Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR107W38437718570.0
Kwal_26.866235537112681e-175
Scas_700.4040740212001e-164
YPL133C (RDS2)44643511901e-162
KLLA0D07029g53432310781e-144
CAGL0M02651g46221210221e-137
Kwal_14.16364561742549e-24
YBR239C5292012479e-23
AFL031W5171752301e-20
KLLA0F10417g5071692185e-19
Scas_597.25402022142e-18
CAGL0K06985g5962262026e-17
Sklu_2207.45322022019e-17
KLLA0F13904g5792211973e-16
YJL103C6182311691e-12
AFR081C4821941635e-12
Scas_711.185091531474e-10
CAGL0L03674g6292231475e-10
Scas_542.8902361058e-05
KLLA0D00484g1004391041e-04
YOR162C (YRR1)810591031e-04
KLLA0F22990g1253391022e-04
CAGL0B03421g1355521022e-04
KLLA0A02585g37031975e-04
KLLA0F09559g65847985e-04
Sklu_2191.271843978e-04
CAGL0K05841g137237950.001
AFR117C115242950.001
Scas_709.5175934940.001
KLLA0F10835g75640920.003
Sklu_2384.683135920.003
Scas_573.4147854920.003
YLR256W (HAP1)150239900.005
KLLA0E18194g86557880.008
AGL233C87242880.008
ACL195C10941810.012
Sklu_2411.1168735860.016
YNR063W60743850.017
CAGL0L04400g98735860.017
Scas_663.1294446840.030
YLR266C (PDR8)70134830.032
Kwal_23.642573537830.032
Scas_659.1075781830.037
ACR028C60145820.038
CAGL0L03377g120940820.051
YBL005W (PDR3)97631810.065
AER370W80128810.066
AER183C87936800.075
Scas_702.7111327800.082
CAGL0G08844g84738800.087
CAGL0M12298g99457800.088
KLLA0F04609g91628800.089
Sklu_2376.692254790.094
YOR172W (YRM1)78633790.095
CAGL0M05907g89133790.097
Scas_662.890628790.097
YKR064W86365790.11
Scas_556.6102236790.11
Scas_657.385645790.11
Kwal_23.475481228780.13
YIL130W96428780.13
KLLA0F02750g114836780.13
Sklu_1993.282328780.13
KLLA0F25630g100760770.18
Sklu_2434.1098338770.21
CAGL0J07150g102236760.21
KLLA0A03421g88030760.22
CAGL0F09229g83533760.22
YOR380W (RDR1)54637750.26
KLLA0F19602g60334750.26
YOR363C (PIP2)99650760.28
YMR019W (STB4)94932750.31
CAGL0L04576g86527750.33
Sklu_2335.694030750.36
KLLA0C14212g104029750.37
Scas_669.863737740.38
ADR403C97048740.39
YER184C79430740.41
Scas_625.5114155740.45
Kwal_23.351457929730.52
YBR297W (MAL33)46860730.53
YGL013C (PDR1)106864730.53
Scas_234.133746720.58
AGL361C69649730.58
Kwal_47.1750692429730.60
ADR405C80743720.76
CAGL0A00451g110730720.85
ACL096W83554710.86
YKL015W (PUT3)97933710.88
Kwal_34.1575162834710.90
KLLA0D10153g65539710.97
Scas_518.591963711.0
Kwal_26.680594441711.0
CAGL0F07909g104968711.1
KLLA0D12650g65144701.2
Kwal_14.91582263701.2
YAL051W (OAF1)106245701.3
KLLA0D11286g67860691.5
CAGL0G09757g142335691.7
Scas_637.799836681.9
Kwal_55.2188488238682.0
Sklu_2064.292234682.0
YGR288W (MAL13)47347682.0
KLLA0C19228g59126682.1
Scas_721.9486958682.2
KLLA0D10593g92537682.3
CAGL0L09691g82422682.4
KLLA0C03201g65028672.5
CAGL0L01903g128736682.5
KLLA0A09119g108232682.5
Kwal_47.1756562837672.6
KLLA0C04620g126935672.7
YLR278C134135672.8
KLLA0A03443g97531672.9
Scas_638.14104329673.0
Sklu_2321.390649673.1
Scas_630.1470135663.3
CAGL0F07865g84456663.6
YOL089C (HAL9)103033663.6
KLLA0A06039g65741664.1
Scas_590.2117232664.2
KLLA0D10197g85640664.3
CAGL0K11902g83135654.6
KLLA0F14322g71742654.9
YDR034C (LYS14)79043655.0
Scas_449.163630655.0
Scas_688.1776963655.1
KLLA0F02387g72727655.3
Scas_526.3110932655.8
ADR404C87537646.1
Kwal_23.653755228646.4
ABR174W86442646.6
KLLA0F22880g116430646.7
AFL200W59625646.7
Scas_691.3290650646.7
Scas_711.3193234647.1
CAGL0I07755g105338647.5
CAGL0D02904g88734637.8
YLR098C (CHA4)64842638.0
AGR280C110635638.2
AFR096W85252638.2
YPR196W47029638.3
Kwal_26.673267628638.6
YKL222C70546638.7
Kwal_23.652959834638.7
Kwal_56.2305877535638.8
ABL121C128531639.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR107W
         (377 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR107W [1154] [Homologous to ScYPL133C - SH] complement(544402....   719   0.0  
Kwal_26.8662                                                          493   e-175
Scas_700.40                                                           466   e-164
YPL133C (RDS2) [5312] chr16 complement(299887..301227) Protein w...   462   e-162
KLLA0D07029g 602763..604367 some similarities with sp|P19541 Sac...   419   e-144
CAGL0M02651g complement(304583..305971) similar to sp|P19541 Sac...   398   e-137
Kwal_14.1636                                                          102   9e-24
YBR239C (YBR239C) [418] chr2 complement(698311..699900) Protein ...   100   9e-23
AFL031W [3162] [Homologous to ScYBR239C - SH] complement(376161....    93   1e-20
KLLA0F10417g 961004..962527 similar to sp|P38140 Saccharomyces c...    89   5e-19
Scas_597.2                                                             87   2e-18
CAGL0K06985g 681115..682905 similar to sp|P38140 Saccharomyces c...    82   6e-17
Sklu_2207.4 YJL103C, Contig c2207 6715-8313 reverse complement         82   9e-17
KLLA0F13904g complement(1287758..1289497) some similarities with...    80   3e-16
YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protei...    70   1e-12
AFR081C [3273] [Homologous to ScYJL103C - SH] (574366..575814) [...    67   5e-12
Scas_711.18                                                            61   4e-10
CAGL0L03674g 420574..422463 some similarities with sp|P42950 Sac...    61   5e-10
Scas_542.8                                                             45   8e-05
KLLA0D00484g 44879..47893 no similarity, hypothetical start            45   1e-04
YOR162C (YRR1) [4961] chr15 complement(639560..641992) Transcrip...    44   1e-04
KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces...    44   2e-04
CAGL0B03421g complement(336071..340138) similar to sp|P12351 Sac...    44   2e-04
KLLA0A02585g complement(226562..227674) some similarities with c...    42   5e-04
KLLA0F09559g complement(876719..878695) some similarities with s...    42   5e-04
Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement         42   8e-04
CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces c...    41   0.001
AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH] (646832..65...    41   0.001
Scas_709.51                                                            41   0.001
KLLA0F10835g 997512..999782 no similarity, hypothetical start          40   0.003
Sklu_2384.6 YKL015W, Contig c2384 10929-13424                          40   0.003
Scas_573.4                                                             40   0.003
YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription facto...    39   0.005
KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces...    39   0.008
AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH] ...    39   0.008
ACL195C [854] [Homologous to NOHBY] (19204..19533) [330 bp, 109 aa]    36   0.012
Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement      38   0.016
YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with sim...    37   0.017
CAGL0L04400g complement(511762..514725) similar to tr|Q12340 Sac...    38   0.017
Scas_663.12                                                            37   0.030
YLR266C (PDR8) [3660] chr12 complement(675621..677726) Zn[2]-Cys...    37   0.032
Kwal_23.6425                                                           37   0.032
Scas_659.10                                                            37   0.037
ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp, ...    36   0.038
CAGL0L03377g complement(382932..386561) some similarities with s...    36   0.051
YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger transcrip...    36   0.065
AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH] complement(...    36   0.066
AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH] (975879..9...    35   0.075
Scas_702.7                                                             35   0.082
CAGL0G08844g complement(846590..849133) similar to sp|P40467 Sac...    35   0.087
CAGL0M12298g complement(1225753..1228737) similar to sp|P39720 S...    35   0.088
KLLA0F04609g complement(451579..454329) similar to sp|P40467 Sac...    35   0.089
Sklu_2376.6 , Contig c2376 12573-15341 reverse complement              35   0.094
YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with simila...    35   0.095
CAGL0M05907g 622029..624704 similar to sp|P36023 Saccharomyces c...    35   0.097
Scas_662.8                                                             35   0.097
YKR064W (YKR064W) [3315] chr11 (562189..564780) Protein with sim...    35   0.11 
Scas_556.6                                                             35   0.11 
Scas_657.3                                                             35   0.11 
Kwal_23.4754                                                           35   0.13 
YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that cont...    35   0.13 
KLLA0F02750g complement(250368..253814) some similarities with s...    35   0.13 
Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement         35   0.13 
KLLA0F25630g 2378464..2381487 some similarities with sp|P32862 S...    34   0.18 
Sklu_2434.10 YAL051W, Contig c2434 22765-25716                         34   0.21 
CAGL0J07150g complement(686734..689802) similar to sp|P39720 Sac...    34   0.21 
KLLA0A03421g 308414..311056 weakly similar to sp|P39720 Saccharo...    34   0.22 
CAGL0F09229g complement(908186..910693) weakly similar to sp|P39...    34   0.22 
YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with simi...    33   0.26 
KLLA0F19602g complement(1814949..1816760) similar to sp|P43634 S...    33   0.26 
YOR363C (PIP2) [5140] chr15 complement(1020218..1023208) Transcr...    34   0.28 
YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding prote...    33   0.31 
CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces c...    33   0.33 
Sklu_2335.6 YBL005W, Contig c2335 10191-13013                          33   0.36 
KLLA0C14212g complement(1229219..1232341) some similarities with...    33   0.37 
Scas_669.8                                                             33   0.38 
ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    33   0.39 
YER184C (YER184C) [1612] chr5 complement(556291..558675) Protein...    33   0.41 
Scas_625.5                                                             33   0.45 
Kwal_23.3514                                                           33   0.52 
YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation...    33   0.53 
YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finge...    33   0.53 
Scas_234.1                                                             32   0.58 
AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 69...    33   0.58 
Kwal_47.17506                                                          33   0.60 
ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    32   0.76 
CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces cer...    32   0.85 
ACL096W [953] [Homologous to ScYKL015W (PUT3) - SH] complement(1...    32   0.86 
YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription facto...    32   0.88 
Kwal_34.15751                                                          32   0.90 
KLLA0D10153g 858016..859983 weakly similar to sp|P35995 Saccharo...    32   0.97 
Scas_518.5                                                             32   1.0  
Kwal_26.6805                                                           32   1.0  
CAGL0F07909g 776659..779808 some similarities with tr|Q12180 Sac...    32   1.1  
KLLA0D12650g complement(1073580..1075535) weakly similar to ca|C...    32   1.2  
Kwal_14.915                                                            32   1.2  
YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor req...    32   1.3  
KLLA0D11286g complement(964642..966678) no similarity, hypotheti...    31   1.5  
CAGL0G09757g 930351..934622 some similarities with sp|Q05854 Sac...    31   1.7  
Scas_637.7                                                             31   1.9  
Kwal_55.21884                                                          31   2.0  
Sklu_2064.2 , Contig c2064 873-3641                                    31   2.0  
YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway r...    31   2.0  
KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces...    31   2.1  
Scas_721.94                                                            31   2.2  
KLLA0D10593g complement(900326..903103) similar to sp|P08638 Sac...    31   2.3  
CAGL0L09691g complement(1039799..1042273) some similarities with...    31   2.4  
KLLA0C03201g complement(286973..288925) similar to sp|P39529 Sac...    30   2.5  
CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces c...    31   2.5  
KLLA0A09119g complement(797533..800781) weakly similar to sp|P12...    31   2.5  
Kwal_47.17565                                                          30   2.6  
KLLA0C04620g complement(422705..426514) weakly similar to sp|Q05...    30   2.7  
YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protei...    30   2.8  
KLLA0A03443g 311628..314555 weakly similar to sp|P39720 Saccharo...    30   2.9  
Scas_638.14                                                            30   3.0  
Sklu_2321.3 YLR014C, Contig c2321 8747-11467                           30   3.1  
Scas_630.14                                                            30   3.3  
CAGL0F07865g complement(768270..770804) similar to tr|Q12151 Sac...    30   3.6  
YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein i...    30   3.6  
KLLA0A06039g 557368..559341 weakly similar to sp|P36023 Saccharo...    30   4.1  
Scas_590.2                                                             30   4.2  
KLLA0D10197g complement(861726..864296) similar to sp|P05085 Sac...    30   4.3  
CAGL0K11902g complement(1148381..1150876) similar to sp|P40971 S...    30   4.6  
KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1 Kluyver...    30   4.9  
YDR034C (LYS14) [885] chr4 complement(509732..512104) Transcript...    30   5.0  
Scas_449.1                                                             30   5.0  
Scas_688.17                                                            30   5.1  
KLLA0F02387g complement(213669..215852) similar to sp|P47988 Sac...    30   5.3  
Scas_526.3                                                             30   5.8  
ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    29   6.1  
Kwal_23.6537                                                           29   6.4  
ABR174W [767] [Homologous to ScYLR451W (LEU3) - SH] complement(7...    29   6.6  
KLLA0F22880g 2123577..2127071 some similarities with ca|CA3639|I...    29   6.7  
AFL200W [2995] [Homologous to ScYMR168C (CEP3) - SH] complement(...    29   6.7  
Scas_691.32                                                            29   6.7  
Scas_711.31                                                            29   7.1  
CAGL0I07755g complement(745315..748476) similar to tr|Q12180 Sac...    29   7.5  
CAGL0D02904g complement(302952..305615) similar to sp|P07272 Sac...    29   7.8  
YLR098C (CHA4) [3513] chr12 complement(337528..339474) Zinc-fing...    29   8.0  
AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)...    29   8.2  
AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH] complement(...    29   8.2  
YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive regulat...    29   8.3  
Kwal_26.6732                                                           29   8.6  
YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein wi...    29   8.7  
Kwal_23.6529                                                           29   8.7  
Kwal_56.23058                                                          29   8.8  
ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH] (170784..174...    29   9.8  

>ACR107W [1154] [Homologous to ScYPL133C - SH]
           complement(544402..545556) [1155 bp, 384 aa]
          Length = 384

 Score =  719 bits (1857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/377 (92%), Positives = 350/377 (92%)

Query: 1   MSTENVQTDYASTKKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCCDEKLQPGA 60
           MSTENVQTDYASTKKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCCDEKLQPGA
Sbjct: 1   MSTENVQTDYASTKKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCCDEKLQPGA 60

Query: 61  ERLQSQSPLRTETFDVQPVPEHXXXXXXXXXXXXNRYANVINHPKFVSEHIGSEFSSLNE 120
           ERLQSQSPLRTETFDVQPVPEH            NRYANVINHPKFVSEHIGSEFSSLNE
Sbjct: 61  ERLQSQSPLRTETFDVQPVPEHLVAGLGVGAAGGNRYANVINHPKFVSEHIGSEFSSLNE 120

Query: 121 FLTLLEDPLLMEATPSPGCNGQAADPGARXXXXXXXXXXXXXXXQEQPTAKENFFLTAAD 180
           FLTLLEDPLLMEATPSPGCNGQAADPGAR               QEQPTAKENFFLTAAD
Sbjct: 121 FLTLLEDPLLMEATPSPGCNGQAADPGARGPGELVGGVLAGAAPQEQPTAKENFFLTAAD 180

Query: 181 PSTEVEPEDRLKLVINAKLEAGLLQPYNYSQGYARLQNYMDKYMNQSSRQRILKPLSTIR 240
           PSTEVEPEDRLKLVINAKLEAGLLQPYNYSQGYARLQNYMDKYMNQSSRQRILKPLSTIR
Sbjct: 181 PSTEVEPEDRLKLVINAKLEAGLLQPYNYSQGYARLQNYMDKYMNQSSRQRILKPLSTIR 240

Query: 241 PAFRAIARSLKDVDLVLVEEGFERMLLSYDRVFTSMSMPACLWRRTGEIYRGNKEFASLV 300
           PAFRAIARSLKDVDLVLVEEGFERMLLSYDRVFTSMSMPACLWRRTGEIYRGNKEFASLV
Sbjct: 241 PAFRAIARSLKDVDLVLVEEGFERMLLSYDRVFTSMSMPACLWRRTGEIYRGNKEFASLV 300

Query: 301 DCTVDDLRDGNLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTSCNLRSKDGRKRRPCC 360
           DCTVDDLRDGNLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTSCNLRSKDGRKRRPCC
Sbjct: 301 DCTVDDLRDGNLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTSCNLRSKDGRKRRPCC 360

Query: 361 FSFTIRRDRYNIPICII 377
           FSFTIRRDRYNIPICII
Sbjct: 361 FSFTIRRDRYNIPICII 377

>Kwal_26.8662
          Length = 355

 Score =  493 bits (1268), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 247/371 (66%), Positives = 283/371 (76%), Gaps = 38/371 (10%)

Query: 14  KKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCCDEKL------QPGAERLQSQS 67
           KKRKKV KAC+ CRRSHMIC+++RPCSRC+KRDIGH C DE+L      +P AE+LQ+  
Sbjct: 7   KKRKKVSKACIYCRRSHMICNEQRPCSRCVKRDIGHLCRDEELRLALDVEPDAEQLQTD- 65

Query: 68  PLRTETFDVQPVPEHXXXXXXXXXXXXNRYANVINH-PKFVSEHIGSEFSSLNEFLTLLE 126
               + +    VP+               Y  +++  P FVSEH+GSEFSSLNEFL +LE
Sbjct: 66  --LGQVYKSGSVPQQPLKS--------GAYGGLLSQQPTFVSEHVGSEFSSLNEFLNMLE 115

Query: 127 DPLLMEATPSPGCNGQAADPGARXXXXXXXXXXXXXXXQEQPTAKENFFLTAADPSTEVE 186
           DPL++E    P    +                      Q+QPT KENFFLTAADPS E+ 
Sbjct: 116 DPLILEPPAIPKLPPRNP--------------------QDQPTLKENFFLTAADPSAEMT 155

Query: 187 PEDRLKLVINAKLEAGLLQPYNYSQGYARLQNYMDKYMNQSSRQRILKPLSTIRPAFRAI 246
           PEDRLK VINAKLEAGLLQPYNY++GYARLQ YMD +M+ +S+QRIL+PLS IRP FRAI
Sbjct: 156 PEDRLKSVINAKLEAGLLQPYNYARGYARLQTYMDDHMDLASKQRILRPLSIIRPEFRAI 215

Query: 247 ARSLKDVDLVLVEEGFERMLLSYDRVFTSMSMPACLWRRTGEIYRGNKEFASLVDCTVDD 306
           AR+L+DVDL+LVEE FERMLLSYDRVFTSMSMPACLWRRTGEIYRGNKEFASLVDC VDD
Sbjct: 216 ARTLRDVDLILVEESFERMLLSYDRVFTSMSMPACLWRRTGEIYRGNKEFASLVDCKVDD 275

Query: 307 LRDGNLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTSCNLRSKDGRKRRPCCFSFTIR 366
           LRDG LAIYELMTEES VNFWEKYGSIAFDK QKAVLTSC+LRS+DG K+RPCCFSFTIR
Sbjct: 276 LRDGKLAIYELMTEESVVNFWEKYGSIAFDKDQKAVLTSCHLRSRDGSKKRPCCFSFTIR 335

Query: 367 RDRYNIPICII 377
           RDRYNIPICI+
Sbjct: 336 RDRYNIPICIV 346

>Scas_700.40
          Length = 407

 Score =  466 bits (1200), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 234/402 (58%), Positives = 278/402 (69%), Gaps = 27/402 (6%)

Query: 1   MSTENVQTDYASTKKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCCDE------ 54
           M+ +N   D+   KKRKK  K+C+ CRRSH+ CD +RPCSRC+KR I + C         
Sbjct: 1   MNGDNSNNDHGGNKKRKKT-KSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATAEMG 59

Query: 55  -KLQPGAERLQSQSPLRTETFDVQPVP------EHXXXXXXXXXXXXNRYANVINHPKFV 107
             + P  + +++ +P  +  ++  P+P                    N    +   P F+
Sbjct: 60  LNMSPPQDSIRTGAP-GSSMYETPPIPNSINTYNKMVSSATGTTPATNPNLYLPQQPSFI 118

Query: 108 SEHIGSEFSSLNEFLTLLEDPLLMEATPS------------PGCNGQAADPGARXXXXXX 155
           SE+ GSEF+SLNEFL +LEDP L+E TP                                
Sbjct: 119 SENAGSEFNSLNEFLNMLEDPSLLENTPGITQFPQVQQQQQQQQQQPTPQSNLPPAPLPP 178

Query: 156 XXXXXXXXXQEQPTAKENFFLTAADPSTEVEPEDRLKLVINAKLEAGLLQPYNYSQGYAR 215
                    + QPT KE FFLTAADPSTE+ PEDRLKLVINAKLEAGLL+PYNY++GYAR
Sbjct: 179 LSTRSSTSSEPQPTLKEQFFLTAADPSTEMTPEDRLKLVINAKLEAGLLKPYNYAKGYAR 238

Query: 216 LQNYMDKYMNQSSRQRILKPLSTIRPAFRAIARSLKDVDLVLVEEGFERMLLSYDRVFTS 275
           LQ YMD+ M QSS+QRILKPLSTIRPAFR IARSLKDVDL+LVEE FER+LLSYDRVFTS
Sbjct: 239 LQKYMDENMEQSSKQRILKPLSTIRPAFRTIARSLKDVDLILVEENFERLLLSYDRVFTS 298

Query: 276 MSMPACLWRRTGEIYRGNKEFASLVDCTVDDLRDGNLAIYELMTEESAVNFWEKYGSIAF 335
           MSMPACLWRRTGEIYR NKEFA+LVDCTVD+LRDG LAIYELM+EESAVNFWEKYGSIAF
Sbjct: 299 MSMPACLWRRTGEIYRANKEFATLVDCTVDELRDGKLAIYELMSEESAVNFWEKYGSIAF 358

Query: 336 DKGQKAVLTSCNLRSKDGRKRRPCCFSFTIRRDRYNIPICII 377
           DKGQK VLTSCNL+++DG +++ CCFSFTIRRDRYNIPICI+
Sbjct: 359 DKGQKTVLTSCNLQTRDGSRKKNCCFSFTIRRDRYNIPICIV 400

>YPL133C (RDS2) [5312] chr16 complement(299887..301227) Protein with
           similarity to transcription factors, has Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region, involved in resistance to the antifungal drug
           ketoconazole [1341 bp, 446 aa]
          Length = 446

 Score =  462 bits (1190), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 243/435 (55%), Positives = 282/435 (64%), Gaps = 68/435 (15%)

Query: 11  ASTKKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCCDEKL------------QP 58
           +  K+  K  K C+ C+RSH++CD +RPCSRC+KRDI H C ++ +             P
Sbjct: 5   SGVKRASKAFKTCLFCKRSHVVCDKQRPCSRCVKRDIAHLCREDDIAVPNEMPSQHESSP 64

Query: 59  GAERLQSQSPLRTET---FDVQPVPEHXXXXXXXXXXXXNRYANVIN---------HPKF 106
               +Q +   +  T    D Q  P +               ++++N          P F
Sbjct: 65  NDNNIQGKYANKAHTGIPSDYQNEPVNKSGSTYGEELSPKLDSSLVNDTTSLLLPQQPVF 124

Query: 107 VSEHIGSEFSSLNEFLTLLEDPLLME------------------ATPSP----------- 137
           VSE++GSEFSSLNEFL++LE+PLL +                   T SP           
Sbjct: 125 VSENVGSEFSSLNEFLSMLENPLLTQTSLSSSSASNVHLENGSQTTQSPLEYQNDNRRDE 184

Query: 138 ---------------GCNGQAADPGARXXXXXXXXXXXXXXXQEQPTAKENFFLTAADPS 182
                          G +   +    +                  PT KE FFLTAADPS
Sbjct: 185 IGVARQENRSPTIMSGSSNSISKGDKQDQEKEESRILANANENSAPTPKEQFFLTAADPS 244

Query: 183 TEVEPEDRLKLVINAKLEAGLLQPYNYSQGYARLQNYMDKYMNQSSRQRILKPLSTIRPA 242
           TE+ PE RLKLVINAKLEAGLL+PYNY++GYARLQ+YMDKYMNQSS+QRILKPLSTIRPA
Sbjct: 245 TEMTPEHRLKLVINAKLEAGLLKPYNYAKGYARLQDYMDKYMNQSSKQRILKPLSTIRPA 304

Query: 243 FRAIARSLKDVDLVLVEEGFERMLLSYDRVFTSMSMPACLWRRTGEIYRGNKEFASLVDC 302
           FR IARSLKDVDLVLVEE FERMLLSYDRVFTSMSMPACL RRTGEIYR NKEFASLVDC
Sbjct: 305 FRTIARSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLCRRTGEIYRANKEFASLVDC 364

Query: 303 TVDDLRDGNLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTSCNLRSKDGRKRRPCCFS 362
           TVDDLRDG LAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTSC+LR+KDG ++RPCCFS
Sbjct: 365 TVDDLRDGKLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTSCSLRTKDGIRKRPCCFS 424

Query: 363 FTIRRDRYNIPICII 377
           FTIRRDRYNIPICI+
Sbjct: 425 FTIRRDRYNIPICIV 439

>KLLA0D07029g 602763..604367 some similarities with sp|P19541
           Saccharomyces cerevisiae YPL133c, hypothetical start
          Length = 534

 Score =  419 bits (1078), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 213/323 (65%), Positives = 233/323 (72%), Gaps = 46/323 (14%)

Query: 101 INHPKFVSEHIGSEFSS-----------------------LNEFLTLLEDP--------- 128
           +N P F+SEHIGSEFSS                       +N  +T  + P         
Sbjct: 205 LNQPLFLSEHIGSEFSSLNEFLTMLEDPMLIEPGTPIQHHMNAQITAADHPAQATDQPEY 264

Query: 129 ------LLMEATPSPG--------CNGQAADPGARXXXXXXXXXXXXXXXQEQPTAKENF 174
                 +  E T  P          + Q   P                   +QPT KENF
Sbjct: 265 HSQQPLVAHEVTTQPNNMNNSQHPMHTQMQSPVHSNVQNAGGMSPPLLPDDQQPTPKENF 324

Query: 175 FLTAADPSTEVEPEDRLKLVINAKLEAGLLQPYNYSQGYARLQNYMDKYMNQSSRQRILK 234
           FLTAADPSTE+ PEDRLKLVINAKLEAGLLQPYNY++GY+RLQ +MDKYMNQSS+QRILK
Sbjct: 325 FLTAADPSTEINPEDRLKLVINAKLEAGLLQPYNYAKGYSRLQKFMDKYMNQSSKQRILK 384

Query: 235 PLSTIRPAFRAIARSLKDVDLVLVEEGFERMLLSYDRVFTSMSMPACLWRRTGEIYRGNK 294
           PLS IRPAFRAIARSLKDVDLVLVEE FERMLLSYDRVFTSMSMPACLWRRTGEIYRGNK
Sbjct: 385 PLSIIRPAFRAIARSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRRTGEIYRGNK 444

Query: 295 EFASLVDCTVDDLRDGNLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTSCNLRSKDGR 354
           EFASLVDC VD+LRDG LAIYELM+EESAVNFWEKYGSIAFDKGQKAVLTSCNLR++DGR
Sbjct: 445 EFASLVDCKVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKAVLTSCNLRTRDGR 504

Query: 355 KRRPCCFSFTIRRDRYNIPICII 377
           +RRPCCFSFTIRRDRYNIPICI+
Sbjct: 505 QRRPCCFSFTIRRDRYNIPICIV 527

 Score = 67.8 bits (164), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 38/60 (63%), Gaps = 5/60 (8%)

Query: 22 ACVLCRRSHMICDDRRPCSRCIKRDIGHFCCDEKLQ---PGAERLQSQS--PLRTETFDV 76
          ACV CRRSHM+CD++RPCSRC+KR IGH C DE  +   PG     S S   LR    DV
Sbjct: 16 ACVFCRRSHMVCDEQRPCSRCVKRSIGHLCRDEDPEGALPGTVEHSSSSGLELRVPKVDV 75

>CAGL0M02651g complement(304583..305971) similar to sp|P19541
           Saccharomyces cerevisiae YPL133c, hypothetical start
          Length = 462

 Score =  398 bits (1022), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 184/212 (86%), Positives = 200/212 (94%)

Query: 166 EQPTAKENFFLTAADPSTEVEPEDRLKLVINAKLEAGLLQPYNYSQGYARLQNYMDKYMN 225
           + PT+KE FFLTAADPSTE+ P DRLKLVINAKLEAGLL+PY+Y++GYARLQ YMDKYMN
Sbjct: 237 DTPTSKEQFFLTAADPSTEMNPVDRLKLVINAKLEAGLLKPYDYAKGYARLQEYMDKYMN 296

Query: 226 QSSRQRILKPLSTIRPAFRAIARSLKDVDLVLVEEGFERMLLSYDRVFTSMSMPACLWRR 285
            +++QRILKPL +IRPAFR IA+SLKDVDLVLVEE FERMLLSYDRVFTSMSMPACLWRR
Sbjct: 297 DTNKQRILKPLMSIRPAFRTIAKSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRR 356

Query: 286 TGEIYRGNKEFASLVDCTVDDLRDGNLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTS 345
           TGEIYR NKEFASLVDCTVDDLRDG LAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTS
Sbjct: 357 TGEIYRANKEFASLVDCTVDDLRDGKLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTS 416

Query: 346 CNLRSKDGRKRRPCCFSFTIRRDRYNIPICII 377
           C+LR+KDG K+RPCCFSFTIRRDRYNIPICI+
Sbjct: 417 CSLRTKDGLKKRPCCFSFTIRRDRYNIPICIV 448

 Score = 95.9 bits (237), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 79/147 (53%), Gaps = 17/147 (11%)

Query: 12  STKKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFC-CDE---KLQPGAERLQSQS 67
           + KK+KK+ K+C+ CRRSH+ CD +RPCSRCIKR+IGH C  DE    +Q   +   S S
Sbjct: 5   AAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCVADENVSNIQSQYQYKNSMS 64

Query: 68  PLRT------------ETFDVQPVPEHXXXXXXXXXXXXNRYANVINHPKFVSEHIGSEF 115
           P+ +            ET  +Q                 N    +   P FVSE++GSEF
Sbjct: 65  PIGSTEIPNAEINIGDETRAIQGSNSSVYGTETPISSSNNNLL-LPPQPNFVSENVGSEF 123

Query: 116 SSLNEFLTLLEDPLLMEATPSPGCNGQ 142
           SSLNEFL +LE+P+  E+  +   N +
Sbjct: 124 SSLNEFLMMLENPIPGESENTSQSNKE 150

>Kwal_14.1636
          Length = 456

 Score =  102 bits (254), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 95/174 (54%), Gaps = 1/174 (0%)

Query: 205 QPYNYSQGYARLQNYMDKYMNQSSRQRILKPLSTIRPAFRAIARSLKDVDLVLVEEGFER 264
           +P++++ G+  L  Y+    N+     + + L+  RP F AIA +L + D++ +E+ ++R
Sbjct: 273 RPFSHTSGFHSLLQYLRARFNREDVVEMCRSLAEFRPTFIAIAVTLTEEDMIFMEQCYQR 332

Query: 265 MLLSYDRVFTSMSMPACLWRRTGEIYRGNKEFASLVDCTVDDLRDGNLAIYELMTEESAV 324
            LL YD+  + +  P C+WRR G+I   + EF+ L   T  DL      I ELM +ES  
Sbjct: 333 TLLEYDQFISQLGTPTCVWRRNGQISYVSDEFSLLTGWTRADLLFKMTFIVELMDDESVR 392

Query: 325 NFWEKYGSIAF-DKGQKAVLTSCNLRSKDGRKRRPCCFSFTIRRDRYNIPICII 377
            +++ +  +A+ D      + +C L +    ++  CC  +T++RD + +P+ II
Sbjct: 393 EYFKTFNRVAYRDFKGSERMKTCRLLTPVKGRQIECCCIWTLKRDVFGLPLMII 446

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%)

Query: 15 KRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCCD 53
          +R+K   AC+ C +SH+ C   RPC+RC+K+ +   C D
Sbjct: 4  RRQKTSVACINCSKSHVTCQAERPCTRCVKKGLEASCVD 42

>YBR239C (YBR239C) [418] chr2 complement(698311..699900) Protein
           with similarity to transcription factors, has
           Zn[2]-Cys[6] fungal-type binuclear cluster domain in the
           N-terminal region [1590 bp, 529 aa]
          Length = 529

 Score = 99.8 bits (247), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 103/201 (51%), Gaps = 1/201 (0%)

Query: 178 AADPSTEVEPEDRLKLVINAKLEAGLLQPYNYSQGYARLQNYMDKYMNQSSRQRILKPLS 237
           AA+  + VE E  L+     ++   +  P++++ G+  L  Y+    NQ    ++ + ++
Sbjct: 321 AANIKSNVEWEHSLRYSTPMEIYTSINAPFSHTPGFHHLLVYLKHRFNQQDLVKMCRSIA 380

Query: 238 TIRPAFRAIARSLKDVDLVLVEEGFERMLLSYDRVFTSMSMPACLWRRTGEIYRGNKEFA 297
             RP F A + +L + D++ +E+ ++R LL Y +    +  P C+WRR G+I   N+EF 
Sbjct: 381 EFRPIFIACSVTLTEEDMIFMEQCYQRTLLEYVKFIAQIGTPTCIWRRNGQISYVNEEFE 440

Query: 298 SLVDCTVDDLRDGNLAIYELMTEESAVNFWEKYGSIAF-DKGQKAVLTSCNLRSKDGRKR 356
            L   T ++L +    I E+M +ES  ++++    +A+ D      +  C L S    K 
Sbjct: 441 ILCGWTREELLNKMTFIVEIMDDESVRDYFKTLSKVAYRDFRGSEKMKVCRLLSPIKGKI 500

Query: 357 RPCCFSFTIRRDRYNIPICII 377
             CC  +T++RD   +P+ I+
Sbjct: 501 IHCCCMWTLKRDVSGLPLMIL 521

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 20/32 (62%)

Query: 22 ACVLCRRSHMICDDRRPCSRCIKRDIGHFCCD 53
          ACV C R H+ C+ +RPC RCI + +   C D
Sbjct: 39 ACVNCSRLHVSCEAKRPCLRCISKGLTATCVD 70

>AFL031W [3162] [Homologous to ScYBR239C - SH]
           complement(376161..377714) [1554 bp, 517 aa]
          Length = 517

 Score = 93.2 bits (230), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 90/175 (51%), Gaps = 3/175 (1%)

Query: 205 QPYNYSQGYARLQNYMDKYMNQSSRQRILKPLSTIRPAFRAIARSLKDVDLVLVEEGFER 264
           +P+ ++ G+  L  Y+    ++     + + ++  RP F A A  L + D++ +E+ ++R
Sbjct: 311 EPFCHTSGFHSLLKYLHSRFHRHDLVEMCRSIAEFRPIFIASAVDLTEEDMIFMEQSYQR 370

Query: 265 MLLSYDRVFTSMSMPACLWRRTGEIYRGNKEFASLVDCTVDDLRDGNLAIYELMTEESAV 324
            LL YDR  T +  P C+WRR G+I   N EF  L   T ++L      I EL+ + S  
Sbjct: 371 TLLEYDRFITQIGTPTCVWRRNGQISYLNDEFCLLTGWTREELLSKMTFIVELLDDNSVR 430

Query: 325 NFWEKYGSIAFD--KGQKAVLTSCNLRSKDGRKRRPCCFSFTIRRDRYNIPICII 377
            +++ +  +A+   KG + + T   L   +GR     C  +T +RD + +P+ I+
Sbjct: 431 EYFKTFSKVAYKDFKGFEQMETCVLLSPIEGRTIECSCM-WTWKRDVFGMPMMIV 484

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 63/138 (45%), Gaps = 15/138 (10%)

Query: 15  KRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCCD-----EKLQPGAERLQSQSPL 69
           KRKK   ACV C RSH+ C+ +RPC+RC+K+ +   C +      K        Q   PL
Sbjct: 11  KRKKTNVACVNCSRSHVTCESQRPCTRCVKKGLEMSCVNAPRKRRKYLADVPEDQLPIPL 70

Query: 70  RTETFDVQP-VPEHXXXXXXXXXXXXNRY---ANVINHPKFVSEHIGSEFSSLNEFL--- 122
           +    D  P + E             +++     +++ PKF+S     E+S+L++ +   
Sbjct: 71  KPADADAGPGMSERDGAAESGSKGPEHQFQDQGKIVHKPKFLSNAANLEYSTLSDIIHQD 130

Query: 123 TLLED---PLLMEATPSP 137
           TLL      LL   T SP
Sbjct: 131 TLLNKIPVSLLYNGTDSP 148

>KLLA0F10417g 961004..962527 similar to sp|P38140 Saccharomyces
           cerevisiae YBR239c, start by similarity
          Length = 507

 Score = 88.6 bits (218), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 88/169 (52%), Gaps = 1/169 (0%)

Query: 210 SQGYARLQNYMDKYMNQSSRQRILKPLSTIRPAFRAIARSLKDVDLVLVEEGFERMLLSY 269
           + G+  L  Y+ +  +++    + + L+ +RP F A    L D D++ +E+  +R LL Y
Sbjct: 324 TTGFHALLRYLKRRFDKNQLVEMCRCLAELRPIFIASTIDLTDEDMIFMEKSHQRTLLEY 383

Query: 270 DRVFTSMSMPACLWRRTGEIYRGNKEFASLVDCTVDDLRDGNLAIYELMTEESAVNFWEK 329
           ++  + +  P C+WRR G+I   N EF+ L      +L +    I ELM  ++ + +++ 
Sbjct: 384 EKFISQVGTPTCVWRRNGQISYVNDEFSLLTGWNRLELLNKMTFIVELMDGDTVMEYFQT 443

Query: 330 YGSIAFDKGQKA-VLTSCNLRSKDGRKRRPCCFSFTIRRDRYNIPICII 377
           +  +A+   + A  +  CNL +        CC  +T++RD + +P+ II
Sbjct: 444 FTRVAYQGFRGAETMRICNLLTPIKGSVIKCCCLWTLKRDAFGLPMMII 492

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 29/42 (69%)

Query: 12 STKKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCCD 53
          S K+ KKV  ACV C +SH+ CDD RPC+RCI++ +   C D
Sbjct: 2  SVKRNKKVSVACVHCAKSHVTCDDNRPCTRCIRKGLEESCID 43

>Scas_597.2
          Length = 540

 Score = 87.0 bits (214), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 103/202 (50%), Gaps = 3/202 (1%)

Query: 178 AADPSTEVEPEDRLKLVINAKLEAGLLQPYNYSQGYARLQNYMDKYMNQSSRQRILKPLS 237
           A  P    E E  L+     ++   + +P+ ++ G+  L  Y+    NQ     + + ++
Sbjct: 332 AFTPRCNREWEHSLRYSSPMEIYTLINEPFCHTMGFRHLLLYLRNRFNQKDIVSMCRSMT 391

Query: 238 TIRPAFRAIARSLKDVDLVLVEEGFERMLLSYDRVFTSMSMPACLWRRTGEIYRGNKEFA 297
             RP F A + +L + D++ +E+ ++R LL Y +    +  P C+WRR G+I   N+EF 
Sbjct: 392 EFRPIFIACSMTLTEEDMIFMEQCYQRTLLEYSKFIGQIGTPTCVWRRNGQISYINEEFE 451

Query: 298 SLVDCTVDDLRDGNLAIYELMTEESAVNFWEKYGSIAFD--KGQKAVLTSCNLRSKDGRK 355
            L   T ++L +    I E++ ++S  ++++ + S+A+   KG + + T C L +    +
Sbjct: 452 ILTGWTREELLNKMTFIVEILDDDSVRDYFKTFSSVAYKDFKGCEQMKT-CRLLTPLEGQ 510

Query: 356 RRPCCFSFTIRRDRYNIPICII 377
              C   +T++RD   +P+ I+
Sbjct: 511 VVNCGCMWTLKRDISGLPLMIL 532

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 29/44 (65%)

Query: 11 ASTKKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCCDE 54
          + T KR+K+  AC  C +SH  CD  RPCSRCIK+++   C D+
Sbjct: 31 SQTGKRRKINVACSNCAKSHSSCDSCRPCSRCIKKELQDSCVDK 74

>CAGL0K06985g 681115..682905 similar to sp|P38140 Saccharomyces
           cerevisiae YBR239c, hypothetical start
          Length = 596

 Score = 82.4 bits (202), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 108/226 (47%), Gaps = 18/226 (7%)

Query: 166 EQPTAKENFFLTAADPSTEVEPEDRLKLVINAKLEAGLL------------QPYNYSQGY 213
           E+ T  EN+   A   S E  P D  +L  N + +  L             +P++++ G+
Sbjct: 368 EKVTDTENY---AVSVSVECPPPDGSRLYNNVEWDHSLKYGTPVEIYKLINEPFSHTPGF 424

Query: 214 ARLQNYMDKYMNQSSRQRILKPLSTIRPAFRAIARSLKDVDLVLVEEGFERMLLSYDRVF 273
             L  Y+ K  +Q     + + ++  RP F A + +L + D++ +E+ ++R LL Y +  
Sbjct: 425 RHLLQYLRKRFSQKDLVSMCQNMAYFRPIFIACSITLTEEDMIFMEQCYQRTLLQYVKFI 484

Query: 274 TSMSMPACLWRRTGEIYRGNKEFASLVDCTVDDLRDGNLAIYELMTEESAVNFWEKYGSI 333
             +  P  +WRR G+I   N EF  L     ++L D    I E++ +ES   +++ +  I
Sbjct: 485 QEIGTPTVVWRRNGQISYVNDEFEILSGWKREELLDKMSFIVEIIDDESVREYFKTFARI 544

Query: 334 AFD--KGQKAVLTSCNLRSKDGRKRRPCCFSFTIRRDRYNIPICII 377
           A++  KG +  +  C L +    +   C   +T++RD   +P+ I+
Sbjct: 545 AYNNIKGSEQ-MDVCRLLTPIRNQVIECKCIWTLKRDMSGLPLMIL 589

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (63%)

Query: 7  QTDYASTKKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCCD 53
          QT +   KKRK    ACV C R+H  C+ +RPCSRCIK+ I + C D
Sbjct: 52 QTSHTVKKKRKNTNVACVNCSRNHSSCEQKRPCSRCIKKGIANTCVD 98

>Sklu_2207.4 YJL103C, Contig c2207 6715-8313 reverse complement
          Length = 532

 Score = 82.0 bits (201), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 98/202 (48%), Gaps = 29/202 (14%)

Query: 203 LLQPYNYSQGYARLQNYM-DKYMNQSSRQR--------------ILKPLST-IRPAFRAI 246
           L++P+NY   Y  L  Y+ D++++    Q+              I   ++T   P F  +
Sbjct: 321 LIKPHNYRAAYRDLLMYLRDRFLDSRGSQKNTSKNRDGPQHLQHIAHSIATHYAPIFVTL 380

Query: 247 ARSLKDVDLVLVEEGFERMLLSYDRVFTSMS-MPACLWRRTGEIYRGNKEFASLVDCTVD 305
             +L + DL L E   +R LL Y+ +   ++  P C+WRR+GEI   + EF SL      
Sbjct: 381 TTNLIENDLKLQELILQRTLLEYENMAKLVNCTPMCIWRRSGEICYVSNEFVSLTGFPRK 440

Query: 306 DLRDGNLAIYELMTEESAVNFWE----------KYGSIAFDKGQKAVLTSCNLRSKDGRK 355
           D+      I E + +ES V++++          K G+     GQ AV + CNL  K+G  
Sbjct: 441 DMLSKRRFILEFLDDESVVDYFDIFHEYLAFGSKEGAGGTSDGQ-AVFSECNLLLKNGTY 499

Query: 356 RRPCCFSFTIRRDRYNIPICII 377
            +  C  +T++RD YNIP+ ++
Sbjct: 500 LKCACI-WTVKRDGYNIPLLVM 520

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 26/40 (65%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCCD 53
          + RK + KACV C   H+ CD  RPC  C++R+IGH C D
Sbjct: 11 QTRKPIQKACVFCHEKHLQCDVGRPCQNCLRRNIGHECRD 50

>KLLA0F13904g complement(1287758..1289497) some similarities with
           sp|P42950 Saccharomyces cerevisiae YJL103c, hypothetical
           start
          Length = 579

 Score = 80.5 bits (197), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 102/221 (46%), Gaps = 38/221 (17%)

Query: 187 PEDRLKLVINAKLEAGLLQPYNYSQGYARLQNYMD-KYMN-------QSSR------QRI 232
           PED  K          L+QP+NY   Y  L  ++  +++N       +S R      Q I
Sbjct: 357 PEDLYK-------HQALIQPHNYKSAYLELLRFLRWRFINSDKPSSGKSQRDGPEQLQNI 409

Query: 233 LKPLST-IRPAFRAIARSLKDVDLVLVEEGFERMLLSYDRVFTSMS-MPACLWRRTGEIY 290
              + T   P F  +  SL   DL L E   +R LL Y+ +   ++  P C+WRR+GEI 
Sbjct: 410 AHSIKTHYAPIFVTLTNSLIAQDLKLQEIILQRALLEYESMAKLVNCTPMCIWRRSGEIC 469

Query: 291 RGNKEFASLVDCTVDDLRDGNLAIYELMTEESAVNFWEKYGS-IAFDKGQ---------- 339
             + EF SL      ++ +    I E M  ES V++++ +   +AF   Q          
Sbjct: 470 FASNEFISLTGFNKKEILNKRKFIMEFMDNESIVDYYDIFHEYLAFGSTQSGPFNSSTGT 529

Query: 340 ---KAVLTSCNLRSKDGRKRRPCCFSFTIRRDRYNIPICII 377
              +A+ + CNL  K+G   R  C  +T++RD +NIP+ I+
Sbjct: 530 SDGQAIFSECNLLLKNGCYLRCACI-WTVKRDAFNIPMLIM 569

 Score = 48.5 bits (114), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 25/43 (58%)

Query: 16 RKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCCDEKLQP 58
          RK +  ACV C   H+ CD  RPC  C KR IG  C D++ +P
Sbjct: 13 RKPIPTACVFCHEKHLQCDLGRPCQNCSKRGIGDTCRDKERKP 55

>YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protein
           with similarity to transcription factors, contains a
           Zn[2]-Cys[6] fungal-type binuclear cluster domain in the
           N-terminal region [1857 bp, 618 aa]
          Length = 618

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 95/231 (41%), Gaps = 58/231 (25%)

Query: 203 LLQPYNYSQGYARLQNYM-----------------DKYMNQSSRQR------ILKPLSTI 239
           L++P+NY   Y +L   +                 D++  Q    R      I   L   
Sbjct: 380 LIKPHNYKLAYTKLLTTLRKKFLEGAEIDKSASVKDEHSTQKHNLRYDLEVIIRSILERY 439

Query: 240 RPAFRAIARSLKDVDLVLVEEGFERMLLSYDRVFTSMS-MPACLWRRTGEIYRGNKEFAS 298
            P F ++  ++ + DL+L E   +R LL  + +   +S  P C+WRR+GEI   + EF S
Sbjct: 440 APIFISLTSNMIEEDLLLQEVTLQRALLDLENMAKLVSCTPMCIWRRSGEICFVSNEFYS 499

Query: 299 LVDCTVDDLRDGNLAIYELMTEESAVNFWEKYGSI------------------------- 333
           L     + L D    I+E +  +S  N+++ +  +                         
Sbjct: 500 LTGFNKNLLLDRTSFIFEYLDHKSVSNYFQIFNELLAFGYNDINKRKKLLMLNACSSTSS 559

Query: 334 ------AFDKGQKAVLTSCNLRSKDGRKRR-PCCFSFTIRRDRYNIPICII 377
                 +F    KA+ T CNL   +G   +  CC  +T++RD +NIPI ++
Sbjct: 560 KITEGFSFTTDGKAIFTKCNLLLSNGLYLKCACC--WTVKRDSFNIPILVM 608

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (60%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFC 51
          + RK +  AC  C   H+ CD  RPC  C+KR+IG FC
Sbjct: 11 QTRKSIQTACEFCHTKHIQCDVGRPCQNCLKRNIGKFC 48

>AFR081C [3273] [Homologous to ScYJL103C - SH] (574366..575814)
           [1449 bp, 482 aa]
          Length = 482

 Score = 67.4 bits (163), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 91/194 (46%), Gaps = 23/194 (11%)

Query: 206 PYNYSQGYARLQNYMDKYM----NQSSRQRILKPLSTIR--------PAFRAIARSLKDV 253
           P+NY Q Y  L N +        ++ +R+   K L +I         P F  +  +L + 
Sbjct: 278 PHNYRQAYLELLNILRARFLSAQDEIAREEGPKQLHSIAQSIKTYYAPIFVTLTSNLIES 337

Query: 254 DLVLVEEGFERMLLSYDRVFTSMS-MPACLWRRTGEIYRGNKEFASLVDCTVDDLRDGNL 312
           DL + E   +R LL Y+ +   ++ +P C+WRR+GEI   + EF SL   +  +L     
Sbjct: 338 DLKMHELILQRTLLEYENMSKMVNCIPMCIWRRSGEICYVSNEFISLTGFSRRELLMRRR 397

Query: 313 AIYELMTEESAVNFWEKYGS-IAFDKGQ--------KAVLTSCNLRSKDGRKRRPCCFSF 363
            I E       V++++ +   +AF   +        +AV + CNL   +    +  C  +
Sbjct: 398 FIMEFFDNHGIVDYFKLFNEYLAFSSKEGFSSTSDGQAVFSECNLLMANNSFLKCACI-W 456

Query: 364 TIRRDRYNIPICII 377
           T++RD +NIP+ ++
Sbjct: 457 TVKRDSFNIPMLVM 470

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 23/38 (60%)

Query: 16 RKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCCD 53
          RK + +ACV C   H+ CD  RPC  C KR+IG  C D
Sbjct: 13 RKPISRACVFCHEKHLQCDVGRPCQNCEKRNIGESCRD 50

>Scas_711.18
          Length = 509

 Score = 61.2 bits (147), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 69/153 (45%), Gaps = 16/153 (10%)

Query: 241 PAFRAIARSLKDVDLVLVEEGFERMLLSYDRVFT-SMSMPACLWRRTGEIYRGNKEFASL 299
           P   A+   +   D    E   +RMLL  + + T S   P  +WRRTGEI   N EF SL
Sbjct: 350 PVILALETGMIPDDFQFQELTLQRMLLDLEDMATFSNCTPLVIWRRTGEICFANNEFLSL 409

Query: 300 VDCTVDDLRDGNLAIYELMTEESAVNFWEKYGS-IAFD-----------KGQKAVLTSCN 347
              T  +L      I+E    +S  N+++K+ S +AF             G++    +  
Sbjct: 410 TGYTDVELTSRQRFIFEFWDRQSVFNYFKKFHSMLAFGPIEKEGQTETYPGRRWSFNNSV 469

Query: 348 LRSKDGRK---RRPCCFSFTIRRDRYNIPICII 377
            RSK   K      C   +TIRRD +NIP+ ++
Sbjct: 470 DRSKILLKNGFHLNCATCWTIRRDTFNIPLLVV 502

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 25/43 (58%)

Query: 11 ASTKKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCCD 53
          ++   RK +  AC  C   H+ CD  RPC  CIKR+IG+ C D
Sbjct: 22 STPPARKSIPIACEFCHIKHLQCDVGRPCKNCIKRNIGNTCKD 64

>CAGL0L03674g 420574..422463 some similarities with sp|P42950
           Saccharomyces cerevisiae YJL103c, hypothetical start
          Length = 629

 Score = 61.2 bits (147), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 96/223 (43%), Gaps = 50/223 (22%)

Query: 203 LLQPYNYSQGYARLQNYMDK-YMNQSSRQRILKPLSTIR-------PAFRAIARSLKDVD 254
           L++P+NY   Y +L   ++K +++ +S +R  +  S ++       P F A+  ++ + D
Sbjct: 399 LIKPHNYRHTYKKLLEQLEKIFLSDNSPKRRGQLQSIVKCILEDYVPTFIALTSNMIESD 458

Query: 255 LVLVEEGFERMLLSYDRVFTSMS-MPACLWRRTGEIYRGNKEFASLVDCTVDDLRDGNLA 313
           L L E   +R LL  + +   ++  P C+WRR+GEI   + EF  L      ++      
Sbjct: 459 LYLQELTLQRTLLELESMAKLVNCSPICIWRRSGEISYVSDEFLQLTGFKRKEILASRRF 518

Query: 314 IYELMTEESAVNFWEKYGS-IAFDKGQKAVLTSCNLRSKDG--------RKRRP------ 358
           I+E +   S VN++  +   +AF  G K  +TS     K G        RK  P      
Sbjct: 519 IFEFLDPTSIVNYFTNFHEYLAF--GSKNQMTSNISLIKQGLLVNGAVVRKSNPIVSSSP 576

Query: 359 ------------------------CCFSFTIRRDRYNIPICII 377
                                   C   +T++RD +NIP+ I+
Sbjct: 577 MCGTNTDGIFDECHLLLSNGYYLKCATCWTVKRDSFNIPLLIM 619

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%)

Query: 19 VVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCCDEK 55
          +VKAC  C   H+ CD  RPC  C+KR+ G  C D++
Sbjct: 1  MVKACEFCHEKHLHCDPGRPCINCVKRNRGQLCRDKE 37

>Scas_542.8
          Length = 902

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 26/36 (72%), Gaps = 1/36 (2%)

Query: 12 STKKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDI 47
          S+K+R K + AC+LCR+ H+ C    PC+RCIK D+
Sbjct: 19 SSKRRPKSL-ACILCRKRHIKCSGGNPCARCIKHDL 53

>KLLA0D00484g 44879..47893 no similarity, hypothetical start
          Length = 1004

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 27/39 (69%), Gaps = 3/39 (7%)

Query: 12 STKKRKKVV--KACVLCRRSHMICDDRRP-CSRCIKRDI 47
          STKKRK     K C+ C+++H  CD+R+P CSRC KR I
Sbjct: 58 STKKRKSTYSRKGCLQCKKAHTKCDERKPKCSRCEKRSI 96

>YOR162C (YRR1) [4961] chr15 complement(639560..641992)
           Transcription factor involved in drug-induced
           transcriptional regulation, including activation of
           multidrug transporter gene SNQ2, has a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain [2433 bp, 810 aa]
          Length = 810

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 11  ASTKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDIGHFCCDEKLQPGAERLQSQSP 68
            S KKR K++K+C  CRR  + CD ++P CS CI R++      E+     E+  +  P
Sbjct: 42  TSGKKRNKLIKSCGFCRRRKLRCDQQKPMCSTCISRNLTTCQYAEEFNKNIEKKATYGP 100

>KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces
          cerevisiae YLR256w HAP1 transcription factor singleton,
          hypothetical start
          Length = 1253

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 1/39 (2%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDIGHFC 51
          +KR +V  +C +CR+  + CD  RP C +C+K  +GH C
Sbjct: 16 RKRNRVPLSCTICRKRKVKCDKGRPQCQQCVKTGVGHLC 54

>CAGL0B03421g complement(336071..340138) similar to sp|P12351
          Saccharomyces cerevisiae YLR256w HAP1 transcription
          factor, hypothetical start
          Length = 1355

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 1  MSTENVQTDYASTKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDIGHFC 51
          MST       A  KKR ++  +C +CR+  + CD  RP C++C K  + H C
Sbjct: 1  MSTTTTIPGAAPKKKRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLC 52

>KLLA0A02585g complement(226562..227674) some similarities with
          ca|CA5890|CaFCR1 Candida albicans Zinc cluster
          transcription factor, hypothetical start
          Length = 370

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%)

Query: 16 RKKVVKACVLCRRSHMICDDRRPCSRCIKRD 46
          +++V KAC  CR+S   CD  RPCSRC+K +
Sbjct: 15 KRRVSKACDACRKSKTKCDGERPCSRCLKEN 45

>KLLA0F09559g complement(876719..878695) some similarities with
           sgd|S0005698 Saccharomyces cerevisiae YOR172w,
           hypothetical start
          Length = 658

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 2   STENVQTDYASTKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDI 47
           S +N  T     +KR+KV+K+C  CR+  + CD +RP C+ C  R +
Sbjct: 69  SDKNASTSNGKVRKRRKVIKSCTFCRKRKLKCDRKRPMCTGCKMRGL 115

>Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement
          Length = 718

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 6  VQTDYASTKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDI 47
          V +  +  +KR+KV+K+C+ CR+  + CD ++P CS C  R++
Sbjct: 2  VDSQASVIRKRRKVIKSCLFCRKRKLKCDHKKPKCSTCAARNL 44

>CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces
           cerevisiae YLR256w HAP1 transcription factor,
           hypothetical start
          Length = 1372

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 16  RKKVVKACVLCRRSHMICDDRRP-CSRCIKRDIGHFC 51
           R +V  +C +CRR  + CD  RP C++C+K  + H C
Sbjct: 64  RNRVPLSCTICRRRKVKCDKSRPNCTQCVKTGVAHLC 100

>AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH]
          (646832..650290) [3459 bp, 1152 aa]
          Length = 1152

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 11 ASTKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDIGHFC 51
          +S +KR +V  +C +CR+  + CD  RP C++C K  + H C
Sbjct: 7  SSKRKRNRVPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLC 48

>Scas_709.51
          Length = 759

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 24/34 (70%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDI 47
          K+R +V +AC +C+R  + CD  +PC  CIK++I
Sbjct: 25 KQRIRVQRACNICKRRKVKCDGNKPCLNCIKKEI 58

>KLLA0F10835g 997512..999782 no similarity, hypothetical start
          Length = 756

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 27/40 (67%), Gaps = 3/40 (7%)

Query: 12 STKKRKKVV--KACVLCRRSHMICDDRRP-CSRCIKRDIG 48
          S KKRK     K C+ C+RSH+ CD+ +P C +C+KR+I 
Sbjct: 11 SGKKRKTRYSRKGCLQCKRSHLKCDEGQPKCGKCVKRNIS 50

>Sklu_2384.6 YKL015W, Contig c2384 10929-13424
          Length = 831

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIG 48
          K++K+   ACV CRR H+ C    PCS+CI  +I 
Sbjct: 39 KRQKRSSMACVRCRRRHVKCPGGNPCSKCIAANIA 73

>Scas_573.4
          Length = 1478

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 2  STENVQTDYASTK---KRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDIGHFC 51
          S+ +   +  STK   KR +V  +C +CR+  + CD  RP C +C K  + H C
Sbjct: 19 SSSHANANGTSTKVKRKRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTGVAHLC 72

>YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription factor
          with heme-dependent DNA-binding activity, responsible
          for heme-dependent activation of many genes [4509 bp,
          1502 aa]
          Length = 1502

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDIGHFC 51
          +KR ++  +C +CR+  + CD  RP C +C K  + H C
Sbjct: 55 RKRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLC 93

>KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces
          cerevisiae YKL015w PUT3 positive activator of the
          proline utilisation pathway, start by similarity
          Length = 865

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCCDEKLQPGAERLQSQSPLR 70
          KK K+   AC  CRR H+ C    PCS+C+K  +   C  E ++P  + + S S L+
Sbjct: 37 KKVKRSSLACTRCRRRHIKCPGGNPCSKCLKAGVA--C--EYVEPNKKLIVSMSYLQ 89

>AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH]
          (260414..263032) [2619 bp, 872 aa]
          Length = 872

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 7  QTDYASTKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDI 47
          ++D    K R+KV K+CV CR+  + C+  RP CS CI + +
Sbjct: 3  ESDGKIVKTRRKVSKSCVFCRKRRVKCNKARPKCSTCIGKGL 44

>ACL195C [854] [Homologous to NOHBY] (19204..19533) [330 bp, 109
          aa]
          Length = 109

 Score = 35.8 bits (81), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 27/41 (65%), Gaps = 4/41 (9%)

Query: 12 STKKRKKVVKACVLCRRSHMICDDR----RPCSRCIKRDIG 48
          ST K KK +++CV CR++ + CD      +PCS C+K+ +G
Sbjct: 20 STWKMKKPLRSCVRCRKNKIKCDSATRRPKPCSSCLKKGVG 60

>Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement
          Length = 687

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%)

Query: 13 TKKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDI 47
          +K+R +V KAC +C++  + CD  +PC+ C K  +
Sbjct: 18 SKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSV 52

>YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [1824 bp, 607 aa]
          Length = 607

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 24/43 (55%)

Query: 9  DYASTKKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFC 51
          D +   +++ +  AC +CR+  + CD  +PC RCI+ +    C
Sbjct: 2  DRSKDARKRSISLACTVCRKRKLKCDGNKPCGRCIRLNTPKEC 44

>CAGL0L04400g complement(511762..514725) similar to tr|Q12340
          Saccharomyces cerevisiae YOR172w, hypothetical start
          Length = 987

 Score = 37.7 bits (86), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 1/35 (2%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDI 47
          KKR K +K+C  CR+  + CD ++P CS C +R++
Sbjct: 28 KKRFKPLKSCAFCRKRKLKCDKQKPRCSSCARRNL 62

>Scas_663.12
          Length = 944

 Score = 37.0 bits (84), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 3  TENVQTDYASTKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDI 47
          ++++     + KKR ++   C  CRRS + CD  +P CSRC K D+
Sbjct: 20 SKSINDSQVTKKKRYRLSFVCQGCRRSKVKCDQEKPVCSRCSKHDL 65

>YLR266C (PDR8) [3660] chr12 complement(675621..677726)
          Zn[2]-Cys[6] zinc finger transcription factor, likely
          involved in pleiotropic drug response [2106 bp, 701 aa]
          Length = 701

 Score = 36.6 bits (83), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 15 KRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDI 47
          KR+KV+K+C  CR+  + C   RP C +C+ R +
Sbjct: 23 KRRKVIKSCAFCRKRKLKCSQARPMCQQCVIRKL 56

>Kwal_23.6425
          Length = 735

 Score = 36.6 bits (83), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 12 STKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDI 47
           ++KR+K +K C+ CR+  + CD  RP C  C  R +
Sbjct: 25 GSRKRRKSIKQCLFCRKRKLKCDKNRPVCGTCASRGL 61

>Scas_659.10
          Length = 757

 Score = 36.6 bits (83), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 25/81 (30%)

Query: 2  STENVQTDYASTKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDIGHFCCDEKLQPGA 60
          ST+N+       K+R+K +K+C  CR   + CD  +P C++C+ R   H  C        
Sbjct: 5  STQNI-----GFKRRRKPIKSCAFCRGRKLKCDKNKPICNQCLMRK--HPTC-------- 49

Query: 61 ERLQSQSPLRTETFDVQPVPE 81
                  + TETF++ P+P+
Sbjct: 50 --------IYTETFNI-PIPQ 61

>ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp,
          601 aa]
          Length = 601

 Score = 36.2 bits (82), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 3/45 (6%)

Query: 6  VQTDYASTKKRKKVV--KACVLCRRSHMICDDRRP-CSRCIKRDI 47
          +Q      KKRK     K C+ C++SH  CD+ +P C +C+KR++
Sbjct: 2  LQNTGVVMKKRKSPYSRKGCLQCKKSHTKCDETKPACLKCVKRNV 46

>CAGL0L03377g complement(382932..386561) some similarities with
          sp|P46954 Saccharomyces cerevisiae YJL089w SIP4
          interacts with SNF1 protein kinase, hypothetical start
          Length = 1209

 Score = 36.2 bits (82), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 13 TKKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCC 52
          T+ +K+  +AC  CR   + CD  +PCS C K  IG+ C 
Sbjct: 19 TRTKKRHSQACDRCRSKKIKCDGLQPCSNCAK--IGYNCV 56

>YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger
          transcription factor, in conjunction with Pdr1p
          regulates the expression of a network of genes involved
          in multiple drug resistance [2931 bp, 976 aa]
          Length = 976

 Score = 35.8 bits (81), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 18/31 (58%)

Query: 16 RKKVVKACVLCRRSHMICDDRRPCSRCIKRD 46
          R KV  ACV CR+  + C  + PC+ CI  D
Sbjct: 8  RSKVSTACVNCRKRKIKCTGKYPCTNCISYD 38

>AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH]
          complement(1320487..1322892) [2406 bp, 801 aa]
          Length = 801

 Score = 35.8 bits (81), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 15 KRKKVVKACVLCRRSHMICDDRRPCSRC 42
          KR++V +AC  CR+  + CD R PC  C
Sbjct: 10 KRRRVTRACDECRKKKVKCDSRHPCIHC 37

>AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH]
           (975879..978518) [2640 bp, 879 aa]
          Length = 879

 Score = 35.4 bits (80), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 21/36 (58%)

Query: 13  TKKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIG 48
           T  RK+V KAC +CR   + C+   PC  C K ++G
Sbjct: 71  TVMRKRVSKACDICRAKKIRCNGEEPCVNCEKFNLG 106

>Scas_702.7
          Length = 1113

 Score = 35.4 bits (80), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 16/27 (59%)

Query: 16 RKKVVKACVLCRRSHMICDDRRPCSRC 42
          RKKV KAC  CRR  + C    PCS C
Sbjct: 30 RKKVSKACANCRRRKIKCTGTYPCSNC 56

>CAGL0G08844g complement(846590..849133) similar to sp|P40467
          Saccharomyces cerevisiae YIL130w, hypothetical start
          Length = 847

 Score = 35.4 bits (80), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 5  NVQTDYASTKKRKKVVKACVLCRRSHMICDDRRPCSRC 42
          N+   +    KR+KV +AC  CR+  + CD  +PC  C
Sbjct: 2  NLTVPHRQEGKRRKVTRACDDCRKKKVKCDGNQPCIHC 39

>CAGL0M12298g complement(1225753..1228737) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 994

 Score = 35.4 bits (80), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 11 ASTKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDIGHFCCDEKLQPGAERLQSQ 66
          A T+KR ++   C  CRRS   CD  +P C+RC K  +   C  +  +  A R+ S+
Sbjct: 15 ARTRKRNRISFVCQACRRSKTRCDKEKPICTRCKKLKLE--CVYDMAKQSAPRIPSK 69

>KLLA0F04609g complement(451579..454329) similar to sp|P40467
          Saccharomyces cerevisiae YIL130w, start by similarity
          Length = 916

 Score = 35.4 bits (80), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 15 KRKKVVKACVLCRRSHMICDDRRPCSRC 42
          KR++V +AC  CR+  + CD ++PC  C
Sbjct: 6  KRRRVTRACDECRKKKVKCDGKQPCIHC 33

>Sklu_2376.6 , Contig c2376 12573-15341 reverse complement
          Length = 922

 Score = 35.0 bits (79), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 7  QTDYASTKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDIGHFCCDEKLQPG 59
          ++++   KKR++    C  C++  + CD +RP CS C   ++  +C  + +QP 
Sbjct: 12 ESEHFPKKKRQRTTVVCTNCKKRKIKCDRKRPACSNCSVANVAEYC--QYVQPN 63

>YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [2361 bp, 786 aa]
          Length = 786

 Score = 35.0 bits (79), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRP-CSRCIKR 45
          +KR+K +K+C  CR+  + CD ++P CS C  R
Sbjct: 22 QKRRKPIKSCAFCRKRKLRCDQQKPMCSTCKTR 54

>CAGL0M05907g 622029..624704 similar to sp|P36023 Saccharomyces
          cerevisiae YKR064w, hypothetical start
          Length = 891

 Score = 35.0 bits (79), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 13 TKKRKKVVKACVLCRRSHMICDDRRPCSRCIKR 45
          TK R++ +  CV CR+    CD + PCS+CI+ 
Sbjct: 8  TKSRRRPMLVCVNCRKRKSKCDRQLPCSKCIQH 40

>Scas_662.8
          Length = 906

 Score = 35.0 bits (79), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 15 KRKKVVKACVLCRRSHMICDDRRPCSRC 42
          KR++V +AC  CR+  + CD ++PC  C
Sbjct: 29 KRRRVTRACDECRKKKVKCDGQQPCIHC 56

>YKR064W (YKR064W) [3315] chr11 (562189..564780) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [2592 bp, 863 aa]
          Length = 863

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 4/65 (6%)

Query: 13 TKKRKKVVKACVLCRRSHMICDDRRPCSRCIKR---DIGHFCCDEKLQP-GAERLQSQSP 68
          TKKR ++   C  C++    CD  +PC  C++    D   +  D   QP  +  L    P
Sbjct: 9  TKKRHRITVVCTNCKKRKSKCDRTKPCGTCVRLGDVDSCVYLTDSSGQPESSPSLNDADP 68

Query: 69 LRTET 73
          LR ++
Sbjct: 69 LRKQS 73

>Scas_556.6
          Length = 1022

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDIG 48
          KKR ++   C  CR++   CD  +P C+RC+K+++ 
Sbjct: 37 KKRNRISFVCQECRKAKTKCDKEKPACTRCVKQNLA 72

>Scas_657.3
          Length = 856

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 2/45 (4%)

Query: 20 VKACVLCRRSHMICDDRRP-CSRCIKRDIGH-FCCDEKLQPGAER 62
          + +C  CR+  + CD +RP CS CI R +      D+ L P   R
Sbjct: 42 ITSCAFCRQRKLKCDQKRPICSTCIGRKLTTCVYADDNLSPNDSR 86

>Kwal_23.4754
          Length = 812

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 15 KRKKVVKACVLCRRSHMICDDRRPCSRC 42
          KR++V +AC  CR+  + CD ++PC  C
Sbjct: 7  KRRRVTRACDECRKKKVKCDGQQPCIHC 34

>YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region, putative transcription
          factor [2895 bp, 964 aa]
          Length = 964

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 15 KRKKVVKACVLCRRSHMICDDRRPCSRC 42
          KR++V +AC  CR+  + CD ++PC  C
Sbjct: 13 KRRRVTRACDECRKKKVKCDGQQPCIHC 40

>KLLA0F02750g complement(250368..253814) some similarities with
          sgd|S0005449 Saccharomyces cerevisiae YOL089c HAL9
          transcriptional activator of ENA1, hypothetical start
          Length = 1148

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 4/36 (11%)

Query: 16 RKKVVKACVLCRRSHMICDDRRP----CSRCIKRDI 47
          +K+V KAC  CRR  + CDD  P    CS CIK  +
Sbjct: 27 KKRVSKACDRCRRRKIKCDDLDPVSGKCSNCIKYKV 62

>Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement
          Length = 823

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 15 KRKKVVKACVLCRRSHMICDDRRPCSRC 42
          KR++V +AC  CR+  + CD ++PC  C
Sbjct: 7  KRRRVTRACDECRKKKVKCDGQQPCIHC 34

>KLLA0F25630g 2378464..2381487 some similarities with sp|P32862
           Saccharomyces cerevisiae YKL038w RGT1 regulator of
           glucose-induced genes, hypothetical start
          Length = 1007

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 6/60 (10%)

Query: 3   TENVQTDYASTKKRKKVVKACVLCRRSHMICD-----DRRPCSRCIK-RDIGHFCCDEKL 56
           + NV T    +++R KV +AC  CR+  + CD     D  P   C   R IG  C  E++
Sbjct: 97  SSNVSTATTESRRRSKVSRACDQCRKKKIKCDFIEGHDINPDQSCTGCRKIGEKCSFERI 156

>Sklu_2434.10 YAL051W, Contig c2434 22765-25716
          Length = 983

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 11 ASTKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDI 47
          + + KR ++   C  CR+S   CD  +P C+RCIK  I
Sbjct: 16 SHSSKRNRISFVCKACRKSKTKCDREKPSCTRCIKNGI 53

>CAGL0J07150g complement(686734..689802) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 1022

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 13 TKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDI 47
          +KKR ++   C  CR++   CD  +P CSRC+K  I
Sbjct: 13 SKKRNRLSFVCQGCRKAKTKCDKEKPACSRCLKHGI 48

>KLLA0A03421g 308414..311056 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 880

 Score = 33.9 bits (76), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRP-CSRC 42
          KKR K+   C LCR+S   CD ++P C+RC
Sbjct: 12 KKRYKLSFVCQLCRKSKTKCDRKKPSCARC 41

>CAGL0F09229g complement(908186..910693) weakly similar to
          sp|P39961 Saccharomyces cerevisiae YER184c,
          hypothetical start
          Length = 835

 Score = 33.9 bits (76), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 11 ASTKKRKKVVKACVLCRRSHMICDDRRPCSRCI 43
          A    + +V++AC +CR+  + CD  +PCS C+
Sbjct: 9  AKLAGKDRVIRACDVCRKRKVKCDGDQPCSSCM 41

>YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [1641 bp, 546 aa]
          Length = 546

 Score = 33.5 bits (75), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 2/37 (5%)

Query: 15 KRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFC 51
          KR++V KACV CR     C+ + PC  C+    G+ C
Sbjct: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVA--YGYVC 46

>KLLA0F19602g complement(1814949..1816760) similar to sp|P43634
          Saccharomyces cerevisiae YLR098c CHA4 transcription
          factor, start by similarity
          Length = 603

 Score = 33.5 bits (75), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDI 47
          K+++K   AC  CR     CD  RPCS C+K  I
Sbjct: 8  KRKRKAHLACQNCRIKRRKCDMERPCSNCLKYGI 41

>YOR363C (PIP2) [5140] chr15 complement(1020218..1023208)
          Transcription factor required for induction of
          peroxisomal proteins in response to oleic acid [2991
          bp, 996 aa]
          Length = 996

 Score = 33.9 bits (76), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDIGHFCCDEKLQPGAER 62
          KKR ++   C  CR++   CD  +P C RC K+++  FC  +  +  A R
Sbjct: 16 KKRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNL--FCIYDVARQAAPR 63

>YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding protein,
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region [2850 bp, 949 aa]
          Length = 949

 Score = 33.5 bits (75), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%)

Query: 14  KKRKKVVKACVLCRRSHMICDDRRPCSRCIKR 45
           K R +V KAC LC++  + CD   PC  C K 
Sbjct: 78  KGRLRVQKACELCKKRKVKCDGNNPCLNCSKH 109

>CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces
          cerevisiae YOR172w, hypothetical start
          Length = 865

 Score = 33.5 bits (75), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 20 VKACVLCRRSHMICDDRRP-CSRCIKR 45
          ++ C  CRR  + CD+ RP CS C+ R
Sbjct: 37 IRTCAFCRRRKLKCDNARPMCSTCVSR 63

>Sklu_2335.6 YBL005W, Contig c2335 10191-13013
          Length = 940

 Score = 33.5 bits (75), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 13 TKKRKKVVKACVLCRRSHMICDDRRPCSRC 42
          TK   KV +AC  CRR  + C  ++PCS C
Sbjct: 18 TKSSSKVSRACDNCRRRKIKCTGKQPCSNC 47

>KLLA0C14212g complement(1229219..1232341) some similarities with
          sp|P25611 Saccharomyces cerevisiae YCR106w,
          hypothetical start
          Length = 1040

 Score = 33.5 bits (75), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 15 KRKKVVKACVLCRRSHMICDDRRPCSRCI 43
          KR +V   C  CRR    CD   PCS+C+
Sbjct: 67 KRNRVSYVCYACRRRKTRCDRGNPCSKCV 95

>Scas_669.8
          Length = 637

 Score = 33.1 bits (74), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 23/37 (62%)

Query: 15 KRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFC 51
          +R+K   AC +C++  + CD   PC+ CI++ + + C
Sbjct: 8  ERRKTPYACNVCKKRKVKCDKLIPCTSCIQKGLENEC 44

>ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1429118..1432030) [2913 bp, 970 aa]
          Length = 970

 Score = 33.1 bits (74), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query: 1  MSTENVQTDYASTKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDI 47
          +S E+    Y S  KR ++   C  CR+S   CD  +P CSRC K ++
Sbjct: 12 LSEESPDRKYVS--KRNRISFVCQACRKSKTKCDREKPRCSRCAKNNV 57

>YER184C (YER184C) [1612] chr5 complement(556291..558675) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2385 bp, 794 aa]
          Length = 794

 Score = 33.1 bits (74), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 19/30 (63%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRPCSRCI 43
          K++ +V KAC  C R  + C+ ++PC  CI
Sbjct: 9  KQKSRVTKACDRCHRKKIKCNSKKPCFGCI 38

>Scas_625.5
          Length = 1141

 Score = 33.1 bits (74), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 5/55 (9%)

Query: 5   NVQTDYASTKKRKKVVKACVLCRRSHMICD---DRRPCSRCIKRDIGHFCCDEKL 56
           N  ++ +S KKR K  +AC  CR+  + CD   ++  CS C +   G  C  E++
Sbjct: 57  NAASNSSSQKKRTKASRACDQCRKKKIKCDFSEEKTLCSNCQRN--GEKCTFERV 109

>Kwal_23.3514
          Length = 579

 Score = 32.7 bits (73), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 23 CVLCRRSHMICDDRRPCSRCIKRDIGHFC 51
          CV+C +  + CD   PCS C+KR     C
Sbjct: 12 CVVCTKRKVKCDRNIPCSNCVKRGQQELC 40

>YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation
          regulatory protein, has a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1407 bp, 468 aa]
          Length = 468

 Score = 32.7 bits (73), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 6/60 (10%)

Query: 19 VVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCCDEKLQPGAERLQSQSPLRTETFDVQP 78
          V  AC  CR   + CD ++PCSRCI+ +   F C  + QP  +R     P+ T +    P
Sbjct: 4  VKYACDYCRVRRVKCDGKKPCSRCIEHN---FDCTYQ-QPLKKR--GSKPIGTRSLKYIP 57

>YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finger
          transcription factor, in conjunction with Pdr3p
          regulates the expression of a network of genes involved
          in multiple drug resistance [3207 bp, 1068 aa]
          Length = 1068

 Score = 32.7 bits (73), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 3/64 (4%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCCDEKLQPGAERLQSQSPLRTET 73
          K R KV KAC  CR+  + C+ + PC+ C   +I    C    + G  R+++      E 
Sbjct: 37 KPRSKVSKACDNCRKRKIKCNGKFPCASC---EIYSCECTFSTRQGGARIKNLHKTSLEG 93

Query: 74 FDVQ 77
            VQ
Sbjct: 94 TTVQ 97

>Scas_234.1
          Length = 337

 Score = 32.3 bits (72), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 2/46 (4%)

Query: 8  TDYAS--TKKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFC 51
          T+Y S  +KKR +    C  C++    CD  RPCS C +   G  C
Sbjct: 16 TEYNSQNSKKRNRPTVVCTNCKKRKSKCDRGRPCSTCARLGDGDRC 61

>AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 696
          aa]
          Length = 696

 Score = 32.7 bits (73), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 6/49 (12%)

Query: 5  NVQTDYASTKKRKK-----VVKACVLCRRSHMICDDRRP-CSRCIKRDI 47
          N   D   T K KK       K C  C++SH+ CD  +P C+ C K++I
Sbjct: 38 NSSADMLETLKSKKPKVQYSRKGCSQCKKSHIKCDKVQPLCTTCAKKNI 86

>Kwal_47.17506
          Length = 924

 Score = 32.7 bits (73), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRPCSRC 42
          KKR KV +AC  CRR  + C   +PC  C
Sbjct: 10 KKRSKVSRACNNCRRRKIKCTGAQPCLNC 38

>ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1435705..1438128) [2424 bp, 807 aa]
          Length = 807

 Score = 32.3 bits (72), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 4  ENVQTDYASTK-KRKKVVKACVLCRRSHMICDDRRP-CSRCIK 44
          E V      TK +R K+   C  CRRS   CD  +P C+RC+K
Sbjct: 19 EGVSGKVTKTKGRRNKLSFVCQSCRRSKTKCDKVKPSCTRCVK 61

>CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces
          cerevisiae YGL013c PDR1 transcription factor,
          hypothetical start
          Length = 1107

 Score = 32.3 bits (72), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 13 TKKRKKVVKACVLCRRSHMICDDRRPCSRC 42
          + +R KV KAC  CRR  + C+  +PC  C
Sbjct: 21 STRRTKVGKACDSCRRRKIKCNGLKPCPSC 50

>ACL096W [953] [Homologous to ScYKL015W (PUT3) - SH]
           complement(169508..172015) [2508 bp, 835 aa]
          Length = 835

 Score = 32.0 bits (71), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 17  KKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCCDEKLQPGAERLQSQSPLR 70
           K+   AC+ CRR H+ C    PC++C    + +  C E L+P  + + S   L+
Sbjct: 55  KRAPLACLRCRRRHVRCPGGTPCAKCA---VANIAC-EYLEPSKKLIVSMKYLQ 104

>YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription factor
          that activates the proline utilization pathway genes,
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region [2940 bp, 979 aa]
          Length = 979

 Score = 32.0 bits (71), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 20/33 (60%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRPCSRCIKRD 46
          K++++   AC+ CR+ H+ C    PC +C+  +
Sbjct: 25 KRQQRSSVACLSCRKRHIKCPGGNPCQKCVTSN 57

>Kwal_34.15751
          Length = 628

 Score = 32.0 bits (71), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 15 KRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDI 47
          K+ ++   C  CR   + C+ ++P CSRC+K D+
Sbjct: 7  KKNRISHVCDACRIRKLKCNKQKPSCSRCVKHDL 40

>KLLA0D10153g 858016..859983 weakly similar to sp|P35995
          Saccharomyces cerevisiae YKL222c, hypothetical start
          Length = 655

 Score = 32.0 bits (71), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDIGHFC 51
          K R K  ++C++C+R    CD + P CS C+K+  G+ C
Sbjct: 3  KSRNKPTRSCLMCQRRKKKCDRKAPSCSACLKK--GYEC 39

>Scas_518.5
          Length = 919

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 8/63 (12%)

Query: 5   NVQTDYASTKK-RKKVVKACVLCRRSHMICDD----RRPCSRCIKRDIGHFCCDEKLQPG 59
           NV   Y   K+ +K+V+KAC  CR+  + C D       C+ C K D+    C  K    
Sbjct: 100 NVTDQYGEGKESKKRVLKACDYCRKRKVKCGDIIAQTGKCANCTKNDVE---CTFKFHLQ 156

Query: 60  AER 62
            ER
Sbjct: 157 LER 159

>Kwal_26.6805
          Length = 944

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 8  TDYASTKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDI 47
          T  A + +R ++   C  CR+    CD  +P CSRC+K  I
Sbjct: 14 TQSAHSGRRNRLSFVCQSCRKGKTKCDRAKPSCSRCLKHGI 54

>CAGL0F07909g 776659..779808 some similarities with tr|Q12180
          Saccharomyces cerevisiae YOL089c HAL9 or sp|P38114
          Saccharomyces cerevisiae YBR150c TBS1, hypothetical
          start
          Length = 1049

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 10/68 (14%)

Query: 1  MSTENVQTDYASTKKRKKVVKACVLCRRSHMICDDRRP----CSRCIKRDIG-HFCCDEK 55
          M+ E +Q  Y     +++  KAC  CR+  + CD+  P    CS C+K  +   F   E+
Sbjct: 24 MAMELLQQHY-----KRRSTKACDHCRKRKIRCDEVNPVTNKCSNCVKFKVECTFKFHEE 78

Query: 56 LQPGAERL 63
          LQ   +R+
Sbjct: 79 LQTKKKRM 86

>KLLA0D12650g complement(1073580..1075535) weakly similar to
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 651

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 8/44 (18%)

Query: 11 ASTKKRKKVVKACVLCRRSHMICDDRRP-CS-------RCIKRD 46
          A+T   K+  + C+ CR  H  CD+++P CS       RC+ RD
Sbjct: 20 ATTLVEKRSSRGCLTCRDRHKKCDEKKPLCSGCKENFLRCVWRD 63

>Kwal_14.915
          Length = 822

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 8/63 (12%)

Query: 12 STKKRKKVVK----ACVLCRRSHMICDDRRPCSRCIKRDIGHFCCDEKLQPGAERLQSQS 67
           +K  K+ +K    ACV CRR H  C    PC+ C   +I   C  E L+P  + + S  
Sbjct: 34 GSKGVKRSIKRSGLACVRCRRRHAKCSGDNPCTTCRAANIA--C--EYLEPNKKLVVSMK 89

Query: 68 PLR 70
           L+
Sbjct: 90 YLQ 92

>YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor
          required for induction of SPS19 and POX1 on
          oleate-containing medium, plays a role in peroxisome
          proliferation [3189 bp, 1062 aa]
          Length = 1062

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 4/45 (8%)

Query: 4  ENVQTDYASTKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDI 47
          EN +T     +KR +++  C  C +S   CD  +P C RC+K  +
Sbjct: 50 ENSETH---NRKRNRILFVCQACWKSKTKCDREKPECGRCVKHGL 91

>KLLA0D11286g complement(964642..966678) no similarity,
          hypothetical start
          Length = 678

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 16 RKKVVKACVLCRRSHMICDDRRP-CSRCIKRDI--GHFCCDEKLQPGAER-LQSQSPLRT 71
          RK+  K+C+ C      CD ++P C+RC K+ +   +F  +  L    ER LQ QS LR+
Sbjct: 19 RKRTPKSCIRCYSIKRKCDHKKPSCTRCFKKSLPCEYFTEEHVL----ERCLQRQSNLRS 74

>CAGL0G09757g 930351..934622 some similarities with sp|Q05854
          Saccharomyces cerevisiae YLR278c, hypothetical start
          Length = 1423

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDI 47
          K +K   ++C+LCRR    CD + P C+ C+K  +
Sbjct: 32 KDKKGRSRSCLLCRRRKQRCDHKLPSCTACLKAAV 66

>Scas_637.7
          Length = 998

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 4/36 (11%)

Query: 13  TKKRKKVVKACVLCRRSHMICDDRRP----CSRCIK 44
           T  +K+V KAC  CR+  + CD   P    CS C+K
Sbjct: 96  TSGKKRVSKACDHCRKRKIKCDKVDPSTGKCSNCLK 131

>Kwal_55.21884
          Length = 882

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 6/38 (15%)

Query: 15 KRKKVVKACVLCRRSHMICDDR----RPCSRCIKRDIG 48
          +RKK+  ACV CR+    CD       PC+RC K+++ 
Sbjct: 25 RRKKL--ACVECRQQKSKCDAHEKAPEPCTRCAKKNVA 60

>Sklu_2064.2 , Contig c2064 873-3641
          Length = 922

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 2/34 (5%)

Query: 11 ASTKKRKKVVKACVLCRRSHMICDDRRPCSRCIK 44
             +KR ++   C+ CRR  + CD +RPC  CI+
Sbjct: 13 GKVQKRNRLSFVCLECRRRKIKCDKQRPC--CIQ 44

>YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway
          regulatory protein, contains a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1422 bp, 473 aa]
          Length = 473

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 21 KACVLCRRSHMICDDRRPCSRCIKR--DIGHFCCDEKLQPGAERLQS 65
          +AC  CR   + CD +RPCS C++   D  +     K  P + RL+S
Sbjct: 11 QACDCCRIRRVKCDGKRPCSSCLQNSLDCTYLQPSRKRGPKSIRLRS 57

>KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces
          cerevisiae YNR063w singleton, hypothetical start
          Length = 591

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 17/26 (65%)

Query: 22 ACVLCRRSHMICDDRRPCSRCIKRDI 47
          AC+ C++    CD ++PC RC K ++
Sbjct: 2  ACLECKKRKQKCDGQKPCRRCTKLNV 27

>Scas_721.94
          Length = 869

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 6/58 (10%)

Query: 12 STKKRK---KVVKACVLCRRSHMICDDRRP-CSRCIKRDIGHFCCDEKLQPGAERLQS 65
          ST KRK   K  + C  C+R  + CD+ +P C RC+  ++   C    +QP   ++ +
Sbjct: 41 STGKRKFHNKSKQGCTHCKRRRVKCDELKPACRRCLNWNVP--CVYPVVQPKKRKVST 96

>KLLA0D10593g complement(900326..903103) similar to sp|P08638
          Saccharomyces cerevisiae YLR451w LEU3 transcription
          factor, hypothetical start
          Length = 925

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 6/37 (16%)

Query: 15 KRKKVVKACVLCRRSHMICDDRR----PCSRCIKRDI 47
          ++KK+  ACV CR+    CD       PCSRC+K+ +
Sbjct: 43 QKKKL--ACVECRQQKSKCDAHERAPEPCSRCLKKGV 77

>CAGL0L09691g complement(1039799..1042273) some similarities with
          sp|P25502 Saccharomyces cerevisiae YKL015w PUT3
          positive activator of the proline utilisation pathway,
          hypothetical start
          Length = 824

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 9/22 (40%), Positives = 15/22 (68%)

Query: 22 ACVLCRRSHMICDDRRPCSRCI 43
          AC+ CR+ H+ C    PC++C+
Sbjct: 27 ACLRCRQKHIKCPGGNPCAKCV 48

>KLLA0C03201g complement(286973..288925) similar to sp|P39529
          Saccharomyces cerevisiae YJL206c, start by similarity
          Length = 650

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 16 RKKVVKACVLCRRSHMICDDRRPCSRCI 43
          R KV  AC  C+   + CD + PC+ CI
Sbjct: 29 RHKVKHACSSCKERKVRCDGQSPCASCI 56

>CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces
          cerevisiae YKL038w RGT1, hypothetical start
          Length = 1287

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 10 YASTKKRKKVVKACVLCRRSHMICD---DRRPCSRC 42
          + + KKR  V +AC  CRR  + CD   +R  C+ C
Sbjct: 3  HNNDKKRTNVSRACDQCRRKKIKCDRNQERNICTSC 38

>KLLA0A09119g complement(797533..800781) weakly similar to
          sp|P12383 Saccharomyces cerevisiae YGL013c PDR1
          transcription factor, start by similarity
          Length = 1082

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 17/32 (53%)

Query: 11 ASTKKRKKVVKACVLCRRSHMICDDRRPCSRC 42
           + K R+KV +AC  CR+  + C    PC  C
Sbjct: 43 GTGKPRRKVSRACDSCRKKKIKCSGTLPCKSC 74

>Kwal_47.17565
          Length = 628

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 11/37 (29%), Positives = 17/37 (45%)

Query: 15 KRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFC 51
          KR + +K C  C    + C+ + PC  C +  I   C
Sbjct: 5  KRHRSIKTCKYCYEHKLKCNKQSPCDNCTRLGITSHC 41

>KLLA0C04620g complement(422705..426514) weakly similar to
          sp|Q05854 Saccharomyces cerevisiae YLR278c, start by
          similarity
          Length = 1269

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDI 47
          K +K   +AC+LC+R    CD + P C+ C+K  +
Sbjct: 32 KDKKGRSRACLLCQRRKQKCDHKIPSCTACLKAGV 66

>YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protein
          with similarity to transcription factors, contains an
          N-terminal Zn[2]-Cys[6] fungal-type binuclear cluster
          domain [4026 bp, 1341 aa]
          Length = 1341

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDI 47
          + +K   ++C+LCRR    CD + P C+ C+K  I
Sbjct: 32 QDKKGRSRSCLLCRRRKQRCDHKLPSCTACLKAGI 66

>KLLA0A03443g 311628..314555 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 975

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 15 KRKKVVKACVLCRRSHMICDDRRP-CSRCIK 44
          KR+++   C  CR++   CD  +P C RC+K
Sbjct: 27 KRQRISFVCQACRKNKTKCDREKPRCGRCVK 57

>Scas_638.14
          Length = 1043

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRPCSRC 42
          K   KV KAC  CR+  + C  ++PC+ C
Sbjct: 39 KPTNKVSKACDNCRKRKIKCTGKQPCATC 67

>Sklu_2321.3 YLR014C, Contig c2321 8747-11467
          Length = 906

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 9/49 (18%)

Query: 3  TENVQTDYASTKKR--------KKVVKACVLCRRSHMICDDRRP-CSRC 42
          + N+ T Y+  KKR         + + AC  CR   + CD + P CS+C
Sbjct: 15 SSNIDTSYSKQKKRPSSSILGISRSIAACKRCRLKKVKCDQKFPSCSKC 63

>Scas_630.14
          Length = 701

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDI 47
          +KR +V K+C +CR     CD  +P CS C+   I
Sbjct: 17 RKRNRVPKSCTVCRLRKSKCDRIKPYCSSCVLHGI 51

>CAGL0F07865g complement(768270..770804) similar to tr|Q12151
          Saccharomyces cerevisiae YDR213w UPC2, start by
          similarity
          Length = 844

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 6/56 (10%)

Query: 11 ASTKKRK---KVVKACVLCRRSHMICDDRRP-CSRCIKRDIGHFCCDEKLQPGAER 62
           ST KRK   K    C  C+R  + CD+ +P C +C+K  +   C    +QP   R
Sbjct: 39 TSTGKRKFHNKSKNGCDHCKRRRVKCDEGKPMCDKCVKMKLE--CVYTPVQPPKRR 92

>YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein
           involved in salt tolerance, has similarity to
           transcription factors, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [3093 bp, 1030 aa]
          Length = 1030

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 4/33 (12%)

Query: 16  RKKVVKACVLCRRSHMICDD----RRPCSRCIK 44
           +K+V KAC  CR+  + CD+     + CS CIK
Sbjct: 129 KKRVSKACDHCRKRKIRCDEVDQQTKKCSNCIK 161

>KLLA0A06039g 557368..559341 weakly similar to sp|P36023
          Saccharomyces cerevisiae YKR064w singleton, start by
          similarity
          Length = 657

 Score = 30.0 bits (66), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 3/41 (7%)

Query: 13 TKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDIGHFCC 52
           KKR +    C+ CRR    CD  +P CS C+K  +G  C 
Sbjct: 11 VKKRHRPTLVCLNCRRRKTKCDRGKPSCSNCLK--LGETCV 49

>Scas_590.2
          Length = 1172

 Score = 30.0 bits (66), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRP-CSRCIK 44
          + +K    AC+LCRR    CD + P C+ C+K
Sbjct: 32 RDKKGRSTACLLCRRRKQKCDHQLPSCTACLK 63

>KLLA0D10197g complement(861726..864296) similar to sp|P05085
          Saccharomyces cerevisiae YML099c ARG81 transcription
          factor involved in arginine metabolism singleton, start
          by similarity
          Length = 856

 Score = 30.0 bits (66), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 4/40 (10%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDIGHFCC 52
          K R K    C  CR   + CD RRP C RC K   G   C
Sbjct: 5  KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEK---GGLIC 41

>CAGL0K11902g complement(1148381..1150876) similar to sp|P40971
           Saccharomyces cerevisiae YDR034c LYS14 transcriptional
           activator of lysine pathway genes, hypothetical start
          Length = 831

 Score = 29.6 bits (65), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 11  ASTKKRKKVVKACVLCRRSHMICDDRRP-CSRCIK 44
            +T KRK     C  C+R  M CD+ +P C +C +
Sbjct: 192 GNTVKRKYSRNGCAECKRRRMKCDESKPKCWQCTR 226

>KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1
          Kluyveromyces lactis Sip4 protein, start by similarity
          Length = 717

 Score = 29.6 bits (65), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 11 ASTKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDIGHFC 51
           ++ K K+  +AC  CR   + CD  +P CS C  + IG+ C
Sbjct: 51 TASTKVKRFSQACDRCRLKKIKCDGIKPSCSNC--KKIGYHC 90

>YDR034C (LYS14) [885] chr4 complement(509732..512104)
           Transcriptional activator of lysine pathway genes with
           2-aminoadipate semialdehyde as coinducer [2373 bp, 790
           aa]
          Length = 790

 Score = 29.6 bits (65), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%)

Query: 3   TENVQTDYASTKKRKKVVKACVLCRRSHMICDDRRP-CSRCIK 44
           T  V     +T KRK     C  C+R  M CD+ +P C +C +
Sbjct: 139 TSTVTDKKGNTVKRKYSRNGCSECKRRRMKCDETKPTCWQCAR 181

>Scas_449.1
          Length = 636

 Score = 29.6 bits (65), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 2/30 (6%)

Query: 15 KRKKVVKACVLCRRSHMICDDRRPCSRCIK 44
          KRK++  AC  CRR    CD   PC+ CI+
Sbjct: 31 KRKRL--ACSNCRRRRKKCDLNFPCANCIR 58

>Scas_688.17
          Length = 769

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 5/63 (7%)

Query: 13 TKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDIGHFCCDEKLQPGAERL---QSQSP 68
          T+K KK   AC+ CR+  + CD   P C  CIK         ++    +E L   +  SP
Sbjct: 8  TRKPKKN-PACIQCRKRKIGCDRGHPKCGNCIKLKRAQCIYPDEFHTASELLREMEKASP 66

Query: 69 LRT 71
          L+T
Sbjct: 67 LQT 69

>KLLA0F02387g complement(213669..215852) similar to sp|P47988
          Saccharomyces cerevisiae YOR337w TEA1 TY1 enhancer
          activator, start by similarity
          Length = 727

 Score = 29.6 bits (65), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 14/27 (51%)

Query: 22 ACVLCRRSHMICDDRRPCSRCIKRDIG 48
          AC  CRR    CD   PC RC +  +G
Sbjct: 40 ACANCRRRRKKCDLEYPCGRCQELGLG 66

>Scas_526.3
          Length = 1109

 Score = 29.6 bits (65), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRP-CSRCIK 44
          + +K   ++C+LCRR    CD + P C+ C+K
Sbjct: 32 QDKKGRSRSCLLCRRRKQRCDHKMPSCTACLK 63

>ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1432323..1434950) [2628 bp, 875 aa]
          Length = 875

 Score = 29.3 bits (64), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 3/37 (8%)

Query: 16 RKKVVKACVLCRRSHMICDDRRP-CSRCIKRDIGHFC 51
          ++K+   C+ CR+    CD  +P CSRC   ++G +C
Sbjct: 17 KRKLSYVCIPCRKCKTKCDKLKPTCSRC--AELGLYC 51

>Kwal_23.6537
          Length = 552

 Score = 29.3 bits (64), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 16/28 (57%)

Query: 15 KRKKVVKACVLCRRSHMICDDRRPCSRC 42
          KR +V KAC+ CR+    CD   PC  C
Sbjct: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMC 39

>ABR174W [767] [Homologous to ScYLR451W (LEU3) - SH]
          complement(728569..731163) [2595 bp, 864 aa]
          Length = 864

 Score = 29.3 bits (64), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 6/42 (14%)

Query: 10 YASTKKRKKVVKACVLCRRSHMICD--DR--RPCSRCIKRDI 47
          Y   + RKK   ACV CR+    C+  DR   PCSRC K ++
Sbjct: 33 YMRRQNRKKF--ACVECRQQKSKCNAHDRAPEPCSRCAKNNV 72

>KLLA0F22880g 2123577..2127071 some similarities with
          ca|CA3639|IPF9251 Candida albicans unknown function,
          hypothetical start
          Length = 1164

 Score = 29.3 bits (64), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 17 KKVVKACVLCRRSHMICDDRRP-CSRCIKR 45
          KK  K+C++CRR  + CD  +P C  C+K 
Sbjct: 3  KKNGKSCLVCRRRKVRCDRAKPVCLVCVKH 32

>AFL200W [2995] [Homologous to ScYMR168C (CEP3) - SH]
          complement(60109..61899) [1791 bp, 596 aa]
          Length = 596

 Score = 29.3 bits (64), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 15/25 (60%)

Query: 21 KACVLCRRSHMICDDRRPCSRCIKR 45
          K C +C +  + CD   PC+ C+KR
Sbjct: 10 KPCAVCIKRKVKCDRLVPCTNCVKR 34

>Scas_691.32
          Length = 906

 Score = 29.3 bits (64), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 7/50 (14%)

Query: 2  STENVQTDYASTKKRKKVVKACVLCRRSHMICDDRR----PCSRCIKRDI 47
          ST+  Q D    +KRK    ACV CR+    CD       PC++C K+ +
Sbjct: 28 STDQHQQDTNHKRKRKF---ACVECRQQKSKCDAYEKAPDPCTKCQKKGV 74

>Scas_711.31
          Length = 932

 Score = 29.3 bits (64), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 4/34 (11%)

Query: 15 KRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDI 47
          KRK+   AC  CR   + CDDR P C+ C+K  I
Sbjct: 40 KRKQ---ACDRCRLKKIKCDDRTPDCTPCMKAGI 70

>CAGL0I07755g complement(745315..748476) similar to tr|Q12180
           Saccharomyces cerevisiae YOL089c HAL9, hypothetical
           start
          Length = 1053

 Score = 29.3 bits (64), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 4/38 (10%)

Query: 14  KKRKKVVKACVLCRRSHMICDDRRP----CSRCIKRDI 47
           K++++  KAC  CR+    CD+  P    CS C K  +
Sbjct: 169 KEKRRAAKACEYCRKRKTKCDEVSPYTNKCSNCSKAGV 206

>CAGL0D02904g complement(302952..305615) similar to sp|P07272
          Saccharomyces cerevisiae YLR014c PPR1 transcription
          factor regulating pyrimidine pathway, hypothetical
          start
          Length = 887

 Score = 28.9 bits (63), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 15 KRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDI 47
          K  K   AC LCRR  + CD   P C  C++ ++
Sbjct: 17 KFTKFPNACKLCRRKKVKCDQGYPSCKGCLRNNV 50

>YLR098C (CHA4) [3513] chr12 complement(337528..339474)
          Zinc-finger protein required for transcriptional
          activation of CHA1, has a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1947 bp, 648 aa]
          Length = 648

 Score = 28.9 bits (63), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 3  TENVQTDYASTKKRKKVVKACVLCRRSHMICDDRRPCSRCIK 44
          T+N Q +    +KRK    AC  CRR    C+  +PCS CIK
Sbjct: 27 TDNDQNNNNVPRKRKL---ACQNCRRRRRKCNMEKPCSNCIK 65

>AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)
          [3321 bp, 1106 aa]
          Length = 1106

 Score = 28.9 bits (63), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 14 KKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDI 47
          K +K   ++C+LC+R    CD + P C+ C+K  +
Sbjct: 32 KDKKGRSRSCLLCQRRKQRCDHKIPSCTACLKAGV 66

>AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH]
          complement(606993..609551) [2559 bp, 852 aa]
          Length = 852

 Score = 28.9 bits (63), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 5/52 (9%)

Query: 1  MSTENVQTDYASTKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRDIGHFC 51
          +S  + QT   S  KR    +AC  CR   + CD  RP C+ C K  IG+ C
Sbjct: 9  LSAHDGQTIELSNMKRSS--QACDRCRLKKIKCDGLRPSCTSCKK--IGYQC 56

>YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive
          regulator of the maltose pathway MAL genes, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [1413 bp, 470 aa]
          Length = 470

 Score = 28.9 bits (63), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 19 VVKACVLCRRSHMICDDRRPCSRCIKRDI 47
          V ++C  CR   + CD  RPC RC +R++
Sbjct: 4  VRQSCDCCRVRRVKCDRNRPCDRCRQRNL 32

>Kwal_26.6732
          Length = 676

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 16 RKKVVKACVLCRRSHMICDDRRP-CSRC 42
          +K+ V  C+ CR+    CD+R+P C+ C
Sbjct: 5  KKRSVTGCLTCRKRRKKCDERKPVCTGC 32

>YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2118 bp, 705 aa]
          Length = 705

 Score = 28.9 bits (63), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%)

Query: 2  STENVQTDYASTKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKRD 46
          +TE  Q      + R+K  K+C  CR   + CD  RP C  C  R+
Sbjct: 3  NTELSQKKKLDRQSRRKPAKSCHFCRVRKLKCDRVRPFCGSCSSRN 48

>Kwal_23.6529
          Length = 598

 Score = 28.9 bits (63), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 10/34 (29%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 13 TKKRKKVVKACVLCRRSHMICDDRRP-CSRCIKR 45
          + K ++    C+ C++S + CD+++P C +C K+
Sbjct: 4  STKNQRSRGGCINCKKSKIKCDEKKPMCGQCAKK 37

>Kwal_56.23058
          Length = 775

 Score = 28.9 bits (63), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 1/35 (2%)

Query: 11  ASTKKRKKVVKACVLCRRSHMICDDRRP-CSRCIK 44
             T KRK     C  C+R  M CD+ +P C +C +
Sbjct: 137 GKTVKRKYSRNGCTECKRRRMKCDEGKPTCWQCAR 171

>ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH]
          (170784..174641) [3858 bp, 1285 aa]
          Length = 1285

 Score = 28.9 bits (63), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 13 TKKRKKVVKACVLCRRSHMICDDRRP-CSRC 42
          T    +V +AC  CR     CD +RP CS+C
Sbjct: 68 TPTNYRVAQACDRCRSKKTRCDGKRPQCSQC 98

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,219,520
Number of extensions: 430248
Number of successful extensions: 1294
Number of sequences better than 10.0: 175
Number of HSP's gapped: 1278
Number of HSP's successfully gapped: 193
Length of query: 377
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 274
Effective length of database: 13,030,455
Effective search space: 3570344670
Effective search space used: 3570344670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)