbjct: 36  ITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYE 95

Query: 188 QARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWS 247
             + L  +  +    +T  L++ +    +  ++  PF+ +K + Q T  +P      N  
Sbjct: 96  YFKHLYSSWLSPG--VTVYLMASATAEFLADIMLCPFEAIKVKQQTT--MPPFC---NNV 148

Query: 248 LPSLLTIYREE-GFRALYKGFVPKVLRLGP 276
           +     +Y E  G +A YKG VP   R  P
Sbjct: 149 VDGWKKMYAESGGMKAFYKGIVPLWCRQIP 178

>Scas_714.18
          Length = 305

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/304 (21%), Positives = 119/304 (39%), Gaps = 48/304 (15%)

Query: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGR-L 70
           L +  AG++AG     + YP D VK R+Q Q        +     C+K     EG+    
Sbjct: 13  LREILAGSIAGAIGKFIEYPFDTVKVRLQTQ----EAYMFPSTWSCIKYTYENEGILEGF 68

Query: 71  YKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVP 130
           Y+GI SP++  A + A  F   ++    +  AF  E  +  + +++   AG   +FV+ P
Sbjct: 69  YQGIESPLIGAALENAILFLAYNQCSS-FLNAF-TEFSAFLIILISAGFAGSCASFVLTP 126

Query: 131 FELVKIRLQDASSSYK--------------------------GPVDVVRKIVAREGVLAM 164
            EL+K +LQ ++  Y                             +  ++ I+  +G+  +
Sbjct: 127 VELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGL 186

Query: 165 YNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-- 222
           + G  ST  R ++ +  +F      +  L    ++       LIS   G + G   +   
Sbjct: 187 WQGQSSTFIRESIGSVVWFATYELMKQTLRDPKSEVNTTWQLLIS---GATAGLAFNGSV 243

Query: 223 -PFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGIL 281
            P D VKS +Q   +           + ++ +I   +G    Y+G    +LR  P    +
Sbjct: 244 FPADTVKSIMQTEHLAL---------METVRSILERDGVAGFYRGLGITLLRAVPSNAAV 294

Query: 282 LVVF 285
              +
Sbjct: 295 FYTY 298

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 85/200 (42%), Gaps = 27/200 (13%)

Query: 6   TKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQ----------------------V 43
           T+   FL    +   AG     V+ P++++K ++Q+                       +
Sbjct: 101 TEFSAFLIILISAGFAGSCASFVLTPVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGM 160

Query: 44  QGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAF 103
             G G H T ++  +K I+  +G+  L++G SS  + E+      FA  +  ++  +   
Sbjct: 161 VIGEGRH-TRIIPTIKSIIKEKGLFGLWQGQSSTFIRESIGSVVWFATYELMKQTLRDPK 219

Query: 104 GVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLA 163
                +  L +++GA+AG      V P + VK  +Q   + +   ++ VR I+ R+GV  
Sbjct: 220 SEVNTTWQL-LISGATAGLAFNGSVFPADTVKSIMQ---TEHLALMETVRSILERDGVAG 275

Query: 164 MYNGLESTLWRHALWNGGYF 183
            Y GL  TL R    N   F
Sbjct: 276 FYRGLGITLLRAVPSNAAVF 295

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 41/82 (50%), Gaps = 8/82 (9%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           +GA AG++    ++P D VK+ MQ +        +  +++ ++ I+  +GV   Y+G+  
Sbjct: 231 SGATAGLAFNGSVFPADTVKSIMQTE--------HLALMETVRSILERDGVAGFYRGLGI 282

Query: 77  PILMEAPKRATKFACNDEFQKL 98
            +L   P  A  F   ++  K+
Sbjct: 283 TLLRAVPSNAAVFYTYEKLSKI 304

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/308 (22%), Positives = 123/308 (39%), Gaps = 61/308 (19%)

Query: 27  LVMYPLDVVKTRMQ------------LQVQGG------------AGPHYTGVVDCLKKIV 62
           +V  P D+VKTR+Q            + +  G            AG H+   +  +  + 
Sbjct: 68  VVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVY 127

Query: 63  AGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGC 122
             EG   L+KG+   ++   P R+  F      + +Y +AF   + +  + ++A A+AG 
Sbjct: 128 KQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNGQETPMIHLMAAATAGW 187

Query: 123 VEAFVVVPFELVKIRLQ------DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHA 176
             A    P  L+K R+Q       +   YK   D ++ ++  EG   +Y GL ++     
Sbjct: 188 ATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSAS----- 242

Query: 177 LWNGGYFGII---------------------FQARALLPAAHN-KTQCITNDLISDSIGC 214
            + G   GI+                     +QA      +   K  C  +   S  +  
Sbjct: 243 -YLGSVEGILQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSG--SAGLAK 299

Query: 215 SIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRL 274
            +  + + P +VV++R++ T    G  RKY   + S   I +EEG  ++Y G  P ++R 
Sbjct: 300 FVASIATYPHEVVRTRLRQTPKENGK-RKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRT 358

Query: 275 GPGGGILL 282
            P   I+ 
Sbjct: 359 VPNSIIMF 366

>Scas_687.15*
          Length = 328

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 80/325 (24%), Positives = 131/325 (40%), Gaps = 71/325 (21%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQG-GAGPHYTGVVDCLKKIVAGEGVGRLYK 72
           Q  AG+ A V E  + YP + +KT  QL  +  GA P      + L+ I         + 
Sbjct: 11  QILAGSAAAVFETTLTYPFEFLKTGFQLHRRTVGAKP-----FEALRPIKV------YFA 59

Query: 73  GISSPILMEAPKRATKFACNDEFQKLYKQAFGVEK---LSQPLSMLAGASAGCVEAFVVV 129
           G ++  L    K + +FA  D+  ++ +    + K   L  P  +LAG   G VE+  ++
Sbjct: 60  GCTALNLSAIVKTSVRFATFDKACQILRDP-NLPKDSLLKGPRLLLAGILTGAVESLCII 118

Query: 130 PFELVKIRLQDASS--SYKGPVD------------------------------------- 150
           PFE VK+ + + S   S   P +                                     
Sbjct: 119 PFENVKVTMIENSLQLSESKPTEKEIAGTLKKKVTFHVAKPKQLSPQEQWRQVYSKYPSS 178

Query: 151 ----VVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITND 206
               VV++I    G+     G   T++R          + F A   L    + TQ + N+
Sbjct: 179 NIFSVVKEIYLTRGLRGFAQGAMPTVFRQV----SNSTVRFTAYTTLKQLISPTQPL-NE 233

Query: 207 LISDSIGCSIGCM---LSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRAL 263
           + +  IG    C    L+ P DVVK+R+Q+          Y  SL     ++ EEG  +L
Sbjct: 234 VYAFGIGLFSSCAVVALTQPIDVVKTRMQSKTA----HYFYKNSLNCAYRVFVEEGMVSL 289

Query: 264 YKGFVPKVLRLGPGGGILLVVFTGV 288
           +KG++P++ ++G  GGI   V+  V
Sbjct: 290 WKGWLPRLFKVGLSGGISFGVYQYV 314

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVA 63
           S T+ L  +Y F  G  +  + + +  P+DVVKTRMQ +    A   Y   ++C  ++  
Sbjct: 226 SPTQPLNEVYAFGIGLFSSCAVVALTQPIDVVKTRMQSKT---AHYFYKNSLNCAYRVFV 282

Query: 64  GEGVGRLYKG 73
            EG+  L+KG
Sbjct: 283 EEGMVSLWKG 292

>Scas_716.29
          Length = 316

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 131/299 (43%), Gaps = 39/299 (13%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYT-----GVVDCLKKIVAGEGVGR-L 70
           AG+V+G+    V+ PLD +K R+QL+      P YT     G++  +K ++  EG  R  
Sbjct: 28  AGSVSGLLARTVIAPLDTLKIRLQLR------PSYTGQAPSGLLKMMKGMILNEGGLRSF 81

Query: 71  YKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVP 130
           +KG     +M       +F+    +  L+ +   +    Q  S++ GA AG   +FV  P
Sbjct: 82  WKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMN--GQLQSLVVGALAGMTSSFVSYP 139

Query: 131 FELVKIRL---QDA--SSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGI 185
            ++++ R    QD   SS   G     ++I   EG+   + G  ++++   L     FG 
Sbjct: 140 TDVLRTRFIANQDVALSSLSHG----CKEIWNMEGIPGFFRGCTASMFTITLSASILFG- 194

Query: 186 IFQARALLPAAHNKTQCITNDL--ISDSIGCSIGCMLSTPFDVVKSRIQ----------- 232
            +++  +    ++K    TN L   + SI      M++ P D ++ RIQ           
Sbjct: 195 TYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNV 254

Query: 233 NTAVIPGVVRKYNWS--LPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVL 289
              ++  + + Y  +  +   L I R+EG  +LY+G    + +  P   + L  +  V+
Sbjct: 255 ENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVM 313

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 78/181 (43%), Gaps = 25/181 (13%)

Query: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLY 71
           L     GA+AG++   V YP DV++TR  +  Q  A    + +    K+I   EG+   +
Sbjct: 120 LQSLVVGALAGMTSSFVSYPTDVLRTRF-IANQDVA---LSSLSHGCKEIWNMEGIPGFF 175

Query: 72  KGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEK-LSQPLSMLAGASAGCVEAFVVVP 130
           +G ++ +       +  F   +   K+Y   +  E   +  L   A + +G     V  P
Sbjct: 176 RGCTASMFTITLSASILFGTYESI-KIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYP 234

Query: 131 FELVKIRLQDASS-----------------SYKGP--VDVVRKIVAREGVLAMYNGLEST 171
            + ++ R+Q  +S                 SYKG   + +   I+ +EG+L++Y G+  +
Sbjct: 235 LDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMS 294

Query: 172 L 172
           L
Sbjct: 295 L 295

 Score = 35.0 bits (79), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 82/206 (39%), Gaps = 43/206 (20%)

Query: 107 KLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYN 166
           K+SQ  S++AG+ +G +   V+ P + +KIRLQ    SY G         A  G+L M  
Sbjct: 21  KVSQ--SLVAGSVSGLLARTVIAPLDTLKIRLQ-LRPSYTGQ--------APSGLLKMMK 69

Query: 167 GL---ESTLWRHALWNGG---------YFGIIFQARALLPAAHNKTQCITNDLISDSIGC 214
           G+   E  L   + W G          Y G  F + +       +T  +   L S  +G 
Sbjct: 70  GMILNEGGL--RSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGA 127

Query: 215 SIG---CMLSTPFDVVKSR-IQNTAVIPGVVRKYNWSLPSLL----TIYREEGFRALYKG 266
             G     +S P DV+++R I N  V          +L SL      I+  EG    ++G
Sbjct: 128 LAGMTSSFVSYPTDVLRTRFIANQDV----------ALSSLSHGCKEIWNMEGIPGFFRG 177

Query: 267 FVPKVLRLGPGGGILLVVFTGVLDFC 292
               +  +     IL   +  +  +C
Sbjct: 178 CTASMFTITLSASILFGTYESIKIYC 203

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 44/100 (44%), Gaps = 14/100 (14%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQ----VQGGAGPHY-TGVVDCLK--------- 59
           ++ A +++GV+  +V YPLD ++ R+Q++    VQ        T +    K         
Sbjct: 217 RYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGL 276

Query: 60  KIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY 99
            I+  EG+  LY+G+S  +    P         +   +LY
Sbjct: 277 NILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316

>Kwal_23.5757
          Length = 307

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 110/258 (42%), Gaps = 25/258 (9%)

Query: 31  PLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFA 90
           PLD+VK R Q+         Y   +D  ++IV  EG  +++ G+ +  +  + + A K+ 
Sbjct: 39  PLDLVKCRRQVDAS-----LYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYG 93

Query: 91  CNDEFQKLYKQAFGVEKLSQPLS---MLAGASAGCVEAFVVVPFELVKIRLQDASSS--Y 145
             + F+  Y Q    E      +   + A ASA  +    + P+E +K+R Q A      
Sbjct: 94  GYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFA 153

Query: 146 KGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFG----IIFQARALLPAAHNKTQ 201
           +   D   K+V  EG  ++Y G+    +R   +    F     I+    A LP    +  
Sbjct: 154 RNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMS 213

Query: 202 CITNDLISDSIGCSIGCM---LSTPFDVVKSRIQNTAVIPGVVRKYNWS-LPSLLTIYRE 257
            +    +S + G   G +   +S P DV+ S++ N        RK   S L +   IY +
Sbjct: 214 QLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNE-------RKSGESTLQATSRIYGK 266

Query: 258 EGFRALYKGFVPKVLRLG 275
            GF  L+ G   ++L +G
Sbjct: 267 IGFPGLWNGLAVRILMIG 284

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 70/161 (43%), Gaps = 24/161 (14%)

Query: 128 VVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWN----GGYF 183
           V P +LVK R Q  +S YK  +D  R+IV  EG   ++ G+ +T   ++L      GGY 
Sbjct: 37  VTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYE 96

Query: 184 GIIFQARALLP--AAHNKTQCI------TNDLISDSIGCSIGCMLSTPFDVVKSRIQNTA 235
               Q   L+    AH+    I      + + I+D   C        P++ +K R Q TA
Sbjct: 97  FFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLC--------PWEAIKVR-QQTA 147

Query: 236 VIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
           V P   R       +   +   EGF +LYKG  P   R  P
Sbjct: 148 VPPPFARNV---FDAYSKMVGAEGFASLYKGITPLWFRQIP 185

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 65/158 (41%), Gaps = 9/158 (5%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           A A A     + + P + +K R Q  V     P    V D   K+V  EG   LYKGI+ 
Sbjct: 122 ASASAEFIADIFLCPWEAIKVRQQTAV---PPPFARNVFDAYSKMVGAEGFASLYKGITP 178

Query: 77  PILMEAPKRATKFACNDE-----FQKLYKQAFGVEKLSQ-PLSMLAGASAGCVEAFVVVP 130
               + P    KF   +      + +L      + +L Q  +S   G  AG + A V  P
Sbjct: 179 LWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHP 238

Query: 131 FELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGL 168
            +++  ++ +   S +  +    +I  + G   ++NGL
Sbjct: 239 ADVMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGL 276

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 72/314 (22%), Positives = 127/314 (40%), Gaps = 71/314 (22%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           AG+V+G+    + YP + +KT +QL         +  VV      V G  V   + G S+
Sbjct: 15  AGSVSGLFSATITYPFEFLKTGLQL---------HRNVVAAKPFEVLGYQVRTYFAGCSA 65

Query: 77  PILMEAPKRATKFACNDEFQK-LYKQAFGVEKLSQPLS----MLAGASAGCVEAFVVVPF 131
             +    K + +F   D+  + L   A   +    PLS    ++AGA  G +E+  ++PF
Sbjct: 66  VNIGVVMKTSLRFLAFDKASEWLRPPALAKDA---PLSGVQLLMAGALTGTMESLCIIPF 122

Query: 132 ELVKI-----------RLQDASSSYKG----------------------------PVDVV 152
           E VK+           RL   +S+ +G                            P +V+
Sbjct: 123 ENVKVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYEALFPEKLPTNVL 182

Query: 153 R---KIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLIS 209
               ++  + G+ A + G   TL R    +   F      +   P  +       N+  +
Sbjct: 183 TTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAPKEYQN-----NEYFA 237

Query: 210 DSIGCSIGCML---STPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKG 266
             +G    C +   + P DV+K+R+Q        V  Y  S+     I+ EEGF  L+KG
Sbjct: 238 TLLGLISSCAVVGATQPLDVIKTRMQ----AKDSVLLYRNSINCAYRIFVEEGFAMLWKG 293

Query: 267 FVPKVLRLGPGGGI 280
           ++P+++++G  G +
Sbjct: 294 WLPRLMKVGLSGSV 307

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 6/63 (9%)

Query: 14  QFFA---GAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRL 70
           ++FA   G ++  + +    PLDV+KTRMQ +    +   Y   ++C  +I   EG   L
Sbjct: 234 EYFATLLGLISSCAVVGATQPLDVIKTRMQAK---DSVLLYRNSINCAYRIFVEEGFAML 290

Query: 71  YKG 73
           +KG
Sbjct: 291 WKG 293

 Score = 31.2 bits (69), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 34/158 (21%), Positives = 59/158 (37%), Gaps = 27/158 (17%)

Query: 31  PLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFA 90
           P +V+ T  +L  Q G   ++ G +  L + V    V                 R T F 
Sbjct: 178 PTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVV-----------------RFTTFT 220

Query: 91  CNDEFQ-KLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQ--DASSSYKG 147
              +F  K Y+        ++  + L G  + C       P +++K R+Q  D+   Y+ 
Sbjct: 221 MLKQFAPKEYQN-------NEYFATLLGLISSCAVVGATQPLDVIKTRMQAKDSVLLYRN 273

Query: 148 PVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGI 185
            ++   +I   EG   ++ G    L +  L     FGI
Sbjct: 274 SINCAYRIFVEEGFAMLWKGWLPRLMKVGLSGSVSFGI 311

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 20/39 (51%)

Query: 254 IYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFC 292
           +YR+ G RA +KG +P ++R      +    FT +  F 
Sbjct: 188 LYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFA 226

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 119/283 (42%), Gaps = 36/283 (12%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEG---------- 66
           AG V GV  +L  +P D++K R Q           + ++   + +    G          
Sbjct: 27  AGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTVNGSLTTSLFFKN 86

Query: 67  -VGRLYKGISSPILMEAPKRATKFACNDEFQKL--YKQAFGVEKLSQPLSMLAGASAGCV 123
            V   YKG+  P++   P  A  F   D  ++L  +KQA        PL+    A+AG +
Sbjct: 87  SVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVTWKQA-----SDAPLTTAQMATAGFI 141

Query: 124 EA----FVVVPFELVKIRLQDASSSYKGP-VDVVRKIVAREGVLAMYNGLESTLWRHALW 178
            A     V  P E +K+ LQ  +S +KG  +   + IV+  GV +++NG  +TL R    
Sbjct: 142 SAIPTTLVTAPTERIKVVLQ-TNSEFKGSFIKAAKHIVSTGGVKSLFNGSLATLARDGPG 200

Query: 179 NGGYFGIIFQARALLP---AAHNKTQC-ITNDLISDSIGCSIGCMLSTPFDVVKSRIQNT 234
           +  YF     ++A L    A  +K +  + N  ++  I      ++  P D +K+R+Q  
Sbjct: 201 SALYFASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTRLQVA 260

Query: 235 AVIPGVVRKYNWSLPSLLTIYREE-GFRALYKGFVPKVLRLGP 276
                +V+           IY +  G +  + G  P +LR  P
Sbjct: 261 TTPISMVQATK-------DIYIQRGGIKGFFPGLGPALLRSFP 296

 Score = 35.4 bits (80), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 7/87 (8%)

Query: 16  FAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKI-VAGEGVGRLYKGI 74
            AG +AG+S  LV++P+D +KTR+Q+            +V   K I +   G+   + G+
Sbjct: 234 LAGGIAGMSMWLVVFPIDTIKTRLQVATTP------ISMVQATKDIYIQRGGIKGFFPGL 287

Query: 75  SSPILMEAPKRATKFACNDEFQKLYKQ 101
              +L   P  A  F   +     +K+
Sbjct: 288 GPALLRSFPANAATFLGVELTHAFFKK 314

 Score = 32.0 bits (71), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 3/75 (4%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNG-LEST 171
           +++AG   G        PF+L+K+R Q  S+  K  +D V  I+     L+  NG L ++
Sbjct: 24  ALVAGGVGGVCAVLTGHPFDLIKVRCQ--SNQAKSTMDAVSIILKEARSLSTVNGSLTTS 81

Query: 172 LWRHALWNGGYFGII 186
           L+      G Y G+I
Sbjct: 82  LFFKNSVKGFYKGVI 96

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 64/285 (22%), Positives = 116/285 (40%), Gaps = 33/285 (11%)

Query: 16  FAGAVAGVSEILVMYPLDVVKTRMQLQV---------QGGAGPH--YTGVVDCLKKIVAG 64
             GAVA     + +YPLD+ KT +Q QV         +G   P+  Y  VVDC+  I   
Sbjct: 8   LTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKE 67

Query: 65  EGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY--KQAFGVEKLSQ---PLS------ 113
           +G+  LY+G++   +    +    F      +K Y   +  G++ L     P++      
Sbjct: 68  KGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGPITPSTIEE 127

Query: 114 MLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREG---VLAMYNGLES 170
           ++ G +A  +      P  +V  R Q   S+       V K + RE    + A + GL +
Sbjct: 128 LVLGVAAASISQLFTSPMAVVATRQQTVHSAESAKFTNVIKDIYRENNGDITAFWKGLRT 187

Query: 171 TLWRHALWNGGYFGIIFQARALLPAAHNKTQCIT--NDLISDSIGCSIGCMLSTPFDVVK 228
            L      +  Y               N    ++   + I   +   I  +++ P  V K
Sbjct: 188 GLALTINPSITYASFQRLKEVFFHDHSNDAGSLSAVQNFILGVLSKMISTLVTQPLIVAK 247

Query: 229 SRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLR 273
           + +Q+         K+     +LL +Y+ EG ++L+KG +P++ +
Sbjct: 248 AMLQSAG------SKFTTFQEALLYLYKNEGLKSLWKGVLPQLTK 286

 Score = 34.3 bits (77), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 5/72 (6%)

Query: 3   SSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIV 62
           S+D  SL  +  F  G ++ +   LV  PL V K  +Q      AG  +T   + L  + 
Sbjct: 214 SNDAGSLSAVQNFILGVLSKMISTLVTQPLIVAKAMLQ-----SAGSKFTTFQEALLYLY 268

Query: 63  AGEGVGRLYKGI 74
             EG+  L+KG+
Sbjct: 269 KNEGLKSLWKGV 280

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 65/170 (38%), Gaps = 37/170 (21%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDA---SSS-------------YKGPVDVVRKIV 156
           S L GA A  +    V P +L K  +Q     SSS             YK  VD +  I 
Sbjct: 6   SALTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIF 65

Query: 157 AREGVLAMYNGLESTLWRHALWNGGY-FGIIFQARAL-------LPAAHNKTQCITNDLI 208
             +G+L +Y G+  T     + N  Y F   F  ++        L +  N+   IT   I
Sbjct: 66  KEKGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGPITPSTI 125

Query: 209 SDSI----GCSIGCMLSTPFDVVKSRIQN---------TAVIPGVVRKYN 245
            + +      SI  + ++P  VV +R Q          T VI  + R+ N
Sbjct: 126 EELVLGVAAASISQLFTSPMAVVATRQQTVHSAESAKFTNVIKDIYRENN 175

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/277 (24%), Positives = 124/277 (44%), Gaps = 23/277 (8%)

Query: 31  PLDVVKTRMQLQVQ--GGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATK 88
           P++ VKTR+QLQ +   G    Y+G    +  I   EG+  L +G++     +     ++
Sbjct: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSR 90

Query: 89  FACNDEFQKLY-------KQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDA 141
               D  +          ++ +G   L+   +  AGA+AG + A +  P +LVK R+Q  
Sbjct: 91  LGLYDPLRAALGGCVLSDRRTYGTAALAV--NATAGAAAGMIGAALGSPLQLVKTRMQAL 148

Query: 142 SSSYKGPV--DVVRKIVA---REGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAA 196
           +     P+   + R++VA     GV  +Y G+++ L R  + +     +   A+  L  +
Sbjct: 149 APRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEAL--S 206

Query: 197 HNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYR 256
            +    +    ++ ++     C+   PFDV  +R+ +     G+   Y   L  L    R
Sbjct: 207 RHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHR--GGL---YRGPLDCLCKTVR 261

Query: 257 EEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCR 293
           +EGF ALYKG + ++LR+ P   + L +    L   R
Sbjct: 262 QEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVR 298

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 77/181 (42%), Gaps = 13/181 (7%)

Query: 5   DTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAG 64
           +T  L  L  + AG + G+     +YP+D +K R+Q             ++   K +   
Sbjct: 289 ETGELSRLSTYVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYRE 348

Query: 65  EGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY----KQAFGVEKLSQPLSMLA---- 116
            G+   Y+G+   IL   P  A         ++ Y      A G+ +    +S L     
Sbjct: 349 GGLRLFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPM 408

Query: 117 GASAGCVEAFVVVPFELVKIRLQDASS-----SYKGPVDVVRKIVAREGVLAMYNGLEST 171
           GA +G V A VV P  L++ RLQ   +      Y G  DV RK V REG+  +Y GL  T
Sbjct: 409 GAFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPT 468

Query: 172 L 172
           L
Sbjct: 469 L 469

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 44/82 (53%), Gaps = 4/82 (4%)

Query: 18  GAVAGVSEILVMYPLDVVKTRMQLQVQGG-AGPH-YTGVVDCLKKIVAGEGVGRLYKGIS 75
           GA +G     V+YP+++++TR  LQ QG  A PH Y G  D  +K V  EG+  LYKG+ 
Sbjct: 409 GAFSGTVGATVVYPINLLRTR--LQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLV 466

Query: 76  SPILMEAPKRATKFACNDEFQK 97
             +    P  A  + C +  ++
Sbjct: 467 PTLAKVCPAVAISYLCYENLKR 488

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 102/231 (44%), Gaps = 24/231 (10%)

Query: 66  GVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVE------KLSQPLSMLAGAS 119
           G+   Y G    ++   P+ A KF     F+   +   G+E      +LS+  + +AG  
Sbjct: 248 GLRAFYLGNGLNVIKVFPESAMKFGS---FELAKRVLAGLEGCGETGELSRLSTYVAGGL 304

Query: 120 AGCVEAFVVVPFELVKIRLQDA--SSSYKGPVDVVR--KIVAREGVLAM-YNGLESTL-- 172
            G +  F V P + +K R+Q A   +  +G   +++  K + REG L + Y GL   +  
Sbjct: 305 GGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLGVGILG 364

Query: 173 -WRHALWNGGYFGII---FQARALLPAAHNKTQCITNDLISDSIGC---SIGCMLSTPFD 225
            + +A  + G F  +   +  R       ++ + + ++L+   +G    ++G  +  P +
Sbjct: 365 VFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGATVVYPIN 424

Query: 226 VVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
           ++++R+Q         R Y+          + EG   LYKG VP + ++ P
Sbjct: 425 LLRTRLQAQGTYAHPHR-YDGFQDVFRKTVQREGLPGLYKGLVPTLAKVCP 474

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/257 (23%), Positives = 112/257 (43%), Gaps = 24/257 (9%)

Query: 31  PLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFA 90
           PLD+VK R+Q+  Q      Y   +D  K IV  EG+ +++ G+ +  +  + + A K+ 
Sbjct: 35  PLDLVKCRLQVNPQ-----LYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYG 89

Query: 91  CNDEFQKLYKQAFGVE---KLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSY-K 146
             + F++ Y      E   +    + + A ASA  +   ++ P+E +K++ Q     + K
Sbjct: 90  GYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCK 149

Query: 147 GPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFG----IIFQARALLPAAHNK--- 199
             ++   KI A EG+  +Y G+     R   +    F     I+    A LP +  +   
Sbjct: 150 NFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSP 209

Query: 200 TQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSL-PSLLTIYREE 258
           +Q I    +   +   +  ++S P DV+ S++          RK   S+  +   IY   
Sbjct: 210 SQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNAD-------RKQGESMVEASKRIYSRI 262

Query: 259 GFRALYKGFVPKVLRLG 275
           GF  L+ G   ++  +G
Sbjct: 263 GFGGLWNGLPVRIFMIG 279

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 66/157 (42%), Gaps = 17/157 (10%)

Query: 128 VVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWN----GG-- 181
           V P +LVK RLQ     Y+  +D  + IV  EG+  ++ G+ +T   ++L      GG  
Sbjct: 33  VTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYE 92

Query: 182 YFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVV 241
           YF   +        AH     +   L + +    +  +L  P++ +K + Q T  IP   
Sbjct: 93  YFKQTYSNLLSPETAHRHRTAVY--LCASASAEFLADILLCPWEAIKVKQQTT--IPPFC 148

Query: 242 RKY--NWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
           + +   WS      I   EG   LYKG  P   R  P
Sbjct: 149 KNFLEGWS-----KITAAEGLSGLYKGITPLWCRQIP 180

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 69/158 (43%), Gaps = 10/158 (6%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           A A A     +++ P + +K + Q  +     P     ++   KI A EG+  LYKGI+ 
Sbjct: 118 ASASAEFLADILLCPWEAIKVKQQTTIP----PFCKNFLEGWSKITAAEGLSGLYKGITP 173

Query: 77  PILMEAPKRATKFACNDEF-QKLYKQAFGVEKLSQP-----LSMLAGASAGCVEAFVVVP 130
               + P    KF   +   + +Y +    ++   P     +S + G  AG + A V  P
Sbjct: 174 LWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHP 233

Query: 131 FELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGL 168
            +++  ++       +  V+  ++I +R G   ++NGL
Sbjct: 234 ADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGL 271

 Score = 28.5 bits (62), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 39/82 (47%), Gaps = 5/82 (6%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74
           F  G +AG+   +V +P DV+ +++    + G       +V+  K+I +  G G L+ G+
Sbjct: 217 FVGGYLAGILCAVVSHPADVMVSKVNADRKQGE-----SMVEASKRIYSRIGFGGLWNGL 271

Query: 75  SSPILMEAPKRATKFACNDEFQ 96
              I M     + ++   D F+
Sbjct: 272 PVRIFMIGTLTSFQWLIYDSFK 293

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 80/182 (43%), Gaps = 15/182 (8%)

Query: 5   DTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAG 64
           DTK L     + AG +AG++    +YP+D +K R+Q             +    K +   
Sbjct: 341 DTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFRE 400

Query: 65  EGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY--KQAFGVE------KLSQPLSMLA 116
            G+   Y+G++  I+   P  A         +K Y  KQA  +        LS  + +  
Sbjct: 401 GGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPM 460

Query: 117 GASAGCVEAFVVVPFELVKIRLQDASSSYKGPV------DVVRKIVAREGVLAMYNGLES 170
           GA +G V A VV P  L++ RLQ A  +Y  P       DV+ K + REG   ++ GL  
Sbjct: 461 GAFSGTVGASVVYPINLLRTRLQ-AQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVP 519

Query: 171 TL 172
           TL
Sbjct: 520 TL 521

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 75/312 (24%), Positives = 136/312 (43%), Gaps = 35/312 (11%)

Query: 4   SDTKSLPF-LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIV 62
           S T + PF   + F  A   +S IL+    D++       +   + P    +   +K + 
Sbjct: 241 SRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSP----LAKAVKSLY 296

Query: 63  AGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFG---VEKLSQPLSMLAGAS 119
              G+   Y G    ++   P+ + KF   +  +K+  +  G    + LS+  + +AG  
Sbjct: 297 RQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFSTYIAGGL 356

Query: 120 AGCVEAFVVVPFELVKIRLQDA--SSSYKGPVDVVR--KIVAREGVLAM-YNGLESTL-- 172
           AG    F V P + +K R+Q A   +  KG   + +  K + REG L + Y G+   +  
Sbjct: 357 AGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFREGGLRLFYRGVTVGIVG 416

Query: 173 -WRHALWNGGYFG------IIFQARAL-LPAAHNKTQCITNDLISDSIGC---SIGCMLS 221
            + +A  + G F       I  QA+ L LP    + Q   ++L+   +G    ++G  + 
Sbjct: 417 IFPYAALDLGTFSALKKWYIAKQAKTLNLP----QDQVTLSNLVVLPMGAFSGTVGASVV 472

Query: 222 TPFDVVKSRIQ--NTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGG 279
            P +++++R+Q   T   P V   YN     LL     EG++ L+KG VP + ++ P   
Sbjct: 473 YPINLLRTRLQAQGTYAHPYV---YNGFKDVLLKTLEREGYQGLFKGLVPTLAKVCPAVS 529

Query: 280 ILLVVFTGVLDF 291
           I  + +  +  F
Sbjct: 530 ISYLCYENLKKF 541

>Kwal_23.3042
          Length = 542

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 77/177 (43%), Gaps = 13/177 (7%)

Query: 5   DTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAG 64
           DT  L     + AG + GV   L +YP+D +K R+Q             ++   K +   
Sbjct: 338 DTAGLSRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKE 397

Query: 65  EGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY--KQA--FGVEK----LSQPLSMLA 116
            G+   Y+GI+  I+   P  A         +K Y  +QA   G+ +    +S    +L 
Sbjct: 398 GGLRIFYRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLM 457

Query: 117 GASAGCVEAFVVVPFELVKIRLQDASS-----SYKGPVDVVRKIVAREGVLAMYNGL 168
           GA +G V A  V P  L++ RLQ   +      Y G  DV+ K V REG   ++ GL
Sbjct: 458 GAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGL 514

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/232 (23%), Positives = 96/232 (41%), Gaps = 18/232 (7%)

Query: 66  GVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEK---LSQPLSMLAGASAGC 122
           G+   Y G     +   P+ A KF   +  ++L  Q  GV+    LS+  + LAG   G 
Sbjct: 297 GIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFSTYLAGGLGGV 356

Query: 123 VEAFVVVPFELVKIRLQDA--SSSYKGP---VDVVRKIVAREGVLAMYNGLE---STLWR 174
           +    V P + +K R+Q A  ++  KG    +   + +    G+   Y G+      ++ 
Sbjct: 357 MAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRIFYRGITVGIMGIFP 416

Query: 175 HALWNGGYFG------IIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVK 228
           +A  + G F       I  QAR         T      L+  +   ++G     P ++++
Sbjct: 417 YAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGTVGATAVYPVNLLR 476

Query: 229 SRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGI 280
           +R+Q         R YN     LL   + EG++ L+KG VP + ++ P   I
Sbjct: 477 TRLQAQGTFAHPHR-YNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCPAVSI 527

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 47/96 (48%), Gaps = 4/96 (4%)

Query: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGG-AGPH-YTGVVDCLKKI 61
            D  ++  ++    GA +G      +YP+++++TR  LQ QG  A PH Y G  D L K 
Sbjct: 444 EDQVTMSNMFVLLMGAFSGTVGATAVYPVNLLRTR--LQAQGTFAHPHRYNGFRDVLLKT 501

Query: 62  VAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQK 97
           V  EG   L+KG+   +    P  +  + C +  ++
Sbjct: 502 VQREGYQGLFKGLVPNLAKVCPAVSISYLCYENLKR 537

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 56.6 bits (135), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 82/177 (46%), Gaps = 13/177 (7%)

Query: 5   DTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAG 64
           DT  L  L  + AG + GV+    +YP+D +K R+Q           + ++   K++   
Sbjct: 313 DTSELSRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQ 372

Query: 65  EGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY--KQA--FGVEK----LSQPLSMLA 116
            G+   Y+G+   ++   P  A         +K Y  K+A   G+ +    +S  + +  
Sbjct: 373 GGIRLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPM 432

Query: 117 GASAGCVEAFVVVPFELVKIRLQDASS-----SYKGPVDVVRKIVAREGVLAMYNGL 168
           GA +G V A +V P  L++ RLQ   +     +Y G  DV++K + REG   ++ GL
Sbjct: 433 GAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGL 489

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 4/85 (4%)

Query: 18  GAVAGVSEILVMYPLDVVKTRMQLQVQGG-AGPH-YTGVVDCLKKIVAGEGVGRLYKGIS 75
           GA +G     ++YP+++++TR  LQ QG  A PH Y G  D LKK +  EG   L+KG+ 
Sbjct: 433 GAFSGTVGATLVYPINLLRTR--LQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLV 490

Query: 76  SPILMEAPKRATKFACNDEFQKLYK 100
             +    P  +  + C +  ++L K
Sbjct: 491 PNLAKVCPAVSISYLCYENLKRLMK 515

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/242 (20%), Positives = 107/242 (44%), Gaps = 22/242 (9%)

Query: 66  GVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVE---KLSQPLSMLAGASAGC 122
           G+   Y G    ++   P+ A KF   +  +++  +   V+   +LS+  + +AG   G 
Sbjct: 272 GLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRLSTYIAGGLGGV 331

Query: 123 VEAFVVVPFELVKIRLQDA--SSSYKGP---VDVVRKIVAREGVLAMYNGLE---STLWR 174
              F V P + +K R+Q A  +++ K     +   +++  + G+   Y G+      ++ 
Sbjct: 332 AAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLFYRGVHIGVMGIFP 391

Query: 175 HALWNGGYFGII---FQARALLPAAHNKTQCITNDLISDSIGC---SIGCMLSTPFDVVK 228
           +A  + G F  +   +  +        + + I ++LI   +G    ++G  L  P ++++
Sbjct: 392 YAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTVGATLVYPINLLR 451

Query: 229 SRIQ--NTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFT 286
           +R+Q   T   P     YN     L    + EG++ L+KG VP + ++ P   I  + + 
Sbjct: 452 TRLQAQGTYAHPHT---YNGFSDVLKKTIQREGYQGLFKGLVPNLAKVCPAVSISYLCYE 508

Query: 287 GV 288
            +
Sbjct: 509 NL 510

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 69/288 (23%), Positives = 108/288 (37%), Gaps = 44/288 (15%)

Query: 16  FAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAG------PHYTGVVDCLKKIVAGEGVGR 69
           F GAVA       +YPLD+ KT +Q Q +            Y  V+DC+ KI    G   
Sbjct: 8   FTGAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLG 67

Query: 70  LYKGISSPILMEAPK-----------RATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGA 118
           LY+G+++ +     +           R+  F       +L   +  +E LS    +  G 
Sbjct: 68  LYQGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIE-LSTIEELALGM 126

Query: 119 SAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRH--- 175
           SAG +   V  P  ++  R Q         +  V K +  E      NG  +  W+    
Sbjct: 127 SAGAMTQVVTNPISVISTRQQLTKDGEDASLKAVIKQIYEES-----NGDLTAFWKGFKV 181

Query: 176 --------ALWNGGY---FGIIFQARALLPAAHNKTQCIT-NDLISDSIGCSIGCMLSTP 223
                   A+  G Y     +I  A+ L  +    TQ     + +       I   ++ P
Sbjct: 182 ALVLSTNPAITYGSYQKLKSMILTAKGLSGSQKISTQLSAGENFLLGMFSKMISTFVTQP 241

Query: 224 FDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKV 271
             V K  +Q      G   K+      L  IY+ EGF +L+KG +P+V
Sbjct: 242 LIVAKITLQ------GKGSKFKTFQEVLQHIYQNEGFLSLWKGVIPQV 283

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 81/197 (41%), Gaps = 44/197 (22%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQ------DASSS-----YKGPVDVVRKIVAREGV 161
           S   GA A  + A  V P +L K  +Q      D+  S     YK  +D + KI  + G 
Sbjct: 6   SAFTGAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGF 65

Query: 162 LAMYNGLESTLWRHALWNGGYF---------GIIFQARALLPAAHNKTQCITNDLISD-S 211
           L +Y GL + +  + + N  YF           +F+A  L     + ++ I    I + +
Sbjct: 66  LGLYQGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRL--QLKDDSKFIELSTIEELA 123

Query: 212 IGCSIGCM---LSTPFDVVKSRIQNT-----AVIPGVVRKYNWSLPSLLTIYREEG--FR 261
           +G S G M   ++ P  V+ +R Q T     A +  V+++          IY E      
Sbjct: 124 LGMSAGAMTQVVTNPISVISTRQQLTKDGEDASLKAVIKQ----------IYEESNGDLT 173

Query: 262 ALYKGF-VPKVLRLGPG 277
           A +KGF V  VL   P 
Sbjct: 174 AFWKGFKVALVLSTNPA 190

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/289 (20%), Positives = 121/289 (41%), Gaps = 29/289 (10%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
               G   G++  + + PLD++KTR+Q Q +          +D   ++  G     L   
Sbjct: 13  HLIGGFFGGLTSAVALQPLDLLKTRIQ-QDKKATLWKNLKEIDSPLQLWRGTLPSALRTS 71

Query: 74  ISSPILME---------APKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVE 124
           I S + +          A +R    +  ++   +Y ++  + +L+   ++L GA A  + 
Sbjct: 72  IGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKSSSLPRLTMYENLLTGAFARGLV 131

Query: 125 AFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFG 184
            ++ +P  ++K+R +    +Y    + +  I  +EG+   + G  +T  R A + G Y  
Sbjct: 132 GYITMPITVIKVRYESTLYNYSSLKEAITHIYTKEGLFGFFRGFGATCLRDAPYAGLYVL 191

Query: 185 IIFQARALLPAA------HNKTQ-------CITNDLISDSIGCSIGCMLSTPFDVVKSRI 231
           +  +++ LLP        H   +         T +  S  +  S+   ++ PFD +K+R+
Sbjct: 192 LYEKSKQLLPMVLPSRFIHYNPEGGFTTYTSTTVNTTSAVLSASLATTVTAPFDTIKTRM 251

Query: 232 QNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGI 280
           Q   + P    K+  S  +  +I + E    L+ G   ++ R     GI
Sbjct: 252 Q---LEPS---KFTNSFNTFTSIVKNENVLKLFSGLSMRLARKAFSAGI 294

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 31/66 (46%)

Query: 120 AGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWN 179
           +  +   V  PF+ +K R+Q   S +    +    IV  E VL +++GL   L R A   
Sbjct: 233 SASLATTVTAPFDTIKTRMQLEPSKFTNSFNTFTSIVKNENVLKLFSGLSMRLARKAFSA 292

Query: 180 GGYFGI 185
           G  +GI
Sbjct: 293 GIAWGI 298

>Kwal_26.7972
          Length = 358

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/322 (20%), Positives = 133/322 (41%), Gaps = 56/322 (17%)

Query: 3   SSDTKSLPFLYQF-FAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHY-------TGV 54
           S D +S  ++ +   AG +AG     ++ PLD +K   Q      + PHY        G+
Sbjct: 18  SVDKRSAHYILRSGLAGGIAGSCAKTLIAPLDRIKILFQT-----SNPHYLKYSGSTMGL 72

Query: 55  VDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSM 114
           +     I A +G+   Y+G S+ ++   P  A KF   ++ +     +   E  ++ L+ 
Sbjct: 73  IRAGAHINAHDGIRGFYQGHSATLIRIFPYAAIKFIAYEQIRHFMIPSKEYETHARRLA- 131

Query: 115 LAGASAGCVEAFVVVPFELVKIRLQDASSSYK-GPVDVVRKIVAREGVLAM--------- 164
            +G+ AG    F+  P +L+++RL   +   +   + V+++I       ++         
Sbjct: 132 -SGSMAGLCSVFMTYPLDLIRVRLAYVTDRSRIKMLPVIKQIYTERASESLTSKSYVPRW 190

Query: 165 -------YNGLESTLWRHALWNGGYF------GIIFQARALLPAA-----------HNKT 200
                  Y G   T+     + G  F      G I ++ AL P +            +K 
Sbjct: 191 FAHWCNFYRGFTPTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIRSKK 250

Query: 201 QC-----ITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLL-TI 254
           Q         +L++  +        S PF++++ R+Q + V P  +  +  ++P ++  I
Sbjct: 251 QSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQ-TIPDMIRII 309

Query: 255 YREEGFRALYKGFVPKVLRLGP 276
           Y+E G+R  + G     +++ P
Sbjct: 310 YKERGWRGFFVGLSIGYIKVTP 331

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 73/192 (38%), Gaps = 31/192 (16%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSY-------KGPVDVVRKIVAREGVLAMY 165
           S LAG  AG     ++ P + +KI  Q ++  Y        G +     I A +G+   Y
Sbjct: 30  SGLAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFY 89

Query: 166 NGLESTLWRHALWNGGYFGIIFQARA-LLPAAHNKTQCITNDLISDSIGCSIGCMLSTPF 224
            G  +TL R   +    F    Q R  ++P+   +T      L S S+       ++ P 
Sbjct: 90  QGHSATLIRIFPYAAIKFIAYEQIRHFMIPSKEYETHA--RRLASGSMAGLCSVFMTYPL 147

Query: 225 DVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRAL----------------YKGFV 268
           D+++ R+          R     LP +  IY E    +L                Y+GF 
Sbjct: 148 DLIRVRLAYV-----TDRSRIKMLPVIKQIYTERASESLTSKSYVPRWFAHWCNFYRGFT 202

Query: 269 PKVLRLGPGGGI 280
           P VL + P  G+
Sbjct: 203 PTVLGMIPYAGV 214

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 35/77 (45%), Gaps = 1/77 (1%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPH-YTGVVDCLKKIVAGEGVGRLYK 72
           +  AG +AG++     YP ++++ R+Q+ V      H +  + D ++ I    G    + 
Sbjct: 261 ELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYKERGWRGFFV 320

Query: 73  GISSPILMEAPKRATKF 89
           G+S   +   P  A  F
Sbjct: 321 GLSIGYIKVTPMVACSF 337

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/326 (20%), Positives = 128/326 (39%), Gaps = 60/326 (18%)

Query: 2   SSSDTKSLPFLYQF-FAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYT-------G 53
           +S D  S  ++ +   AG ++G     ++ PLD +K   Q      + PHYT       G
Sbjct: 23  TSFDRNSFDYIVRSGLAGGISGSCAKTLIAPLDRIKILFQT-----SNPHYTKYTGSLIG 77

Query: 54  VVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLS 113
           +V+  K I   +GV   ++G S+ +L   P  A KF   ++ +     +   E  S    
Sbjct: 78  LVEAAKHIWINDGVRGFFQGHSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFE--SHWRR 135

Query: 114 MLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLA--MYNGLEST 171
           +++G+ AG    F+  P +LV++RL   +   +  +  + K + +E   A  + N     
Sbjct: 136 LVSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPN 195

Query: 172 LWRHALWNGGYFGIIFQARALLPA------AHNKTQCITN-------------------- 205
            + H  W   Y G +     ++P       AH+    +                      
Sbjct: 196 WFCH--WCNFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELER 253

Query: 206 -------------DLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLL 252
                        +LIS  +        + PF++++ R+Q +A+ P  +  + +   S +
Sbjct: 254 VQKKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEI 313

Query: 253 T--IYREEGFRALYKGFVPKVLRLGP 276
              I++E G R  + G     +++ P
Sbjct: 314 AHIIFKERGVRGFFVGLSIGYIKVTP 339

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 81/187 (43%), Gaps = 21/187 (11%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYK-------GPVDVVRKIVAREGVLAMY 165
           S LAG  +G     ++ P + +KI  Q ++  Y        G V+  + I   +GV   +
Sbjct: 36  SGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFF 95

Query: 166 NGLESTLWRHALWNGGYFGIIFQAR-ALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPF 224
            G  +TL R   +    F    Q R  L+P+   ++      L+S S+       ++ P 
Sbjct: 96  QGHSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFESHW--RRLVSGSLAGLCSVFITYPL 153

Query: 225 DVVKSRI----QNTAVIPGVVRKYNWSLPSLLTIYREE-------GFRALYKGFVPKVLR 273
           D+V+ R+    ++  V  G + K  +  P+  T+ + +        +   Y+G+VP VL 
Sbjct: 154 DLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPTVLG 213

Query: 274 LGPGGGI 280
           + P  G+
Sbjct: 214 MIPYAGV 220

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/307 (21%), Positives = 126/307 (41%), Gaps = 32/307 (10%)

Query: 2   SSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQL-QVQGGAGPHYTGVVDCLKK 60
           ++S++   P   +  +G  AG    +V +PLD++K R+QL  +      +Y  V   +K 
Sbjct: 3   ATSNSVLSPLQKEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKD 62

Query: 61  IVAGEGVGRL----YKGISSPILMEAPKRATKFA---CNDEF-------QKLYKQAFGVE 106
              G G  +L    Y+G+   I+  A      F    C+ +          L  +     
Sbjct: 63  ---GSGTQQLLKEAYRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDR 119

Query: 107 KLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSS--YKGPVDVVRKIVAREGVLAM 164
           K++  + +++  ++G   A +  P  ++K R+    SS  Y   ++ + +I   EG+   
Sbjct: 120 KMTSSMYLVSAGASGLATALLTNPMWVIKTRIMSTKSSQGYTSILNAITRIYTEEGLKTF 179

Query: 165 YNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLIS-DSIG-CSIGCMLST 222
           + GL  +L+   +  G  +  I+     L   H++       L + ++IG  S+  M+S 
Sbjct: 180 WRGLVPSLF--GVTQGALYFAIYDTLK-LKYLHDRNDIQERRLNAVETIGIISLSKMISV 236

Query: 223 ----PFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGG 278
               P  ++K+ +Q          K N  + S   I+   G    YKG    ++R  P  
Sbjct: 237 SSVYPLQLLKTNLQTFRTEHNENSKMNSLIRS---IWHTNGIAGFYKGLFANLVRAIPST 293

Query: 279 GILLVVF 285
            I   V+
Sbjct: 294 CITFGVY 300

>Scas_578.3*
          Length = 524

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 77/178 (43%), Gaps = 13/178 (7%)

Query: 8   SLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGV 67
            L  L  + AG +AGV   + +YP+D +K R+Q     G       ++   K++    G+
Sbjct: 323 DLSKLQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGI 382

Query: 68  GRLYKGISSPILMEAPKRATKFACNDEFQKLY-----KQAFGVEK---LSQPLSMLAGAS 119
              Y+G+    L   P  A         +K Y     K+    EK   LS  L +  GA 
Sbjct: 383 RVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAF 442

Query: 120 AGCVEAFVVVPFELVKIRLQDASS-----SYKGPVDVVRKIVAREGVLAMYNGLESTL 172
           +G V A  V P  L++ RLQ   +     +Y G  DV  + + REGV   Y GL  TL
Sbjct: 443 SGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTL 500

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (48%)

Query: 9   LPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVG 68
           L +L     GA +G      +YP+++++TR+Q Q        YTG  D   + +  EGV 
Sbjct: 431 LSYLLVLPMGAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVP 490

Query: 69  RLYKGISSPILMEAPKRATKFACNDEFQ 96
             YKG+   ++   P  +  + C ++F+
Sbjct: 491 GFYKGLVPTLVKVCPAVSIGYLCYEKFK 518

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/301 (18%), Positives = 115/301 (38%), Gaps = 38/301 (12%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKT---------------RMQLQVQG-GAGPHYTGVVDCL 58
           F AG ++GV       PLD +K                +M L++QG       + ++  +
Sbjct: 212 FIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKAI 271

Query: 59  KKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFG---VEKLSQPLSML 115
           + +    G+   Y G    +    P+ + KF   +  ++L     G   V  LS+  + +
Sbjct: 272 RSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVNDLSKLQTYV 331

Query: 116 AGASAGCVEAFVVVPFELVKIRLQDA--SSSYKGP---VDVVRKIVAREGVLAMYNGL-- 168
           AG  AG +    + P + +K R+Q A    + KG    +   +++    G+   Y G+  
Sbjct: 332 AGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRVFYRGVLL 391

Query: 169 -ESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISD--------SIGCSIGCM 219
               ++ +A  + G F  +   +  +     K      D++          +   ++G  
Sbjct: 392 GALGIFPYAALDLGTFSAL--KKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGTVGAT 449

Query: 220 LSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGG 279
              P +++++R+Q           Y       +   + EG    YKG VP ++++ P   
Sbjct: 450 AVYPINLLRTRLQAQGTYAHPY-TYTGFRDVFMQTLKREGVPGFYKGLVPTLVKVCPAVS 508

Query: 280 I 280
           I
Sbjct: 509 I 509

 Score = 31.2 bits (69), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 42/202 (20%), Positives = 81/202 (40%), Gaps = 30/202 (14%)

Query: 114 MLAGASAGCVEAFVVVPFELVKIRL---QDASSSYKGP------------------VDVV 152
            +AG  +G +      P + +K+ L    D SS+   P                  +  +
Sbjct: 212 FIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKAI 271

Query: 153 RKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDL----- 207
           R +  + G+ A Y G   ++++    +   FG    A+ L+  A+     + NDL     
Sbjct: 272 RSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLM--ANLSGDKLVNDLSKLQT 329

Query: 208 -ISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKG 266
            ++  I   +  +   P D +K RIQ  A + G ++     + +   +Y+E G R  Y+G
Sbjct: 330 YVAGGIAGVMAQISIYPIDTLKFRIQ-CAPLEGNLKGNALLISTAKEMYKEGGIRVFYRG 388

Query: 267 FVPKVLRLGPGGGILLVVFTGV 288
            +   L + P   + L  F+ +
Sbjct: 389 VLLGALGIFPYAALDLGTFSAL 410

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 66/324 (20%), Positives = 126/324 (38%), Gaps = 62/324 (19%)

Query: 5   DTKSLPFLYQF-FAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYT-------GVVD 56
           D  SL ++ +   AG V+G     ++ PLD +K   Q      + PHY+       G+ +
Sbjct: 11  DKNSLDYVVRSGLAGGVSGSCAKTLIAPLDRIKILFQ-----TSNPHYSKYAGSLVGLYE 65

Query: 57  CLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLA 116
             K I   +G+   ++G S  +L   P  A KF   ++ + +   +   E  S    + +
Sbjct: 66  AAKHIWINDGIRGFFQGHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYE--SHWRRLAS 123

Query: 117 GASAGCVEAFVVVPFELVKIRLQDASSSYKGPV-DVVRKIVAREGVLAMYNGLESTLWRH 175
           G+ AG    F+  P +L ++RL   +   +  + D+V+ I        + + L    W  
Sbjct: 124 GSLAGLCSVFITYPLDLTRVRLAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKW-F 182

Query: 176 ALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSI------------------- 216
           A W   Y G +     ++P A        +DLI D +  S+                   
Sbjct: 183 AHWCNFYRGYVPTVLGMIPYA--GVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKK 240

Query: 217 -------------------GCMLST---PFDVVKSRIQNTAVIPGVVRKYNWSLPSLLT- 253
                              G +  T   P ++++ R+Q + + P  +  + +   S +  
Sbjct: 241 LRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIAR 300

Query: 254 -IYREEGFRALYKGFVPKVLRLGP 276
            IY+E+G+R  + G     +++ P
Sbjct: 301 IIYQEKGWRGFFVGLSIGYIKVTP 324

 Score = 35.0 bits (79), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 79/207 (38%), Gaps = 33/207 (15%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYK-------GPVDVVRKIVAREGVLAMY 165
           S LAG  +G     ++ P + +KI  Q ++  Y        G  +  + I   +G+   +
Sbjct: 21  SGLAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFF 80

Query: 166 NGLESTLWRHALWNGGYFGIIFQARALL-PAAHNKTQCITNDLISDSIGCSIGCMLSTPF 224
            G   TL R   +    F    Q R++L P+   ++      L S S+       ++ P 
Sbjct: 81  QGHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHW--RRLASGSLAGLCSVFITYPL 138

Query: 225 DVVKSRIQNTAVIPGVVRKYNWSLPSLL-TIYRE---EGFRA-------------LYKGF 267
           D+ + R+        V       L  ++ TIY E   EG  +              Y+G+
Sbjct: 139 DLTRVRLAY------VTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGY 192

Query: 268 VPKVLRLGPGGGILLVVFTGVLDFCRA 294
           VP VL + P  G+       + D  ++
Sbjct: 193 VPTVLGMIPYAGVSFFAHDLIHDIMKS 219

>Kwal_55.21106
          Length = 328

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 72/301 (23%), Positives = 117/301 (38%), Gaps = 64/301 (21%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQ-------VQGGAGPH----------YTGVVDCLK 59
            GAVA     +V+YPLD+VKT +Q Q        + G  P           Y   +D L 
Sbjct: 9   TGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDALI 68

Query: 60  KIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQK---LYKQAFG-VEKLSQPLSML 115
           KI   +GV  LY+G+ + I+    +  + F      +K    YK   G + K S P  +L
Sbjct: 69  KIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPEELL 128

Query: 116 AGASAGCVEAFVVVPFELVKIRLQDASSSYKGPV-DVVRKIVAREGVLAMYNGLESTLWR 174
            G  A  V      P  ++  R Q ++S  KG   +V+ +I + +  +            
Sbjct: 129 LGIVAAAVSQIFTSPIGVISTRQQTSTSGSKGGFREVLHQIYSEQNNIT----------- 177

Query: 175 HALWNGGYFGIIFQAR-ALLPAAHNKTQCI----------TNDLISDSIGCS-------- 215
              W G    +I     ++  A++ K Q I             L+  S   S        
Sbjct: 178 -GFWRGFKVSLILTVNPSITFASYEKLQDIFITSKRAVDENGQLLETSGQLSPRQNFLLG 236

Query: 216 -----IGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPK 270
                I  +++ P  V K+ +Q T         +      LL +Y++EG  +L+KG  P+
Sbjct: 237 VFSKVISTLITQPLIVSKAYLQRTG------SNFQSFQQVLLYLYKQEGLISLWKGLAPQ 290

Query: 271 V 271
           +
Sbjct: 291 L 291

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 60/150 (40%), Gaps = 27/150 (18%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSS----------------------YKGPVD 150
           S + GA A  +   VV P +LVK  +Q  +                        YK  +D
Sbjct: 6   SAITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLD 65

Query: 151 VVRKIVAREGVLAMYNGLESTLWRHALWNGGYF---GIIFQA--RALLPAAHNKTQCITN 205
            + KI   +GVL +Y GL +++    L +  YF    I+ ++  R  L            
Sbjct: 66  ALIKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPE 125

Query: 206 DLISDSIGCSIGCMLSTPFDVVKSRIQNTA 235
           +L+   +  ++  + ++P  V+ +R Q + 
Sbjct: 126 ELLLGIVAAAVSQIFTSPIGVISTRQQTST 155

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 115/294 (39%), Gaps = 38/294 (12%)

Query: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPH-YTGVVDCLKKIVAGEGVGRL 70
           L+   AG+V+G+    V  P+D VK R QLQ+   A  H Y G++   + +   EGV  L
Sbjct: 25  LHAVVAGSVSGLVARSVTAPMDTVKIRRQLQL---ASEHKYHGILHTFRTVAREEGVRAL 81

Query: 71  YKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVP 130
           +KG      M     + +F     +  L   A       Q  S+  GA AG V + +  P
Sbjct: 82  WKGNVPASAMYVLYGSLQFGT---YAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYP 138

Query: 131 FELVKIRL-QDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQA 189
            +L++ RL  + S+ +       R I   EG    + G    +    L  G  FGI    
Sbjct: 139 LDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRGGAWAIAATTLTTGLIFGIY--- 195

Query: 190 RALLPAAHNKTQCITNDL-----ISDSIGCSIGCMLST---PFDVVKSRIQ--NTAVIPG 239
                    +T  I  D      ++ +   + G +      P D V+ R+Q  +   IP 
Sbjct: 196 ---------ETCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPF 246

Query: 240 VVR--------KYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
             R        +    L   + + R EG  +LYKG    + +  P   I L V+
Sbjct: 247 FTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVY 300

 Score = 40.4 bits (93), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 67/155 (43%), Gaps = 12/155 (7%)

Query: 80  MEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIR-- 137
           M A   + + A  D  +K        E +S   +++AG+ +G V   V  P + VKIR  
Sbjct: 1   MAASSGSPQLATEDHLRK-------GEAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQ 53

Query: 138 LQDASSS-YKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAA 196
           LQ AS   Y G +   R +   EGV A++ G       + L+    FG          +A
Sbjct: 54  LQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASA 113

Query: 197 HNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRI 231
               Q   + L   ++   +  +L+ P D++++R+
Sbjct: 114 GLPPQA--HSLAVGALAGLVSSLLTYPLDLLRTRL 146

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 70/180 (38%), Gaps = 27/180 (15%)

Query: 10  PFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGR 69
           P  +    GA+AG+   L+ YPLD+++TR+          H+  +    + I   EG   
Sbjct: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSA----HFFSLRRQARVIWDTEGPAG 172

Query: 70  LYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQP-LSMLAGASAGCVEAFVV 128
            ++G +  I       AT       F          +    P L+  A  +AG V    V
Sbjct: 173 FFRGGAWAIA------ATTLTTGLIFGIYETCTIAADTYGLPWLAAAASPTAGLVSKAAV 226

Query: 129 VPFELVKIRLQ--------------DASSSYKGP--VDVVRKIVAREGVLAMYNGLESTL 172
            P + V+ RLQ               A S+ +G   + +   +V  EG+ ++Y GL   L
Sbjct: 227 FPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMAL 286

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 14/93 (15%)

Query: 3   SSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYT---GVVDCLK 59
           ++DT  LP+L    A   AG+     ++PLD V+ R+Q+ V     P +T   G    L+
Sbjct: 201 AADTYGLPWLAAA-ASPTAGLVSKAAVFPLDTVRRRLQI-VDAKHIPFFTRDPGAYSALR 258

Query: 60  ---------KIVAGEGVGRLYKGISSPILMEAP 83
                     +V  EG+  LYKG++  +    P
Sbjct: 259 GTRFLGLAVHMVRAEGIASLYKGLTMALCKSTP 291

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 79/180 (43%), Gaps = 13/180 (7%)

Query: 6   TKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGE 65
           T  L     + AG + GV     +YP+D +K R+Q      A      ++   +++    
Sbjct: 310 TSELSKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDG 369

Query: 66  GVGRLYKGISSPILMEAPKRATKFACNDEFQKLY--KQA--FGVE----KLSQPLSMLAG 117
           G+   Y+G++  ++   P  A         +K Y  +QA   GV      +S  + +  G
Sbjct: 370 GLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMG 429

Query: 118 ASAGCVEAFVVVPFELVKIRLQDASS-----SYKGPVDVVRKIVAREGVLAMYNGLESTL 172
           A +G V A VV P  L++ RLQ   +     +Y G  DV+ K V REG   ++ GL   L
Sbjct: 430 AFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPNL 489

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 47/85 (55%), Gaps = 4/85 (4%)

Query: 18  GAVAGVSEILVMYPLDVVKTRMQLQVQGG-AGPH-YTGVVDCLKKIVAGEGVGRLYKGIS 75
           GA +G     V+YP+++++TR  LQ QG  A PH YTG  D L K V  EG   L+KG+ 
Sbjct: 429 GAFSGTVGATVVYPINLLRTR--LQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLV 486

Query: 76  SPILMEAPKRATKFACNDEFQKLYK 100
             +    P  +  + C + F++L K
Sbjct: 487 PNLAKVCPAVSISYLCYENFKRLMK 511

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/240 (22%), Positives = 102/240 (42%), Gaps = 34/240 (14%)

Query: 66  GVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVE---KLSQPLSMLAGASAGC 122
           G+   Y G    ++   P+ A KF   +  ++L     GV    +LS+  + +AG   G 
Sbjct: 268 GIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFSTYIAGGMGGV 327

Query: 123 VEAFVVVPFELVKIRLQDA--SSSYKGP---VDVVRKIVAREGVLAMYNGLE---STLWR 174
           V  F V P + +K R+Q A   ++ KG    +   R++    G+   Y G+      ++ 
Sbjct: 328 VAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKLFYRGVTVGVMGIFP 387

Query: 175 HALWNGGYFGII---FQARALLPAAHNKTQCITNDLISDSIGC---SIGCMLSTPFDVVK 228
           +A  + G F  +   + AR          Q   ++ I   +G    ++G  +  P ++++
Sbjct: 388 YAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFSGTVGATVVYPINLLR 447

Query: 229 SRIQNTAVIPGVVRKYNWSLPSLLTIYRE--------EGFRALYKGFVPKVLRLGPGGGI 280
           +R+Q             ++ P   T +R+        EG++ L+KG VP + ++ P   I
Sbjct: 448 TRLQAQGT---------YAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPNLAKVCPAVSI 498

 Score = 32.3 bits (72), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 43/202 (21%), Positives = 81/202 (40%), Gaps = 28/202 (13%)

Query: 114 MLAGASAGCVEAFVVVPFELVKIRL---QDASSS---------YKGPVDVVRKIVA---- 157
            +AG  +G +      PF+ +K+ L    D SS+          K P   + KI +    
Sbjct: 199 FIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIK 258

Query: 158 -------REGVLAMY--NGLES-TLWRHALWNGGYFGIIFQARALLPAAHNKTQCIT-ND 206
                  + G+ A Y  NGL    ++  +    G F +  Q  A L   H+ ++    + 
Sbjct: 259 AATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFST 318

Query: 207 LISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKG 266
            I+  +G  +      P D +K R+Q  A +   ++     + +   +YR+ G +  Y+G
Sbjct: 319 YIAGGMGGVVAQFSVYPIDTLKYRVQ-CAPLDTALKGNELLISTARQMYRDGGLKLFYRG 377

Query: 267 FVPKVLRLGPGGGILLVVFTGV 288
               V+ + P   + L  F+ +
Sbjct: 378 VTVGVMGIFPYAALDLGTFSAL 399

>Scas_328.1
          Length = 227

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 90/209 (43%), Gaps = 14/209 (6%)

Query: 83  PKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQ--- 139
           P +A  FA  D+ + ++    G  +L Q +    G    C  +F +V   L   + +   
Sbjct: 7   PTQALNFAFKDKIKAMFGFQQGKRRLYQMVYGECGIRWMCRCSFPIVCLFLRLCKNEIGS 66

Query: 140 DASS-------SYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARAL 192
           DA S        + G +DV +K +  +GVL +Y G   ++    ++ G YFG+    + +
Sbjct: 67  DAKSIKSGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPV 126

Query: 193 LPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLL 252
           L     +   + + L+  ++  S     S P D V+ R+  T+   G   KY  ++    
Sbjct: 127 LLTGSFENAFLPSFLLGWAVTIS-ASTTSYPLDTVRRRMMMTS---GQAVKYKGAIDCFQ 182

Query: 253 TIYREEGFRALYKGFVPKVLRLGPGGGIL 281
            I  +EG  +L+KG    + R     G++
Sbjct: 183 QIVSQEGVYSLFKGCGANIFRGVAAAGVI 211

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 11  FLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRL 70
           FL  F  G    +S     YPLD V+ RM +    G    Y G +DC ++IV+ EGV  L
Sbjct: 136 FLPSFLLGWAVTISASTTSYPLDTVRRRMMMT--SGQAVKYKGAIDCFQQIVSQEGVYSL 193

Query: 71  YKGISSPIL 79
           +KG  + I 
Sbjct: 194 FKGCGANIF 202

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 62/135 (45%), Gaps = 5/135 (3%)

Query: 43  VQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQA 102
           ++ GA   + G++D  KK +  +GV  LY+G    ++     R   F   D  + +    
Sbjct: 71  IKSGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLLTG 130

Query: 103 FGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSS---YKGPVDVVRKIVARE 159
              E    P S L G +     +    P + V+ R+   S     YKG +D  ++IV++E
Sbjct: 131 -SFENAFLP-SFLLGWAVTISASTTSYPLDTVRRRMMMTSGQAVKYKGAIDCFQQIVSQE 188

Query: 160 GVLAMYNGLESTLWR 174
           GV +++ G  + ++R
Sbjct: 189 GVYSLFKGCGANIFR 203

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 63/128 (49%), Gaps = 8/128 (6%)

Query: 146 KGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGII-FQARALLPAAHNKTQCIT 204
           K  ++ VR+I  +EGV+  Y GLES ++  A  +  Y+      ARA +    ++    +
Sbjct: 58  KSKLEAVREIYRKEGVVGFYYGLESAMYGMAANSLNYYYFYELAARATMRVRGSRRLNTS 117

Query: 205 NDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALY 264
             ++S ++  S+  + S P  VV +R+        V +    +L  LL I R++G  AL+
Sbjct: 118 EAILSSAVAGSMTAIASNPIWVVNTRMT-------VAKSEQSTLAVLLDIVRKDGVTALF 170

Query: 265 KGFVPKVL 272
            G  P ++
Sbjct: 171 NGLRPALM 178

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 66/143 (46%), Gaps = 2/143 (1%)

Query: 31  PLDVVKTRMQLQVQGGA-GPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKF 89
           PL  + TRMQ+  Q    G      ++ +++I   EGV   Y G+ S +   A      +
Sbjct: 36  PLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMAANSLNYY 95

Query: 90  ACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPV 149
              +   +   +  G  +L+   ++L+ A AG + A    P  +V  R+  A S  +  +
Sbjct: 96  YFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRMTVAKSE-QSTL 154

Query: 150 DVVRKIVAREGVLAMYNGLESTL 172
            V+  IV ++GV A++NGL   L
Sbjct: 155 AVLLDIVRKDGVTALFNGLRPAL 177

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 26/62 (41%)

Query: 13  YQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYK 72
           + F  GAV  ++     YP   +KTRM L            +   +  IV  EG+  LY 
Sbjct: 210 WAFLLGAVGKLAATGSTYPYITLKTRMHLAKGKEDADTQQSMWSLMVDIVKKEGIQGLYH 269

Query: 73  GI 74
           GI
Sbjct: 270 GI 271

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 73/336 (21%), Positives = 126/336 (37%), Gaps = 85/336 (25%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAG---EGVGRLYKG 73
           AG+ A V +  + YP + +KT +QL  +     H   ++   K   +G     VG L+K 
Sbjct: 100 AGSCASVFQTTISYPFEFLKTGLQLH-RSLPNAHPFNMMHQFKYYFSGCAALNVGTLFKT 158

Query: 74  ISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFEL 133
           ++     E        AC    Q L   +     +S P  ++AGA  G +E+  VVPFE 
Sbjct: 159 VTRFTTFEK-------AC----QLLKDPSSPSAFISGPRLLMAGAITGFMESLWVVPFEN 207

Query: 134 VKI---------------RLQDASSSYKGP------------------------------ 148
           +K                 ++D   +  G                               
Sbjct: 208 IKTTMVENALVLSGRFQKEIEDKGKAETGSKREVRATFHKQTPGISPRERLFLHYEEHPT 267

Query: 149 ---VDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITN 205
                 V++I    G+     G   T++R    +   F      + L+  + NK     N
Sbjct: 268 SRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLI--SPNKP---LN 322

Query: 206 DLISDSIGCSIGCML---STPFDVVKSRIQNTAVIPGVVRKYNW-----SLPSLLTIYRE 257
           +  +  +G    C +   + P DV+K+R+Q+         KY W     SL     I+ E
Sbjct: 323 EYYAFVLGFISSCAVVAVTQPIDVIKTRMQS---------KYAWANYKNSLNCAYRIFVE 373

Query: 258 EGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCR 293
           EG    +KG+ P+++++G  GG+   V+  V +  +
Sbjct: 374 EGIPKFWKGWAPRLMKVGLSGGVSFGVYQYVENLIK 409

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 4/78 (5%)

Query: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVA 63
           S  K L   Y F  G ++  + + V  P+DV+KTRMQ +    A  +Y   ++C  +I  
Sbjct: 316 SPNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKY---AWANYKNSLNCAYRIFV 372

Query: 64  GEGVGRLYKGISSPILME 81
            EG+ + +KG  +P LM+
Sbjct: 373 EEGIPKFWKGW-APRLMK 389

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 61/145 (42%), Gaps = 6/145 (4%)

Query: 58  LKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAG 117
           +K+I    G+    +G +  I  +    A +F      ++L       + L++  + + G
Sbjct: 274 VKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLISPN---KPLNEYYAFVLG 330

Query: 118 ASAGCVEAFVVVPFELVKIRLQD--ASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRH 175
             + C    V  P +++K R+Q   A ++YK  ++   +I   EG+   + G    L + 
Sbjct: 331 FISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIFVEEGIPKFWKGWAPRLMKV 390

Query: 176 ALWNGGYFGIIFQARALLP-AAHNK 199
            L  G  FG+      L+   AH K
Sbjct: 391 GLSGGVSFGVYQYVENLIKLMAHEK 415

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 75/184 (40%), Gaps = 25/184 (13%)

Query: 10  PFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGR 69
           P LY    G++AG++  L  YP DV++TR     QG        + D +  I + EG+  
Sbjct: 106 PQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQG----QLIKLRDEIMAIWSHEGLMG 161

Query: 70  LYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSM---LAGASAGCVEAF 126
            + G  S ++      A  F   +  +   ++   +     P ++   LAG  +G     
Sbjct: 162 FFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKL 221

Query: 127 VVVPFELVKIRLQ----------------DASSSYKGP--VDVVRKIVAREGVLAMYNGL 168
              P + V+ R+Q                D   SYK    + V   +V +EG L++Y G+
Sbjct: 222 ATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281

Query: 169 ESTL 172
             +L
Sbjct: 282 TMSL 285

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/222 (22%), Positives = 88/222 (39%), Gaps = 14/222 (6%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           AG+++G+     + PLD VK ++Q+       PH     + L  I+  EG+   +KG   
Sbjct: 21  AGSLSGLFARTCIAPLDTVKIKLQVT------PHNKN-ANVLINILKREGIRGFWKGNVP 73

Query: 77  PILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKI 136
             +M       +F          +    +    Q  S L G+ AG   +    PF++++ 
Sbjct: 74  GSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRT 133

Query: 137 RLQDASSSYKGPV-DVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGI-----IFQAR 190
           R    S      + D +  I + EG++  ++G  S++    L     FG+     IF   
Sbjct: 134 RFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEE 193

Query: 191 ALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQ 232
               +       + N+L +  I      + + P D V+ RIQ
Sbjct: 194 RSKLSDRRDPFTLLNEL-AGPISGFTSKLATFPLDTVRRRIQ 234

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 82/190 (43%), Gaps = 12/190 (6%)

Query: 106 EKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMY 165
           E++S   S++AG+ +G      + P + VKI+LQ   + +    +V+  I+ REG+   +
Sbjct: 11  EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQ--VTPHNKNANVLINILKREGIRGFW 68

Query: 166 NGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIG---CMLST 222
            G       + ++ G  FG      + L    +    I+  L S  +G   G    + S 
Sbjct: 69  KGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLN--ISPQLYSCLVGSLAGMTSSLASY 126

Query: 223 PFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILL 282
           PFDV+++R    A   G + K       ++ I+  EG    + G    ++ +G    I+ 
Sbjct: 127 PFDVLRTRF--AANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMF 181

Query: 283 VVFTGVLDFC 292
            V+  +  F 
Sbjct: 182 GVYESIKIFT 191

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 39/96 (40%), Gaps = 13/96 (13%)

Query: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKK--- 60
           SD +    L    AG ++G +  L  +PLD V+ R+Q++       H       + K   
Sbjct: 198 SDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYK 257

Query: 61  ----------IVAGEGVGRLYKGISSPILMEAPKRA 86
                     +V  EG   LY+G++  ++   P  A
Sbjct: 258 NRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTA 293

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 70/309 (22%), Positives = 116/309 (37%), Gaps = 68/309 (22%)

Query: 18  GAVAGVSEILVMYPLDVVKTRMQLQVQG------------------------------GA 47
           GA A     + +YPLD+ KT +Q Q++                                A
Sbjct: 9   GATASSLANIAVYPLDLAKTLVQTQLKDEFVEAGEEAGEERAGSRRQNRIKPIALRSPQA 68

Query: 48  GPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY---KQAFG 104
              Y G +D L++I   EGV  LY+G+ S  +    +  + F      +K Y   KQA G
Sbjct: 69  AEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQARG 128

Query: 105 VE-KLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVD---VVRKIVAREG 160
            + + S P  ++ G  A       V P  +V  R Q       G  D   V R++ A  G
Sbjct: 129 GDARFSTPEELVLGIVAAATSQLFVNPINVVATR-QQTRGQAAGAADMRTVAREVHAENG 187

Query: 161 VLAMYNGLESTL---------------WRHALW-NGGYFGIIFQARALLPAAHNKTQCIT 204
               + GL+ +L                R AL+        +  + ALL    N    + 
Sbjct: 188 WRGFWAGLKVSLVLTVNPSITYATYERLREALFPTPAAASHLVDSAALLSPGQNFVMGVL 247

Query: 205 NDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALY 264
           + ++S         +L+ P  + K+ +Q +       + ++  L  L   Y  EG  +L+
Sbjct: 248 SKIVS--------TVLTQPLIIAKASLQRSG---SCFQDFHQVLHHL---YSTEGPLSLW 293

Query: 265 KGFVPKVLR 273
           KG  P++ +
Sbjct: 294 KGLGPQITK 302

 Score = 35.0 bits (79), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 61/156 (39%), Gaps = 24/156 (15%)

Query: 134 VKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLEST------------LWRHALWNGG 181
           + +R   A+  YKG +D +++I   EGV  +Y GL S+             W + L    
Sbjct: 61  IALRSPQAAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFW-YTLVRKH 119

Query: 182 YFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVV 241
           YF +  QAR       +       +L+   +  +   +   P +VV +R Q      G  
Sbjct: 120 YFRLK-QAR-----GGDARFSTPEELVLGIVAAATSQLFVNPINVVATRQQTRGQAAGAA 173

Query: 242 RKYNWSLPSLLTIYREEGFRALYKGF-VPKVLRLGP 276
                +      ++ E G+R  + G  V  VL + P
Sbjct: 174 DMRTVARE----VHAENGWRGFWAGLKVSLVLTVNP 205

>Kwal_55.21338
          Length = 323

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 64/141 (45%), Gaps = 10/141 (7%)

Query: 134 VKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQA--RA 191
            K++ QDA        D ++ I  ++G +  + GLES L+   L N  Y+   ++A  R 
Sbjct: 48  TKLQTQDAKGEKLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYY-YCYEASSRC 106

Query: 192 LLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSL 251
           +L A H +       ++  SI  S+    + P  V  +R+        V +    +L ++
Sbjct: 107 VLRARHTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMT-------VQKSDRGTLSTI 159

Query: 252 LTIYREEGFRALYKGFVPKVL 272
             I ++EG   L+KG  P ++
Sbjct: 160 FDIVKDEGISGLFKGLNPALI 180

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 72/175 (41%), Gaps = 14/175 (8%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKK 60
           + +  T+ L        G++AG        PL V  TRM +Q          G +  +  
Sbjct: 108 LRARHTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQKSD------RGTLSTIFD 161

Query: 61  IVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASA 120
           IV  EG+  L+KG+ +P L+       ++   ++ +     +     LS   + + GA  
Sbjct: 162 IVKDEGISGLFKGL-NPALILVINPIIQYTVYEQLKNWILSSRQTRTLSPSWAFILGAVG 220

Query: 121 GCVEAFVVVPFELVKIRLQ---DASSSYKGP----VDVVRKIVAREGVLAMYNGL 168
                    P+  +K R+    +  SS   P    + ++ +I+ ++G+L +Y G+
Sbjct: 221 KLAATGSTYPYVTMKARMHLLGEHKSSTAAPPRSLLSLMAEIIKKDGILGLYRGI 275

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 77/329 (23%), Positives = 124/329 (37%), Gaps = 78/329 (23%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQ--VQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74
           AGA A V +  + +P + +KT  QL   + G A  +            A   VG L K  
Sbjct: 26  AGAAAAVFQTTMSHPFEFLKTGQQLHRALPGAAAFNMLHPFKYYFSGCAALNVGTLLK-- 83

Query: 75  SSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLS----MLAGASAGCVEAFVVVP 130
                       T+FA    F++        E   QP++    +LAGA  G +E+  VVP
Sbjct: 84  ----------TGTRFAT---FEQACVWLRDPEHADQPIAGPRLLLAGAITGFLESLWVVP 130

Query: 131 FELVKI-----------RLQ-----DASSSYKGPVD------------------------ 150
           FE +K            R+Q      A++  KGP                          
Sbjct: 131 FESIKTTAVENALELSRRVQGEPETRAAAVSKGPAPKATFHAARPVQTAHERWLLHYERQ 190

Query: 151 -------VVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCI 203
                   V +I    GV     G   T++R      G   + F   A +  + +  + +
Sbjct: 191 PSSHFAGTVLEIYRTRGVRGFLQGAMPTIFRQL----GNSVVRFTTYAWIVQSLSPHKAL 246

Query: 204 T--NDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFR 261
                  + ++  +    L+ P DV+K+R+Q+          Y  SL     I+ EEGFR
Sbjct: 247 DEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAW----FTYKSSLNCAYRIFVEEGFR 302

Query: 262 ALYKGFVPKVLRLGPGGGILLVVFTGVLD 290
            ++KG+VP++ ++   GGI   V+  V +
Sbjct: 303 YMWKGWVPRLFKVSLSGGISFGVYQYVEN 331

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 3/72 (4%)

Query: 2   SSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKI 61
           S S  K+L     F AGA++  + + +  P+DV+KTRMQ +    A   Y   ++C  +I
Sbjct: 239 SLSPHKALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKT---AWFTYKSSLNCAYRI 295

Query: 62  VAGEGVGRLYKG 73
              EG   ++KG
Sbjct: 296 FVEEGFRYMWKG 307

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 72/312 (23%), Positives = 127/312 (40%), Gaps = 47/312 (15%)

Query: 5   DTKSLPFLYQFFA-GAVAGVSEILVM-YPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIV 62
           D +  P  +   A GA   + E+  +  PL+V KT M    Q        G    ++ + 
Sbjct: 9   DLQKKPVSFSNIALGAALNMCEVTTLGQPLEVTKTTMAANRQ-------FGFSQAVRHVW 61

Query: 63  AGEGVGRLYKGISSPILMEAPKRATKF-----ACNDEFQKLYKQAFGVEKLSQPLSMLAG 117
           +  GV   Y+G+     +EA  +             +F++L    FG         +L G
Sbjct: 62  SRGGVFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYQFRRLGLSNFGA-------GILGG 114

Query: 118 ASAGCVEAFVVVPF----ELVKIRLQDASSSYKGPV----DVVRKIVAREGVLAMYNGLE 169
            S G  +A++ + F    + V+I    A+S+   PV     V ++I A EG+  +  G+ 
Sbjct: 115 VSGGVAQAYLTMGFCTCMKTVEITRSKAASAPGVPVPSSLQVFKQIFAAEGLRGINKGVN 174

Query: 170 STLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLIS---DSIGCSIGCMLST---P 223
           +   R     G  FG+   +R +       T   +++ +S     +  ++G  LS    P
Sbjct: 175 AVAIRQMTNWGSRFGL---SRLVEDGIRRVTHKRSDEKLSAMEKIVASALGGGLSAWNQP 231

Query: 224 FDVVKSRIQNTAVIPGVVRKYNWSL-PSLLTIYREEGFRALYKGFVPKVLRLGPGGGILL 282
            +V++  +Q+    P   R  N ++  +   IY   G R LY+G  P++     G G+  
Sbjct: 232 IEVIRVEMQSRTNDPN--RPKNLTVGKTFRYIYENNGLRGLYRGVTPRI-----GLGVWQ 284

Query: 283 VVF-TGVLDFCR 293
            +F  G  D  R
Sbjct: 285 TIFMVGFGDIAR 296

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/288 (19%), Positives = 110/288 (38%), Gaps = 37/288 (12%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
               G   G+   +++ P D++KTR+Q           + +   LK I   E   +L++G
Sbjct: 10  HLIGGFSGGLVSAIILQPFDLLKTRLQQD-------KTSTLWKTLKSI---ETPSQLWRG 59

Query: 74  ISSPILMEAPKRATKFACNDEFQKLYKQAFG--------VEKLSQPLSMLAGASAGCVEA 125
                +  +   A      +  ++   +           + +L+   +M +GA    +  
Sbjct: 60  ALPSCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTG 119

Query: 126 FVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGI 185
            + +P  ++K+R +     Y         I   EG+   + G  +T  R A + G Y   
Sbjct: 120 LITMPITVIKVRYESTLYQYTSLRYATSHIFRTEGLRGFFRGFGATALRDAPYAGLYMLF 179

Query: 186 IFQARALLPA----------AHNKTQCITNDLISDSIGCS---IGCMLSTPFDVVKSRIQ 232
             + + L+P           + N+     + LI+ S   S   I   ++ PFD VK+R+Q
Sbjct: 180 YDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITAPFDTVKTRMQ 239

Query: 233 NTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGI 280
              + P    K++    +   I  +E  R L+ G   ++ R     GI
Sbjct: 240 ---LEPA---KFHSFTSTFWHIATKESVRNLFAGISLRLTRKAFSAGI 281

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/189 (20%), Positives = 82/189 (43%), Gaps = 20/189 (10%)

Query: 106 EKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMY 165
           E+      ++ G S G V A ++ PF+L+K RLQ   +S      + + + + E    ++
Sbjct: 3   EQRRATTHLIGGFSGGLVSAIILQPFDLLKTRLQQDKTS-----TLWKTLKSIETPSQLW 57

Query: 166 NGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQC---------ITNDLISDSIGCSI 216
            G   +  R ++ +  Y  ++   R  +    N             +  ++ S ++  ++
Sbjct: 58  RGALPSCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRAL 117

Query: 217 GCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
             +++ P  V+K R ++T      + +Y     +   I+R EG R  ++GF    LR  P
Sbjct: 118 TGLITMPITVIKVRYEST------LYQYTSLRYATSHIFRTEGLRGFFRGFGATALRDAP 171

Query: 277 GGGILLVVF 285
             G+ ++ +
Sbjct: 172 YAGLYMLFY 180

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 78/198 (39%), Gaps = 20/198 (10%)

Query: 3   SSDTKSLPFLYQF---FAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLK 59
           S+ +  LP L  +   F+GAV      L+  P+ V+K R +  +       YT +     
Sbjct: 93  STGSSYLPQLNMYENMFSGAVTRALTGLITMPITVIKVRYESTLY-----QYTSLRYATS 147

Query: 60  KIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAF--GVEKLSQ------- 110
            I   EG+   ++G  +  L +AP         D  + L        V KL+        
Sbjct: 148 HIFRTEGLRGFFRGFGATALRDAPYAGLYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTY 207

Query: 111 PLSMLAGA---SAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNG 167
             +++ G+   SA  +   +  PF+ VK R+Q   + +         I  +E V  ++ G
Sbjct: 208 ASTLINGSSAFSAAVIATSITAPFDTVKTRMQLEPAKFHSFTSTFWHIATKESVRNLFAG 267

Query: 168 LESTLWRHALWNGGYFGI 185
           +   L R A   G  +GI
Sbjct: 268 ISLRLTRKAFSAGIAWGI 285

>Scas_697.47
          Length = 328

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 80/188 (42%), Gaps = 11/188 (5%)

Query: 2   SSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKI 61
           S S +  L       AG ++ +   LV  P +    R+++ +Q       T  +   K I
Sbjct: 131 SDSSSAQLTMGQMAAAGFISAIPTTLVTAPTE----RIKVVLQTAGANSKTSFIGAAKNI 186

Query: 62  VAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQK-LYKQAFGVEKLSQPLSM----LA 116
           V   GV  L+KG  + +  + P  A  FA  +  +K L  +    E  +  +++    LA
Sbjct: 187 VKDGGVKSLFKGSLATLARDGPGSALYFASYEISKKFLNDRNATAESKTGEVNIANVCLA 246

Query: 117 GASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKI-VAREGVLAMYNGLESTLWRH 175
           G  AG     VV P + +K +LQ +S S +  V   R+I V R G+   + GL   L R 
Sbjct: 247 GGIAGMSMWLVVFPIDTIKTKLQSSSGS-QSMVAATREIYVKRGGIKGFFPGLGPALLRS 305

Query: 176 ALWNGGYF 183
              N   F
Sbjct: 306 FPANAATF 313

 Score = 34.3 bits (77), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 7/87 (8%)

Query: 16  FAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKI-VAGEGVGRLYKGI 74
            AG +AG+S  LV++P+D +KT++Q      +      +V   ++I V   G+   + G+
Sbjct: 245 LAGGIAGMSMWLVVFPIDTIKTKLQ------SSSGSQSMVAATREIYVKRGGIKGFFPGL 298

Query: 75  SSPILMEAPKRATKFACNDEFQKLYKQ 101
              +L   P  A  F   +    L+K+
Sbjct: 299 GPALLRSFPANAATFLGVELTHSLFKK 325

 Score = 28.1 bits (61), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 38/188 (20%), Positives = 77/188 (40%), Gaps = 24/188 (12%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172
           S++AG   G        PF+L+K+R Q   +S    +  ++ I+     +   N L +++
Sbjct: 39  SLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASST--IHAIKIILKDARAIPTSNMLVNSV 96

Query: 173 WRHALWNGGYFGIIFQARALLPA------AHNKTQCITNDLISDSIGCSIGCMLST---- 222
                  G Y G+I     + P        ++  + I     S S   ++G M +     
Sbjct: 97  ------KGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRSDSSSAQLTMGQMAAAGFIS 150

Query: 223 --PFDVVKSRIQNTAVI---PGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPG 277
             P  +V +  +   V+    G   K ++ + +   I ++ G ++L+KG +  + R GPG
Sbjct: 151 AIPTTLVTAPTERIKVVLQTAGANSKTSF-IGAAKNIVKDGGVKSLFKGSLATLARDGPG 209

Query: 278 GGILLVVF 285
             +    +
Sbjct: 210 SALYFASY 217

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 83/207 (40%), Gaps = 42/207 (20%)

Query: 114 MLAGASAGCVEAFVVVPFELVKIRL-QDASSSYK----------------------GPVD 150
           ++AG   G VE+  ++PFE +K  L Q A   +K                       PV 
Sbjct: 79  LIAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVA 138

Query: 151 VVRKIV-------AREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCI 203
            + K++          G  A   G  +T++R        F      + LL A ++K   +
Sbjct: 139 RIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARNDKASSV 198

Query: 204 TNDLISDSIGCSIGCMLSTPFDVVKSRI--QNTAVIPGVVRKYNWSLPSLLTIYREEGFR 261
              L +     +    ++ P DVVK+R+  QN         +Y  +L  +  I+ +EG  
Sbjct: 199 ITGLATSFTLVA----MTQPIDVVKTRMMSQNAKT------EYKNTLNCMYRIFVQEGMA 248

Query: 262 ALYKGFVPKVLRLGPGGGILLVVFTGV 288
             +KG + + +++G  GG+   V+  V
Sbjct: 249 TFWKGSIFRFMKVGISGGLTFTVYEQV 275

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73
            G     + + +  P+DVVKTRM  Q    A   Y   ++C+ +I   EG+   +KG
Sbjct: 200 TGLATSFTLVAMTQPIDVVKTRMMSQ---NAKTEYKNTLNCMYRIFVQEGMATFWKG 253

 Score = 36.6 bits (83), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 33/178 (18%), Positives = 70/178 (39%), Gaps = 32/178 (17%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRM--------------QLQVQGGAGPHYTG--------- 53
           AG + G+ E L + P + +KT +              Q  V   A  H            
Sbjct: 81  AGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVARI 140

Query: 54  --VVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQP 111
             ++  +K +    G     +G ++ I  +    + +F     F++L +      +  + 
Sbjct: 141 EKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQ-----ARNDKA 195

Query: 112 LSMLAGASAGCVEAFVVVPFELVKIRL--QDASSSYKGPVDVVRKIVAREGVLAMYNG 167
            S++ G +       +  P ++VK R+  Q+A + YK  ++ + +I  +EG+   + G
Sbjct: 196 SSVITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFWKG 253

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 71/153 (46%), Gaps = 13/153 (8%)

Query: 130 PFELVKIRLQ----DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGI 185
           P   +  +LQ    D ++  K  ++ +++I  ++G+L  Y GLES ++  AL N  Y+  
Sbjct: 33  PLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFVYYYF 92

Query: 186 I-FQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKY 244
               +R +L    +K       +++  +  S+  + S P  V  +R+        V +  
Sbjct: 93  YELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMT-------VTKSE 145

Query: 245 NWSLPSLLTIYREEGFRALYKGFVPK-VLRLGP 276
             +L +++ I +++  + L+ G  P  VL + P
Sbjct: 146 KTALATIIEIVKKDSAKTLFNGLKPALVLVMNP 178

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 64/148 (43%), Gaps = 8/148 (5%)

Query: 28  VMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRAT 87
           + YPL  + T++Q Q            ++ +K+I   +G+   Y G+ S I   A    T
Sbjct: 30  LTYPLVTITTKLQTQ-GNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMA---LT 85

Query: 88  KFACNDEFQKLYKQAFGV---EKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSS 144
            F     ++   +    V   +KL+   SML G  AG V A    P  +   R+   + S
Sbjct: 86  NFVYYYFYELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRM-TVTKS 144

Query: 145 YKGPVDVVRKIVAREGVLAMYNGLESTL 172
            K  +  + +IV ++    ++NGL+  L
Sbjct: 145 EKTALATIIEIVKKDSAKTLFNGLKPAL 172

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 31/74 (41%), Gaps = 12/74 (16%)

Query: 13  YQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQG------------GAGPHYTGVVDCLKK 60
           + F  GA+  ++     YP   +KTRM L   G            G       ++  + +
Sbjct: 205 WAFLLGALGKLAATGSTYPYITLKTRMHLSESGKHTDDDSGKKAKGHKASSKSMLSLITE 264

Query: 61  IVAGEGVGRLYKGI 74
           IV  +GV  LY+G+
Sbjct: 265 IVKKDGVSGLYRGV 278

>Scas_717.20
          Length = 356

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/325 (19%), Positives = 128/325 (39%), Gaps = 64/325 (19%)

Query: 5   DTKSLPFLYQF-FAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYT-------GVVD 56
           D  SL ++ +   AG ++G     ++ PLD +K   Q      + PHYT       G+ +
Sbjct: 25  DKNSLEYITRSGLAGGISGSCAKTLIAPLDRIKILFQT-----SNPHYTKYAGSLVGLKE 79

Query: 57  CLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLA 116
             K I   +G+   ++G S  ++   P  A KF   ++ +     +   E  S    +++
Sbjct: 80  AAKHIWLNDGIRGFFQGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYE--SHWRRLMS 137

Query: 117 GASAGCVEAFVVVPFELVKIRL--------------------QDASSS------------ 144
           G+ AG    F   P +L+++RL                    + AS++            
Sbjct: 138 GSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFA 197

Query: 145 -----YKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNK 199
                Y+G    V  ++   GV    + L   + +H +     + ++  + +     H K
Sbjct: 198 HWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAP--YSVLALSESEQEERHFK 255

Query: 200 TQCIT----NDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLT-- 253
            Q +      +L+S  +        + PF++++ R+Q + +   V + Y+    S+    
Sbjct: 256 HQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTL--SVSQMYDHRFQSISEIA 313

Query: 254 --IYREEGFRALYKGFVPKVLRLGP 276
             IY+E G+R  + G     +++ P
Sbjct: 314 KIIYKERGWRGFFVGLSIGYIKVTP 338

 Score = 35.0 bits (79), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 74/193 (38%), Gaps = 33/193 (17%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYK-------GPVDVVRKIVAREGVLAMY 165
           S LAG  +G     ++ P + +KI  Q ++  Y        G  +  + I   +G+   +
Sbjct: 35  SGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFF 94

Query: 166 NGLESTLWRHALWNGGYFGIIFQAR-ALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPF 224
            G   TL R   +    F    Q R  L+P+   ++      L+S S+        + P 
Sbjct: 95  QGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYESHW--RRLMSGSLAGLCSVFTTYPL 152

Query: 225 DVVKSRIQNTAVIPGVVRKYNWSLPSLL-TIYREEGFRAL----------------YKGF 267
           D+++ R+        V      SL  L+ TIY+E     L                Y+G+
Sbjct: 153 DLIRVRLAY------VTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYRGY 206

Query: 268 VPKVLRLGPGGGI 280
            P VL + P  G+
Sbjct: 207 TPTVLGMIPYAGV 219

>Scas_705.9
          Length = 323

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/298 (21%), Positives = 114/298 (38%), Gaps = 61/298 (20%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYT----------GVVDCLKKIVAGEG 66
            GA+A     +++YPLDV KT +Q + +       +           V+ CL +I    G
Sbjct: 9   TGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKRG 68

Query: 67  VGRLYKGISSPILMEAPKRATKFACNDEFQKLY--------KQAFGVEKLSQPLSMLAGA 118
           +  LY+G+S+ +  +  +    F      ++ Y         QA  +  +S    ++ G 
Sbjct: 69  LRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINSISTVEELIVGV 128

Query: 119 SAGCVEAFVVVPFELVKIRLQDASSSYKGPVD---VVRKI-VAREGVLAMYNGLESTLWR 174
            A  +   V  P E++  + Q  ++  K  VD   V+++I V   G L+ Y         
Sbjct: 129 GAAALTQVVNNPIEVILTKQQ--TTDDKDNVDFYSVLKQIYVESNGKLSSY--------- 177

Query: 175 HALWNGGYFGIIFQAR-------------ALLPAAHNKTQ------CITNDLISDSIGCS 215
              W G    +I                  LL    N  +       +  + I  ++   
Sbjct: 178 ---WKGFKVSLILTVNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGALAKI 234

Query: 216 IGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLR 273
           I  +++ P  V K  +Q +        K+      L  +Y+EEG  AL+KG  P++ +
Sbjct: 235 ISTIITQPLIVAKVSLQRSN------SKFKHFEEVLRYLYKEEGVLALWKGVGPQLTK 286

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 91/210 (43%), Gaps = 19/210 (9%)

Query: 8   SLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGV 67
           S+  + +   G  A     +V  P++V+ T+ Q          Y+     LK+I   E  
Sbjct: 117 SISTVEELIVGVGAAALTQVVNNPIEVILTKQQTTDDKDNVDFYS----VLKQIYV-ESN 171

Query: 68  GRL---YKGISSPILMEAPKRATKFACNDEFQK-LYKQAFGVEK-----LSQPLSMLAGA 118
           G+L   +KG    +++      T FA    F+  L KQ    EK     L+   + + GA
Sbjct: 172 GKLSSYWKGFKVSLILTVNPSIT-FAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGA 230

Query: 119 SAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALW 178
            A  +   +  P  + K+ LQ ++S +K   +V+R +   EGVLA++ G+   L +  L 
Sbjct: 231 LAKIISTIITQPLIVAKVSLQRSNSKFKHFEEVLRYLYKEEGVLALWKGVGPQLTKGVLV 290

Query: 179 NGGYFGIIFQARALLPAAHNKTQCITNDLI 208
                G++F  +  L  +  +   I N LI
Sbjct: 291 Q----GLVFAFKGELTKSWKRLLFILNLLI 316

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 84/190 (44%), Gaps = 38/190 (20%)

Query: 107 KLSQPLSMLAGASAGCVEAFVVVPFELVKI--RLQDASSSYK-GPVDVVRKIVAREGVLA 163
           K    ++ +AG  AG V   VV PFE VKI  ++Q ++S+Y  G ++ V ++   EGV  
Sbjct: 8   KQESSIAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAG 67

Query: 164 MYNGLESTLWRHALWNGGYFGI-------IFQARALLPAAHNKTQCITNDLISDSIGCSI 216
           ++ G      R   ++   F +       IF     +     K Q +    +S    C  
Sbjct: 68  LFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTV----GKEQLLNWQRLSAGALCGG 123

Query: 217 GCMLST-PFDVVKSRI---------------QNTAVIPGVVRKYNWSLPSLLTIYREE-G 259
             +L+T P D+V++R+               ++ A  PGV     W L  L+  ++EE G
Sbjct: 124 MSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGV-----WEL--LVKTFKEEGG 176

Query: 260 FRALYKGFVP 269
            R LY+G  P
Sbjct: 177 IRGLYRGIYP 186

 Score = 45.8 bits (107), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 57/127 (44%), Gaps = 5/127 (3%)

Query: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74
           F AG VAG     V+ P + VK  + LQVQ     +  G+++ + ++   EGV  L++G 
Sbjct: 15  FIAGGVAGAVSRTVVSPFERVK--ILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGN 72

Query: 75  SSPILMEAPKRATKFACNDEFQKLYKQ---AFGVEKLSQPLSMLAGASAGCVEAFVVVPF 131
               +   P  A +F   +  +K         G E+L     + AGA  G +      P 
Sbjct: 73  GLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPL 132

Query: 132 ELVKIRL 138
           +LV+ RL
Sbjct: 133 DLVRTRL 139

 Score = 33.1 bits (74), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 34/68 (50%), Gaps = 10/68 (14%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYT---------GVVDCLKKIVAGEGV 67
           AGA+ G   +L  YPLD+V+TR+ +Q    A    +         GV + L K    EG 
Sbjct: 117 AGALCGGMSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGG 176

Query: 68  GR-LYKGI 74
            R LY+GI
Sbjct: 177 IRGLYRGI 184

 Score = 27.7 bits (60), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 19/88 (21%), Positives = 42/88 (47%), Gaps = 9/88 (10%)

Query: 207 LISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLL-TIYREEGFRALYK 265
            I+  +  ++   + +PF+ VK  +Q    +      YN  + + +  +Y+EEG   L++
Sbjct: 15  FIAGGVAGAVSRTVVSPFERVKILLQ----VQSSTSAYNHGIINAVGQVYKEEGVAGLFR 70

Query: 266 GFVPKVLRLGPGGGILLVVFTGVLDFCR 293
           G     +R+ P   +  VV+    ++C+
Sbjct: 71  GNGLNCVRIFPYSAVQFVVY----EWCK 94

>Kwal_47.19228
          Length = 281

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 101/264 (38%), Gaps = 67/264 (25%)

Query: 84  KRATKFACNDEF-QKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRL---- 138
           K AT+F   D   Q L+        +S P  + AG   G +E+ +V+PFE +K  +    
Sbjct: 22  KTATRFTTFDRACQLLHDPENPNGTISGPRLLAAGVITGFMESLLVIPFENIKTTMIENA 81

Query: 139 ------QDASSSYKGPVDV----------------------------------VRKIVAR 158
                  +A    K  V V                                  V++I   
Sbjct: 82  LLLSERANAEPQEKKKVTVQPRATFHSQKKALHPRQKWALYYDEHPSRQFLTTVQEIYRS 141

Query: 159 EGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGC 218
            G+     G   T+ R    +   F      + ++  + NK     N+  + ++G    C
Sbjct: 142 RGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMI--SPNKP---LNEYYAFALGFISSC 196

Query: 219 ML---STPFDVVKSRIQNTAVIPGVVRKYNWS-----LPSLLTIYREEGFRALYKGFVPK 270
            +   + P DV+K+R+Q+         KY WS     L     I+ EEGF   +KG+ P+
Sbjct: 197 AVVAVTQPIDVIKTRMQS---------KYTWSNYKNSLNCAYRIFVEEGFTKFWKGWAPR 247

Query: 271 VLRLGPGGGILLVVFTGVLDFCRA 294
           ++++G  GG+   V+  V +  +A
Sbjct: 248 LMKVGLSGGVSFGVYQYVDNLMKA 271

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVA 63
           S  K L   Y F  G ++  + + V  P+DV+KTRMQ +       +Y   ++C  +I  
Sbjct: 177 SPNKPLNEYYAFALGFISSCAVVAVTQPIDVIKTRMQSKY---TWSNYKNSLNCAYRIFV 233

Query: 64  GEGVGRLYKGISSPILME 81
            EG  + +KG  +P LM+
Sbjct: 234 EEGFTKFWKGW-APRLMK 250

 Score = 35.8 bits (81), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 28/149 (18%), Positives = 60/149 (40%), Gaps = 5/149 (3%)

Query: 55  VDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSM 114
           +  +++I    G+    +G    I+ +    A +F      +++       + L++  + 
Sbjct: 132 LTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPN---KPLNEYYAF 188

Query: 115 LAGASAGCVEAFVVVPFELVKIRLQD--ASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172
             G  + C    V  P +++K R+Q     S+YK  ++   +I   EG    + G    L
Sbjct: 189 ALGFISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFVEEGFTKFWKGWAPRL 248

Query: 173 WRHALWNGGYFGIIFQARALLPAAHNKTQ 201
            +  L  G  FG+      L+ A + + +
Sbjct: 249 MKVGLSGGVSFGVYQYVDNLMKAVNGQQE 277

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 46.6 bits (109), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 124/284 (43%), Gaps = 35/284 (12%)

Query: 18  GAVAGVSEILVM-YPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           GA   +SE+  +  PL+VVKT M       A  ++T  ++ +K + +  G+   Y+G+  
Sbjct: 26  GACLNLSEVTTLGQPLEVVKTTM------AANRNFT-FLESVKHVWSRGGILGYYQGLIP 78

Query: 77  PILMEAP-KRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPF---- 131
              +EA  K A     + E +  +K + G+   +    +L G + G  +A++ + F    
Sbjct: 79  WAWIEASTKGAVLLFVSAEAEYRFK-SLGLNNFAS--GILGGVTGGVTQAYLTMGFCTCM 135

Query: 132 ---ELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQ 188
              E+ + +   A    +    V + I  +EG+  +  G+ +   R     G  FG+   
Sbjct: 136 KTVEITRHKSASAGGVPQSSWSVFKNIYKKEGIRGINKGVNAVAIRQMTNWGSRFGLSRL 195

Query: 189 ARALLPAAHNKTQCITNDLIS--DSIGCS-IGCMLST---PFDVVKSRIQNTAVIPGVVR 242
               +     KT    +D ++  + IG S +G  LS    P +V++  +Q+    P   R
Sbjct: 196 VEDGIRKITGKTN--KDDKLNPFEKIGASALGGGLSAWNQPIEVIRVEMQSKKEDPN--R 251

Query: 243 KYNWSL-PSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
             N ++  +   IY+  G + LY+G  P++     G GI   VF
Sbjct: 252 PKNLTVGKTFKYIYQSNGLKGLYRGVTPRI-----GLGIWQTVF 290

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 77/175 (44%), Gaps = 17/175 (9%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           AG ++ +   LV  P + VK  +Q   +G         +   K IV   G+  L+KG  +
Sbjct: 147 AGFISAIPTTLVTAPTERVKVVLQTSSKGS-------FIQAAKTIVKEGGIASLFKGSLA 199

Query: 77  PILMEAPKRATKFACNDEFQKLY------KQAFGVEKLSQPLSM-LAGASAGCVEAFVVV 129
            +  + P  A  FA + E  K Y      +Q  G ++    L++ LAG  AG      V 
Sbjct: 200 TLARDGPGSALYFA-SYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVF 258

Query: 130 PFELVKIRLQDASSSYKGPVDVVRKI-VAREGVLAMYNGLESTLWRHALWNGGYF 183
           P + +K +LQ ASS+ +  +   ++I + R G+   + GL   L R    N   F
Sbjct: 259 PIDTIKTKLQ-ASSTRQNMLSATKEIYLQRGGIKGFFPGLGPALLRSFPANAATF 312

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 82/190 (43%), Gaps = 29/190 (15%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQD--ASSSYKGPVDVVRKIVAREGVLAMYNGLES 170
           S +AG   G    F   PF+L+K+R Q+  A+S+     +++++   +         ++ 
Sbjct: 38  SFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQ---------VKG 88

Query: 171 TLWRHALWNGGYFGIIFQARALLP---------------AAHNKTQCITNDLISDSIGCS 215
           TL+ +++  G Y G+I     + P                  N  Q  +N+L    +  +
Sbjct: 89  TLFTNSV-KGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAA 147

Query: 216 IGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLG 275
            G + + P  +V +  +   V+     K ++ + +  TI +E G  +L+KG +  + R G
Sbjct: 148 -GFISAIPTTLVTAPTERVKVVLQTSSKGSF-IQAAKTIVKEGGIASLFKGSLATLARDG 205

Query: 276 PGGGILLVVF 285
           PG  +    +
Sbjct: 206 PGSALYFASY 215

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 41/87 (47%), Gaps = 7/87 (8%)

Query: 16  FAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKI-VAGEGVGRLYKGI 74
            AG +AG+S  L ++P+D +KT++Q      A      ++   K+I +   G+   + G+
Sbjct: 244 LAGGIAGMSMWLAVFPIDTIKTKLQ------ASSTRQNMLSATKEIYLQRGGIKGFFPGL 297

Query: 75  SSPILMEAPKRATKFACNDEFQKLYKQ 101
              +L   P  A  F   +    L+K+
Sbjct: 298 GPALLRSFPANAATFLGVEMTHSLFKK 324

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 74/172 (43%), Gaps = 6/172 (3%)

Query: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKK 60
           MS  +   +  L    AG++ G + I V YPL  + T +Q + +  A P     ++ +K+
Sbjct: 1   MSEINPNDVDELAHAIAGSLGGAASIAVTYPLVTITTNLQTK-ENEARPK----LETIKE 55

Query: 61  IVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASA 120
           I    G+   + G+ S +   A      +   +   K  +     + LS   S+LA   A
Sbjct: 56  IYNKNGIIGYFLGLESAVYGMATTNFVYYYFYEWCAKTARTLTTKQYLSTWESILASTIA 115

Query: 121 GCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172
           G + A    P  +   R+  A S++   +  V  IV  +G L + NGL+  L
Sbjct: 116 GSMTAVASNPIWVANTRMTVAKSNH-STLRTVIDIVKTDGPLTLLNGLKPAL 166

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/159 (20%), Positives = 67/159 (42%), Gaps = 14/159 (8%)

Query: 115 LAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWR 174
           +AG+  G     V  P   +   LQ   +  +  ++ +++I  + G++  + GLES ++ 
Sbjct: 16  IAGSLGGAASIAVTYPLVTITTNLQTKENEARPKLETIKEIYNKNGIIGYFLGLESAVYG 75

Query: 175 HALWNGGYFGIIF----QARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSR 230
            A  N  Y+         AR L    +  T      +++ +I  S+  + S P  V  +R
Sbjct: 76  MATTNFVYYYFYEWCAKTARTLTTKQYLSTW---ESILASTIAGSMTAVASNPIWVANTR 132

Query: 231 IQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVP 269
           +        V +  + +L +++ I + +G   L  G  P
Sbjct: 133 MT-------VAKSNHSTLRTVIDIVKTDGPLTLLNGLKP 164

 Score = 32.3 bits (72), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 64/158 (40%), Gaps = 14/158 (8%)

Query: 16  FAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYT--GVVDCLKKIVAGEGVGRLYKG 73
            A  +AG    +   P+ V  TRM +        H T   V+D    IV  +G   L  G
Sbjct: 110 LASTIAGSMTAVASNPIWVANTRMTV----AKSNHSTLRTVID----IVKTDGPLTLLNG 161

Query: 74  ISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFEL 133
           +  P L+       ++   ++ + L  +    + LS   + L GA           P+  
Sbjct: 162 LK-PALVLVSNPIIQYTVYEQLKNLVLRLQRKKVLSPSWAFLLGAIGKLAATGTTYPYIT 220

Query: 134 VKIRL---QDASSSYKGPVDVVRKIVAREGVLAMYNGL 168
           +K R+   Q+     K    ++ +IV ++GV  +YNG+
Sbjct: 221 LKTRMHLMQNDPKHQKSMWSLIVEIVKKDGVSGLYNGV 258

 Score = 32.0 bits (71), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 2/63 (3%)

Query: 13  YQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYK 72
           + F  GA+  ++     YP   +KTRM L        H   +   + +IV  +GV  LY 
Sbjct: 199 WAFLLGAIGKLAATGTTYPYITLKTRMHL--MQNDPKHQKSMWSLIVEIVKKDGVSGLYN 256

Query: 73  GIS 75
           G++
Sbjct: 257 GVA 259

>Kwal_23.2913
          Length = 320

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 68/168 (40%), Gaps = 8/168 (4%)

Query: 16  FAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGIS 75
            AG  + +   L+  P + VK  +Q    G         +   + ++   GV  L++G  
Sbjct: 146 LAGFFSAIPTTLITAPTERVKVVLQTSESGS-------FLGAARTLIREGGVRSLFQGTL 198

Query: 76  SPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVK 135
           + +  + P  A  FA  +  ++   +    + LS     +AG  AG      V P + +K
Sbjct: 199 ATLARDGPGSALYFASYEVSKRFLSRNQDTDALSVVSICVAGGVAGMSMWIGVFPIDTIK 258

Query: 136 IRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYF 183
            +LQ +S S +  V   R+I  R G+   + GL   L R    N   F
Sbjct: 259 TKLQSSSRS-QSMVQAAREIYTRAGLRGFFPGLGPALMRSFPANAATF 305

>Scas_613.24
          Length = 177

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/161 (20%), Positives = 69/161 (42%), Gaps = 5/161 (3%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGV--GRLY 71
              +G + G+S  + + PLD++KTR+Q   Q      ++ + D    I    G     L 
Sbjct: 11  HLVSGFIGGLSSAVTLQPLDLLKTRIQ---QHKGATLWSAIKDIKDPIQFWRGTLPSALR 67

Query: 72  KGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPF 131
             I S + +           + +      ++  + +L+   ++L GA A  +  ++ +P 
Sbjct: 68  TSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARGLVGYITMPI 127

Query: 132 ELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172
            ++K+R +    SYK   + ++ I   EG+   + G   T+
Sbjct: 128 TILKVRYESTYYSYKSMNEAIKDIYKMEGISGFFKGFGPTV 168

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
          Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 41.2 bits (95), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 41/84 (48%), Gaps = 2/84 (2%)

Query: 8  SLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGA--GPHYTGVVDCLKKIVAGE 65
          +L  LY+   GA++G     ++YP D+++ R Q+   GG   G  Y  V D L  I   E
Sbjct: 7  NLANLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTE 66

Query: 66 GVGRLYKGISSPILMEAPKRATKF 89
          G    YKG+++ +    P  A  +
Sbjct: 67 GPKGYYKGLTANLFKVIPSTAVSW 90

 Score = 29.3 bits (64), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 37/76 (48%), Gaps = 1/76 (1%)

Query: 211 SIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVR-KYNWSLPSLLTIYREEGFRALYKGFVP 269
           +I   +   L  PFD+++ R Q  A+    +  +Y     +L+TI + EG +  YKG   
Sbjct: 18  AISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKGYYKGLTA 77

Query: 270 KVLRLGPGGGILLVVF 285
            + ++ P   +  +V+
Sbjct: 78  NLFKVIPSTAVSWLVY 93

 Score = 28.9 bits (63), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 7/75 (9%)

Query: 107 KLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQ-------DASSSYKGPVDVVRKIVARE 159
            L+    +  GA +G V   +V PF+L++ R Q       +    YK   D +  I   E
Sbjct: 7   NLANLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTE 66

Query: 160 GVLAMYNGLESTLWR 174
           G    Y GL + L++
Sbjct: 67  GPKGYYKGLTANLFK 81

>Scas_696.9
          Length = 312

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 63/282 (22%), Positives = 116/282 (41%), Gaps = 31/282 (10%)

Query: 18  GAVAGVSEILVM-YPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           GA   ++E+  +  PL+VVKT M       A       V+ +K + +  G+   Y+G+  
Sbjct: 24  GATINMAEVTSLGQPLEVVKTTM-------AANRNLNFVNSMKYVWSRGGIVGFYQGLIP 76

Query: 77  PILMEAP-KRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPF---- 131
              +EA  K A     + E +  +K   G+   +  +           ++++ + F    
Sbjct: 77  WAWIEASTKGAVLLFVSAESEYRFK-LLGMGNFTSGILGGVLGGV--TQSYLTMGFCTCM 133

Query: 132 ---ELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQ 188
              E+ +++   A +  +   +V R I A+EG+  +Y G+ +   R     G  FG    
Sbjct: 134 KTVEITRLKSASAGAPVQSSWNVFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSRFGFSRL 193

Query: 189 ARALLPAAHNKTQCITNDLISDSIGCS-IGCMLST---PFDVVKSRIQNTAVIPGVVRKY 244
               +  A  KT+        + IG + +G  LS    P +V++  +Q+    P   R  
Sbjct: 194 VEDWVRKATGKTKPEDRLNAWEKIGATAVGGGLSAWNQPIEVIRVEMQSKKEDPN--RPK 251

Query: 245 NWSLPSLLT-IYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
           N ++      I +  G + LY+G  P++     G GI   VF
Sbjct: 252 NLTVAKTFKYIMKTNGVKGLYRGVTPRI-----GLGIWQTVF 288

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/281 (21%), Positives = 109/281 (38%), Gaps = 39/281 (13%)

Query: 31  PLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRAT--- 87
           PL+V+KT M       A        + +K + +  GV   Y+G+     +EA  +     
Sbjct: 38  PLEVIKTTM-------AANRSFSFFNAIKHVWSRGGVFGFYQGLIPWAWIEASTKGAVLL 90

Query: 88  --KFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPF-------ELVKIRL 138
                   +F+++    FG         ++ G + G  +A++ + F       E+ K + 
Sbjct: 91  FVSAESEYQFKRMGLSNFGS-------GIMGGVTGGVAQAYLTMGFCTCMKTVEITKKKS 143

Query: 139 QDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHN 198
             A +  +      ++I  ++G+  +  G+ +   R     G  FG        +  A  
Sbjct: 144 AGAGAIPQSSWGAFKEIYKKDGIKGINKGVNAVAIRQMTNWGSRFGFSRLVEEGIRNATG 203

Query: 199 KTQCITNDLISDSIGCS-IGCMLST---PFDVVKSRIQNTAVIPGVVRKYNWSLPSLLT- 253
           KT         + I  S IG  LS    P +V++  +Q+    P   R  N ++ S    
Sbjct: 204 KTNPDDKLTALEKIAASAIGGGLSAWNQPIEVIRVEMQSKKEDPN--RPKNLTVSSAFKY 261

Query: 254 IYREEGFRALYKGFVPKVLRLGPGGGILLVVF-TGVLDFCR 293
           IY+  G + LY+G  P++     G G+   VF  G  D  R
Sbjct: 262 IYQSSGIKGLYRGVAPRI-----GLGVWQTVFMVGFGDMAR 297

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 123/297 (41%), Gaps = 43/297 (14%)

Query: 18  GAVAGVSEILVM-YPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76
           GA   +SE+  +  PL+VVKT M       A       +   K + +  G+   Y+G+  
Sbjct: 18  GAGLNLSEVTTLGQPLEVVKTTM-------AAHREFNFLQATKHVWSRGGIFGFYQGLIP 70

Query: 77  PILMEAP-KRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPF---- 131
              +EA  K A     + E +  +K   G+        ++ G + G  +A++ + F    
Sbjct: 71  WAWIEASTKGAVLLFVSAEAEYRFK-VLGLNNFGA--GIMGGITGGVTQAYLTMGFCTCM 127

Query: 132 ELVKIRLQDAS--------SSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYF 183
           + V+I  Q A+        SS++    V + I  +EG+  +  G+ +   R     G  F
Sbjct: 128 KTVEITRQKAANVPGVIPQSSWQ----VFKSIYKKEGIRGINKGVNAVAIRQMTNWGSRF 183

Query: 184 GI---IFQARALLPAAHNKTQCIT--NDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIP 238
           G+   +      L     K   +T    +++ +IG  +    + P +V++  +Q+    P
Sbjct: 184 GLSRLVEDGIRKLTGKTGKDDKLTALEKIMASAIGGGLSA-WNQPIEVIRVEMQSKKEDP 242

Query: 239 GVVRKYNWSL-PSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVF-TGVLDFCR 293
              R  N ++  +   IY+  G + LY+G  P+V     G GI   VF  G  D  R
Sbjct: 243 N--RPKNLTVGKTFKYIYQSNGLKGLYRGVTPRV-----GLGIWQTVFMVGFGDMAR 292

>Kwal_34.15907
          Length = 312

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 54/272 (19%), Positives = 106/272 (38%), Gaps = 38/272 (13%)

Query: 31  PLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRAT--- 87
           PL+V+KT M       A          +K + +  GV   Y+G+     +EA  +     
Sbjct: 38  PLEVIKTTM-------AANRNLNFGQSVKHVWSRGGVFGFYQGLIPWAWIEASTKGAVLL 90

Query: 88  --KFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPF-------ELVKIRL 138
                   +F++L    FG         ++ G S G  +A++ + F       E+ K + 
Sbjct: 91  FVSAEAEYQFKRLGLGNFGA-------GIMGGVSGGVAQAYLTMGFCTCMKTVEITKAKS 143

Query: 139 QDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGI---IFQARALLPA 195
             A +  +      ++I ++EG+  +  G+ +   R     G  FG+   + Q       
Sbjct: 144 AVAGAIPQSSWSAFKEIYSKEGIKGINKGVNAVAIRQMTNWGSRFGLSRLVEQGIRDFTG 203

Query: 196 AHNKTQCIT--NDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLT 253
             N    +T    + + ++G  +    + P +V++  +Q+    P   +K      +   
Sbjct: 204 KTNPDDKLTALEKIFASALGGGLSAW-NQPIEVIRVEMQSKKEDPNRPKKLTVG-SAFKY 261

Query: 254 IYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285
           IY+  G + LY+G  P++     G G+   VF
Sbjct: 262 IYQSSGIKGLYRGVAPRI-----GLGVWQTVF 288

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 63/288 (21%), Positives = 110/288 (38%), Gaps = 54/288 (18%)

Query: 31  PLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKF- 89
           PL+VVKT M       A   +T     +  I +  GV   Y+G+     +EA  +     
Sbjct: 35  PLEVVKTTM------AANRQFT-FFQAINHIWSRGGVFGFYQGLIPWAWIEASTKGAVLL 87

Query: 90  ----ACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPF-------ELVKIRL 138
                    F+KL    FG         ++ G S G  +A++ + F       E+ K + 
Sbjct: 88  FVSAEAEYHFKKLGLNNFGA-------GIMGGVSGGVAQAYLTMGFCTCMKTVEITKHK- 139

Query: 139 QDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFG---IIFQARALLPA 195
             A+ + +      ++I  +EG+  +  G+ +   R     G  FG   ++ +       
Sbjct: 140 SAAAGAKQSSWAAFKEIYNKEGIRGINKGVNAVAIRQMTNWGSRFGFSRLVEEGLRKFTG 199

Query: 196 AHNKTQCIT--NDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLT 253
             N    +T    + + +IG  +    + P +V++  +Q+    P        + P  LT
Sbjct: 200 KTNPDDKLTALEKIFASAIGGGLSA-WNQPIEVIRVEMQSKTNDP--------NRPKDLT 250

Query: 254 -------IYREEGFRALYKGFVPKVLRLGPGGGILLVVF-TGVLDFCR 293
                  IY+  G + LY+G  P++     G GI   VF  G  D  R
Sbjct: 251 VGKAFRYIYQSNGVKGLYRGVTPRI-----GLGIWQTVFMVGCGDIAR 293

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/180 (20%), Positives = 70/180 (38%), Gaps = 34/180 (18%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGR---- 69
           +  +G++AG+  + V YPLD+V+ R+   V          ++ C+      E + +    
Sbjct: 121 RLLSGSLAGLCSVFVTYPLDLVRVRLAY-VTERHDAKVRKIMACIYNERPSEALRKWYIP 179

Query: 70  --------LYKGISSPILMEAPKRATKFACNDEFQKLYKQAF------------GVEKLS 109
                    Y+G +  ++   P     F  +D  Q +++                    +
Sbjct: 180 QWFAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRT 239

Query: 110 QPL----SMLAGASAGCVEAFVVVPFELVKIRLQ-----DASSSYKGPVDVVRKIVAREG 160
            PL     ++AG  AG        PFE+++ RLQ     D +  +   ++ + KI+  EG
Sbjct: 240 VPLKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEG 299

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 77/191 (40%), Gaps = 30/191 (15%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYK-------GPVDVVRKIVAREGVLAMY 165
           S LAG  AG     +V P + +KI  Q ++  +        G V   + I+A +G    +
Sbjct: 22  SGLAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFF 81

Query: 166 NGLESTLWRHALWNGGYFGIIFQARA-LLPAAHNKTQCITNDLISDSIGCSIGCMLSTPF 224
            G  +TL R   +    F    Q R+ ++P   +++      L+S S+       ++ P 
Sbjct: 82  QGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESHW--RRLLSGSLAGLCSVFVTYPL 139

Query: 225 DVVKSRIQN-TAVIPGVVRK-----YN---------WSLPSLLTIYREEGFRALYKGFVP 269
           D+V+ R+   T      VRK     YN         W +P     +        Y+G+ P
Sbjct: 140 DLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQWFAHWSN-----FYRGYTP 194

Query: 270 KVLRLGPGGGI 280
            V+ + P  G+
Sbjct: 195 TVIGMIPYAGV 205

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 68/337 (20%), Positives = 119/337 (35%), Gaps = 106/337 (31%)

Query: 16  FAGAVAGVSEILVMYPLDVVKTRMQLQVQ--------------------GGAGP------ 49
           F GAV+     L +YPLD+ KT +Q Q++                    G + P      
Sbjct: 8   FVGAVSSGFANLAVYPLDLAKTVIQTQLKQGDLYPSSDVQADVSTKESTGSSKPKKHGIQ 67

Query: 50  ------------------HYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFAC 91
                              Y   +D + K+   EG G LY G+S+ +L    +  + F  
Sbjct: 68  QIKPKPEPPTATKESLEQRYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFW 127

Query: 92  NDEFQKLYKQAFGVEKLSQP-----------LSMLAGASAGCVEAFVVVPFELVKIRLQ- 139
               ++ Y   F V+K+              LSMLA A++         P  +V  + Q 
Sbjct: 128 YTLIRRHY---FRVKKVKGEAARFSTIEELLLSMLAAATS----QLFTNPINIVSTKQQT 180

Query: 140 ----DASSSYKGPVDVVRKIVAREGVLAMYNGLESTL-------------------WRHA 176
               +  +S+K    + +++   +G+   +  L+ +L                     H 
Sbjct: 181 RRGLEGDNSFKA---IAKEVYDEDGITGFWKSLKVSLVLTINPSITYASAEKLKDILYHV 237

Query: 177 LWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAV 236
            WN         +   L    N    + + +IS          L+ P  V K+ +Q ++ 
Sbjct: 238 EWNAKDLN---DSSLQLKPGQNFLIGVLSKIIS--------TCLTHPLIVAKASLQRSS- 285

Query: 237 IPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLR 273
                 K+      L  +YR EG  AL+KG +P++ +
Sbjct: 286 -----SKFTSFQEVLTYLYRHEGAHALWKGLLPQLTK 317

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 85/207 (41%), Gaps = 35/207 (16%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDAS-------SSYKGPVDVVRKIVAREGVLAMY 165
           S LAG  AG     ++ P + +KI  Q ++        S++G ++    I +R+ +  ++
Sbjct: 56  SGLAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVF 115

Query: 166 NGLESTLWRHALWNGGYFGIIFQAR-ALLPAAHNKTQCITNDLISDSIG--CSIGCMLST 222
            G  +TL R   +    F    Q R  ++P+   +T      L S S+   CS+ C  + 
Sbjct: 116 QGHSATLLRIFPYAAVKFIAYEQIRNVIIPSKEYETHF--RRLCSGSLAGLCSVFC--TY 171

Query: 223 PFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRAL----------------YKG 266
           P D+++ R+   A +    +   W  P +  IY E    AL                Y+G
Sbjct: 172 PLDLIRVRL---AYVTEHHKVRVW--PLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRG 226

Query: 267 FVPKVLRLGPGGGILLVVFTGVLDFCR 293
           ++P V+ + P  G+         D  R
Sbjct: 227 YIPTVIGMIPYAGVSFFAHDLFHDILR 253

 Score = 28.9 bits (63), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 34/77 (44%), Gaps = 1/77 (1%)

Query: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPH-YTGVVDCLKKIVAGEGVGRLYK 72
           +  AG +AG++     YP ++++ R+Q+        H +T + +  K I    G    + 
Sbjct: 293 ELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKIIFHERGWRGFFV 352

Query: 73  GISSPILMEAPKRATKF 89
           G+S   +   P  A  F
Sbjct: 353 GLSIGYIKVTPMVACSF 369

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 35.4 bits (80), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 67/332 (20%), Positives = 121/332 (36%), Gaps = 74/332 (22%)

Query: 16  FAGAVAGVSEILVMYPLDVVKTRMQLQV---------------QGGAGP----------- 49
            +GAVA      V+YPLD+VKT +Q Q+               Q    P           
Sbjct: 8   LSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVPIKL 67

Query: 50  ------HYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAF 103
                  Y    D + KI   EG+  LY+G+++ ++    +  + F      +K Y +  
Sbjct: 68  NENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVK 127

Query: 104 GVEKLSQPLS----MLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVD--VVRKIVA 157
            + + +   +    +L G  A         P  L+  R Q       G  D   V K + 
Sbjct: 128 LINRKNTKFTTIEELLLGIVAAATSQIFTNPISLISAR-QQTRQGIDGDNDFLTVAKEIY 186

Query: 158 RE--GVLAMYNGLESTLW---------------RHALWNGGYFGI---IFQARALLPAAH 197
           +E   +   + GL+ +L                + AL+      +   +  + + L    
Sbjct: 187 KEQRSIKGFWKGLKVSLMLTINPSITYTSYEKLKDALFTTDTMNLKKELVDSSSQLSPYQ 246

Query: 198 NKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYRE 257
           N T  + + +IS         +++ P  + K+ +Q           ++     L  +Y+ 
Sbjct: 247 NFTLGVLSKMIS--------AIITMPLIISKAWLQRNG------SNFSSFQQVLYYLYKN 292

Query: 258 EGFRALYKGFVPKVLRLGPGGGILLVVFTGVL 289
           EG R+ +KG  P++ + G     LL +F G L
Sbjct: 293 EGLRSWWKGLSPQLAK-GVLVQGLLFMFKGEL 323

>Scas_671.1*
          Length = 123

 Score = 33.9 bits (76), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172
           S+ A ASA    A +  PF+ +K R+Q     +      +  I   E +  +++GL   L
Sbjct: 43  SVSAIASASLATA-ITAPFDTIKTRMQLKPKVFTNFFTTLVLITKNESIFQLFSGLSMRL 101

Query: 173 WRHALWNGGYFGI 185
            R AL  G  +GI
Sbjct: 102 TRKALSAGIAWGI 114

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 39/189 (20%), Positives = 77/189 (40%), Gaps = 21/189 (11%)

Query: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIV--AREG--------VL 162
           S+ AG   G        PF+LVK+R Q  S+  +  +D V  I+  AR+         V 
Sbjct: 31  SLAAGGVGGVCAVLTGHPFDLVKVRCQ--SNQARSAMDAVSHILQAARQAAGPTSLNAVR 88

Query: 163 AMYNGLE------STLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSI 216
             Y G+       + ++  + W    + +  +    +P++           ++ S   + 
Sbjct: 89  GFYKGVVPPLLGVTPIFAVSFWG---YDVGKKLVTSVPSSAASGAAAVEPELTLSQMAAA 145

Query: 217 GCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276
           G + + P  +V +  +   V+    +     L +   I R +GF++L+KG +  + R GP
Sbjct: 146 GFISAIPTTLVTAPTERVKVVLQTTQGKASFLDAAKQIVRTQGFQSLFKGSLATLSRDGP 205

Query: 277 GGGILLVVF 285
           G  +    +
Sbjct: 206 GSALYFASY 214

 Score = 32.3 bits (72), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 45/94 (47%), Gaps = 8/94 (8%)

Query: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGE-GVGRLYKGIS 75
           +G +AGVS  +V++P+D VKT++Q      +      +++  + I     G+   + G+ 
Sbjct: 240 SGGMAGVSMWVVVFPIDTVKTQLQ------SSSKRQSMLEVTRMIYNTRGGIKGFFPGVG 293

Query: 76  SPILMEAPKRATKFACNDEFQKLYKQAFGVEKLS 109
             IL   P  A  F   +    L+K+ F  +K S
Sbjct: 294 PAILRSFPANAATFLGVELTHSLFKK-FEQQKTS 326

>Kwal_14.1028
          Length = 680

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 6/74 (8%)

Query: 16  FAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGIS 75
           FAG  +G+ ++  +   D     +  +++ GA  H       LKK      V R  K + 
Sbjct: 602 FAGDHSGMYKVKSLIDYDDKDGNVVRKIKSGASTHSKS---SLKK---HPSVARRVKSVD 655

Query: 76  SPILMEAPKRATKF 89
           SP++ +A K+ +KF
Sbjct: 656 SPVVPDAKKKTSKF 669

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.140    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,918,210
Number of extensions: 355149
Number of successful extensions: 2444
Number of sequences better than 10.0: 210
Number of HSP's gapped: 1361
Number of HSP's successfully gapped: 580
Length of query: 294
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 193
Effective length of database: 13,099,691
Effective search space: 2528240363
Effective search space used: 2528240363
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 61 (28.1 bits)