Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR092C27425512151e-170
Sklu_1710.22792596456e-84
Kwal_55.215572712556272e-81
KLLA0E21857g2752535831e-74
YOR036W (PEP12)2882505762e-73
Scas_699.403112555295e-66
CAGL0I01012g2822594805e-59
Sklu_2407.11276821416e-10
KLLA0A10681g364731354e-09
KLLA0C13233g262871327e-09
YOL018C (TLG2)397701321e-08
AFL232W301901292e-08
Kwal_26.8414260821256e-08
Sklu_2256.2377721241e-07
CAGL0G08932g367671241e-07
Scas_607.2417731222e-07
Scas_697.44281861151e-06
Kwal_34.16287362721151e-06
CAGL0G04807g245871122e-06
YOR106W (VAM3)283751043e-05
AEL026C349711019e-05
Scas_721.10637773920.001
YLR026C (SED5)34073910.002
CAGL0D01914g33573900.002
Scas_720.3231069870.004
Kwal_26.753230383870.004
AFR210C32976860.007
Sklu_2338.530782840.010
KLLA0F17798g31776790.046
CAGL0L00561g26489730.22
AEL296W43960635.0
YHR198C32161625.2
Scas_638.10108127618.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR092C
         (269 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR092C [1139] [Homologous to ScYOR036W (PEP12) - SH] (521646..5...   472   e-170
Sklu_1710.2 YOR036W, Contig c1710 773-1612 reverse complement         253   6e-84
Kwal_55.21557                                                         246   2e-81
KLLA0E21857g 1943933..1944760 similar to sp|P32854 Saccharomyces...   229   1e-74
YOR036W (PEP12) [4848] chr15 (400347..401213) Syntaxin homolog (...   226   2e-73
Scas_699.40                                                           208   5e-66
CAGL0I01012g complement(82834..83682) similar to sp|P32854 Sacch...   189   5e-59
Sklu_2407.11 YOR106W, Contig c2407 19619-20449 reverse complement      59   6e-10
KLLA0A10681g 928563..929657 similar to sp|Q08144 Saccharomyces c...    57   4e-09
KLLA0C13233g complement(1129020..1129808) weakly similar to sp|Q...    55   7e-09
YOL018C (TLG2) [4798] chr15 complement(290881..292074) Syntaxin ...    55   1e-08
AFL232W [2963] [Homologous to ScYOR106W (VAM3) - SH] complement(...    54   2e-08
Kwal_26.8414                                                           53   6e-08
Sklu_2256.2 YOL018C, Contig c2256 2912-4045 reverse complement         52   1e-07
CAGL0G08932g 855763..856866 similar to sp|Q08144 Saccharomyces c...    52   1e-07
Scas_607.2                                                             52   2e-07
Scas_697.44                                                            49   1e-06
Kwal_34.16287                                                          49   1e-06
CAGL0G04807g complement(458085..458822) similar to sp|Q12241 Sac...    48   2e-06
YOR106W (VAM3) [4909] chr15 (519121..519972) Syntaxin homolog (t...    45   3e-05
AEL026C [2480] [Homologous to ScYOL018C (TLG2) - SH] (585366..58...    44   9e-05
Scas_721.106                                                           40   0.001
YLR026C (SED5) [3444] chr12 complement(195451..196473) Syntaxin ...    40   0.002
CAGL0D01914g 201005..202012 highly similar to sp|Q01590 Saccharo...    39   0.002
Scas_720.32                                                            38   0.004
Kwal_26.7532                                                           38   0.004
AFR210C [3402] [Homologous to ScYLR026C (SED5) - SH] (811271..81...    38   0.007
Sklu_2338.5 YLR026C, Contig c2338 7666-8589 reverse complement         37   0.010
KLLA0F17798g 1629735..1630688 similar to sp|Q01590 Saccharomyces...    35   0.046
CAGL0L00561g 63339..64133 similar to sp|P39926 Saccharomyces cer...    33   0.22 
AEL296W [2209] [Homologous to ScYGL164C - SH] complement(86307.....    29   5.0  
YHR198C (YHR198C) [2483] chr8 complement(496313..497278) Protein...    28   5.2  
Scas_638.10                                                            28   8.5  

>ACR092C [1139] [Homologous to ScYOR036W (PEP12) - SH]
           (521646..522470) [825 bp, 274 aa]
          Length = 274

 Score =  472 bits (1215), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 235/255 (92%), Positives = 235/255 (92%)

Query: 1   MSIFSEDTQEVARYSDNPQFEEWGTDIVSNLFEMNGQLGTFQHFIKGLESNYRNGKANTM 60
           MSIFSEDTQEVARYSDNPQFEEWGTDIVSNLFEMNGQLGTFQHFIKGLESNYRNGKANTM
Sbjct: 1   MSIFSEDTQEVARYSDNPQFEEWGTDIVSNLFEMNGQLGTFQHFIKGLESNYRNGKANTM 60

Query: 61  VVENISNRSMEVIHKVSLLVKTLNGLVHSINAIPKNELDRTQLTTREKLNRDIRLSVQEF 120
           VVENISNRSMEVIHKVSLLVKTLNGLVHSINAIPKNELDRTQLTTREKLNRDIRLSVQEF
Sbjct: 61  VVENISNRSMEVIHKVSLLVKTLNGLVHSINAIPKNELDRTQLTTREKLNRDIRLSVQEF 120

Query: 121 QRCQSEFAGIRKQINEQAKISLSXXXXXXXXXXXXXXXXXXXXHHIVIEREPINNEEFAY 180
           QRCQSEFAGIRKQINEQAKISLS                    HHIVIEREPINNEEFAY
Sbjct: 121 QRCQSEFAGIRKQINEQAKISLSEQQEEAAGAAALEEEAAQQQHHIVIEREPINNEEFAY 180

Query: 181 QQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNE 240
           QQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNE
Sbjct: 181 QQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNE 240

Query: 241 LSRALRYQRRSNRWC 255
           LSRALRYQRRSNRWC
Sbjct: 241 LSRALRYQRRSNRWC 255

>Sklu_1710.2 YOR036W, Contig c1710 773-1612 reverse complement
          Length = 279

 Score =  253 bits (645), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 172/259 (66%), Gaps = 4/259 (1%)

Query: 1   MSIFSEDTQEVARYSDNPQFEEWGTDIVSNLFEMNGQLGTFQHFIKGLESNYRNGKANTM 60
           MS + +  +E  R+ D+P+FE++  +I + LFEMNG L T Q F+K L++ Y  G  NT 
Sbjct: 1   MSFYRDSFEENERFVDSPEFEQFSYEISAKLFEMNGLLSTLQQFVKTLQNKYEQGSVNTK 60

Query: 61  VVENISNRSMEVIHKVSLLVKTLNGLVHSINAIPKNELDRTQLTTREKLNRDIRLSVQEF 120
            VENI+ +++   + +S L K++N LVH ++AI +  LDR+QL +REKL RD++ SVQ F
Sbjct: 61  AVENINKKAVSYTNNISALTKSINELVHKVDAIEETSLDRSQLISREKLTRDVKYSVQVF 120

Query: 121 QRCQSEFAGIRKQINEQAKISLSXXXX----XXXXXXXXXXXXXXXXHHIVIEREPINNE 176
           Q  QSEFA   K IN +AK +L                           +VIEREPINNE
Sbjct: 121 QTVQSEFAKTTKLINNKAKSALVKEEQGLDEVLREELEDQHQQQQQQKSVVIEREPINNE 180

Query: 177 EFAYQQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNH 236
           EFAYQQ LIR+RDEEI+NIERGI ELN +FQDLG+IVQQQ  LVD+IE NIY+   ST  
Sbjct: 181 EFAYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQS 240

Query: 237 ASNELSRALRYQRRSNRWC 255
           A+ EL++A++ QRRS++WC
Sbjct: 241 AARELNKAMKSQRRSSKWC 259

>Kwal_55.21557
          Length = 271

 Score =  246 bits (627), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 126/255 (49%), Positives = 164/255 (64%), Gaps = 4/255 (1%)

Query: 1   MSIFSEDTQEVARYSDNPQFEEWGTDIVSNLFEMNGQLGTFQHFIKGLESNYRNGKANTM 60
           M  F E+  E   +SDNPQFEEW   I++NLFEMNG L T Q FIK L+ N   G   + 
Sbjct: 1   MPPFDENLNEAPHFSDNPQFEEWVDKIMNNLFEMNGHLSTLQQFIKTLQKNQSQGNTRSK 60

Query: 61  VVENISNRSMEVIHKVSLLVKTLNGLVHSINAIPKNELDRTQLTTREKLNRDIRLSVQEF 120
           ++ N+  +S+  I+ ++ L+K +N LVH IN I + ELDR QL +R+KL RD++ SVQEF
Sbjct: 61  MIANLDKKSVYHINAITELLKVINSLVHKINEIEETELDRAQLISRDKLTRDVKYSVQEF 120

Query: 121 QRCQSEFAGIRKQINEQAKISLSXXXXXXXXXXXXXXXXXXXXHHIVIEREPINNEEFAY 180
           Q  Q EF    K +N QAK +L+                      I IERE INNEEFAY
Sbjct: 121 QEAQKEFTSTSKVMNAQAKQALA----EDEETREDNVINSKSQEQITIEREAINNEEFAY 176

Query: 181 QQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNE 240
           QQ LI++RDEEIA+IE GI ELN++F DLG+IVQQQ  LVD+IE+NIYT   +T   + E
Sbjct: 177 QQRLIQERDEEIAHIESGIEELNDIFHDLGTIVQQQGYLVDNIESNIYTVANNTQSGARE 236

Query: 241 LSRALRYQRRSNRWC 255
           L++A+R QR S+ WC
Sbjct: 237 LTKAMRSQRSSSIWC 251

>KLLA0E21857g 1943933..1944760 similar to sp|P32854 Saccharomyces
           cerevisiae YOR036w PEP12 syntaxin (T-SNARE), vacuolar,
           hypothetical start
          Length = 275

 Score =  229 bits (583), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 167/253 (66%), Gaps = 3/253 (1%)

Query: 4   FSEDTQEVARYSDNPQFEEWGTDIVSNLFEMNGQLGTFQHFIKGLESNYRNGKANTMVVE 63
            S+   E+ +Y D+P+FE+    I  +LFE+NG L T  HF+  LE+N  +GK+NT V++
Sbjct: 1   MSDSPNEILQYRDSPEFEDCCDAISQDLFELNGSLSTMNHFVTALETNVSHGKSNTKVID 60

Query: 64  NISNRSMEVIHKVSLLVKTLNGLVHSINAIPKNELDRTQLTTREKLNRDIRLSVQEFQRC 123
           NI+ +++E+I K + LV ++N  +H +N + ++ LD+  L TREKL RD + SVQEF++ 
Sbjct: 61  NINKKTVELIDKSTKLVSSINENIHKVNELEESALDKPHLITREKLTRDAKFSVQEFKKY 120

Query: 124 QSEFAGIRKQINEQAKISLSXXXXXXXXXXX---XXXXXXXXXHHIVIEREPINNEEFAY 180
           Q  F  + K+IN+ AK++L                          +VIEREPINNEEFAY
Sbjct: 121 QQHFLEVTKRINDMAKVALEDEEQNNSLMDTVLREEEDEHAKRTQVVIEREPINNEEFAY 180

Query: 181 QQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNE 240
           QQ LIR+RD+EI+NIE+GI ELN +F+DLG +VQQQ +LVD IE N+Y    +T +A+NE
Sbjct: 181 QQHLIRERDQEISNIEQGITELNGIFKDLGGLVQQQGQLVDSIEANLYNVEDNTRNAANE 240

Query: 241 LSRALRYQRRSNR 253
           LSRA+R  R S++
Sbjct: 241 LSRAMRSGRSSSK 253

>YOR036W (PEP12) [4848] chr15 (400347..401213) Syntaxin homolog
           (t-SNARE) involved in Golgi to vacuole transport [867
           bp, 288 aa]
          Length = 288

 Score =  226 bits (576), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 118/250 (47%), Positives = 160/250 (64%), Gaps = 7/250 (2%)

Query: 12  ARYSDNPQFEEWGTDIVSNLFEMNGQLGTFQHFIKGLESNYRNGKANTMVVENISNRSME 71
           +R+SD+P+F+    ++ + LFE+NGQ+ T Q F   L+S    G  +  VVE I+ RS+ 
Sbjct: 18  SRFSDSPEFQTLKEEVAAELFEINGQISTLQQFTATLKSFIDRGDVSAKVVERINKRSVA 77

Query: 72  VIHKVSLLVKTLNGLVHSINAIPKNELDRTQLTTREKLNRDIRLSVQEFQRCQSEFAGIR 131
            I ++  L+K +N  V  ++AI +  LD+TQ+  REKL RD+  S QEFQ  Q +F  + 
Sbjct: 78  KIEEIGGLIKKVNTSVKKMDAIEEASLDKTQIIAREKLVRDVSYSFQEFQGIQRQFTQVM 137

Query: 132 KQINEQAKISLSXXXXXXXXX-------XXXXXXXXXXXHHIVIEREPINNEEFAYQQEL 184
           KQ+NE+AK SL                              IVIER+PINNEEFAYQQ L
Sbjct: 138 KQVNERAKESLEASEMANDAALLDEEQRQNSSKSTRIPGSQIVIERDPINNEEFAYQQNL 197

Query: 185 IRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNELSRA 244
           I +RD+EI+NIERGI ELNEVF+DLGS+VQQQ  LVD+IE NIYT   +T  AS+EL +A
Sbjct: 198 IEQRDQEISNIERGITELNEVFKDLGSVVQQQGVLVDNIEANIYTTSDNTQLASDELRKA 257

Query: 245 LRYQRRSNRW 254
           +RYQ+R++RW
Sbjct: 258 MRYQKRTSRW 267

>Scas_699.40
          Length = 311

 Score =  208 bits (529), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 110/255 (43%), Positives = 155/255 (60%), Gaps = 13/255 (5%)

Query: 14  YSDNPQFEEWGTDIVSNLFEMNGQLGTFQHFIKGLESNYRNGKANTMVVENISNRSMEVI 73
           + D+P+F+     I + LFE+NGQ+GT Q F   L+++ + G+  T VVEN+  R+   I
Sbjct: 37  FKDSPEFQSLKESIQAQLFEINGQIGTLQQFTSSLQNSLQTGQIRTKVVENVIKRASTNI 96

Query: 74  HKVSLLVKTLNGLVHSINAIPKNELDRTQLTTREKLNRDIRLSVQEFQRCQSEFAGIRKQ 133
           H V+ L+K  N +V  I+++  NELD+ Q+  REKL RD+R S+ EFQ  Q E+  + K 
Sbjct: 97  HNVNSLMKQCNDVVQRIDSLDPNELDKVQIIQREKLVRDVRYSINEFQETQKEYTQLVKS 156

Query: 134 INEQAKISL-------------SXXXXXXXXXXXXXXXXXXXXHHIVIEREPINNEEFAY 180
           IN++ K +L             S                     H+ I REPINNEEFAY
Sbjct: 157 INDKNKSALLQDQSVKNYTDDDSNKAALSQEQDRQEQLQQQQQQHVEIIREPINNEEFAY 216

Query: 181 QQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNE 240
           QQ LI++RD EI NIE+GI ELNE+F+DLG++VQQQ  +VD+IE N+Y+   +T  AS E
Sbjct: 217 QQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKE 276

Query: 241 LSRALRYQRRSNRWC 255
           L+RA R Q+ S +WC
Sbjct: 277 LNRARRSQKVSTKWC 291

>CAGL0I01012g complement(82834..83682) similar to sp|P32854
           Saccharomyces cerevisiae YOR036w PEP12 syntaxin, start
           by similarity
          Length = 282

 Score =  189 bits (480), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 110/259 (42%), Positives = 155/259 (59%), Gaps = 9/259 (3%)

Query: 6   EDTQEVARYSDNPQFEEWGTDIVSNLFEMNGQLGTFQHFIKGLESNYRNGK--ANTMVVE 63
           E+ +    + D P+FEE    I S LFE+NG++ T + F + L     N     N  VV+
Sbjct: 5   EERESSPMFRDCPRFEELKDKISSELFEVNGRVSTLRQFTESLSRFLDNSDIDVNANVVQ 64

Query: 64  NISNRSMEVIHKVSLLVKTLNGLVHSINAIPKNELDRTQLTTREKLNRDIRLSVQEFQRC 123
           NI+ +++  I  V+ L+K +N  V  I+ I  +ELD+ Q+  R+KL RD R S+QE Q  
Sbjct: 65  NINKKALTNIEVVNELLKNVNEDVKEIDNIEDSELDKPQIIARDKLIRDSRFSIQESQTA 124

Query: 124 QSEFAGIRKQINEQAKISL-------SXXXXXXXXXXXXXXXXXXXXHHIVIEREPINNE 176
           Q +F+ I K IN +A+  L       +                     + VIEREPINNE
Sbjct: 125 QQQFSKIIKSINAEARGKLNEEQNWTALLQEDEESHQTNNDNTAQRQVNFVIEREPINNE 184

Query: 177 EFAYQQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNH 236
           EFAYQQ LI++RDEEI NIERGI ELN +F+DLG+++  Q  +VD+IE NIY+AV +T  
Sbjct: 185 EFAYQQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAG 244

Query: 237 ASNELSRALRYQRRSNRWC 255
           AS EL++A R Q+RS+R+C
Sbjct: 245 ASQELNKANRMQKRSSRYC 263

>Sklu_2407.11 YOR106W, Contig c2407 19619-20449 reverse complement
          Length = 276

 Score = 58.9 bits (141), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 51/82 (62%)

Query: 173 INNEEFAYQQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVT 232
           ++ +E  +   + ++R +EI+ I   + E+N +F  LG++VQ+Q E VD I+NNI     
Sbjct: 174 LSQDELDFHSIIQQERSQEISRIHSAVQEVNAIFHQLGTLVQEQGEQVDTIDNNISGLGN 233

Query: 233 STNHASNELSRALRYQRRSNRW 254
           +   A+++L+ A RYQR+ NR 
Sbjct: 234 NLQKANDQLANAERYQRKKNRC 255

>KLLA0A10681g 928563..929657 similar to sp|Q08144 Saccharomyces
           cerevisiae YOL018c TLG2 member of the syntaxin family of
           t-SNAREs, start by similarity
          Length = 364

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 46/73 (63%)

Query: 182 QELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNEL 241
           Q+ +++RDEEI  + +G++E++ +F+++ S++  Q  +VD I+ N+   V     A  EL
Sbjct: 232 QQFLQQRDEEITQLAKGVLEVSTIFREMQSLIIDQGTVVDRIDYNLENTVIELKQAQKEL 291

Query: 242 SRALRYQRRSNRW 254
            +A  YQ+RS + 
Sbjct: 292 DKATHYQKRSQKC 304

>KLLA0C13233g complement(1129020..1129808) weakly similar to
           sp|Q12241 Saccharomyces cerevisiae YOR106w VAM3 syntaxin
           (t-SNARE) singleton, start by similarity
          Length = 262

 Score = 55.5 bits (132), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 51/87 (58%), Gaps = 1/87 (1%)

Query: 169 EREPI-NNEEFAYQQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNI 227
           ++EP+ N +E  +   +  +R ++I+ I   + E+N +F+ LGS+VQ+Q E VD I  N+
Sbjct: 155 QQEPLLNQDELDFHTIIQHERSQDISKIHSAVQEVNAIFKQLGSLVQEQGEQVDTIGENV 214

Query: 228 YTAVTSTNHASNELSRALRYQRRSNRW 254
                +   A+ EL +A  YQR+ NR 
Sbjct: 215 TGLSNNLQKANKELHKANEYQRKKNRC 241

>YOL018C (TLG2) [4798] chr15 complement(290881..292074) Syntaxin
           homolog (t-SNARE), involved in efficient endocytosis and
           in maintenance of resident proteins in the trans-Golgi
           network [1194 bp, 397 aa]
          Length = 397

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 44/70 (62%)

Query: 185 IRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNELSRA 244
           +R+RDEEI  + RG++E++ +F+++  +V  Q  +VD I+ N+   V     A  EL++A
Sbjct: 247 LRERDEEITQLARGVLEVSTIFREMQDLVVDQGTIVDRIDYNLENTVVELKSADKELNKA 306

Query: 245 LRYQRRSNRW 254
             YQ+R+ + 
Sbjct: 307 THYQKRTQKC 316

>AFL232W [2963] [Homologous to ScYOR106W (VAM3) - SH]
           complement(5332..6237) [906 bp, 301 aa]
          Length = 301

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 54/90 (60%)

Query: 164 HHIVIEREPINNEEFAYQQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHI 223
             I+ ++E +  EE  +   +   R +EI+NI   + ++N +F+ LG++VQ+Q + VD I
Sbjct: 190 QQILRQQEHVPQEELDFHSLIQEVRSQEISNIHTQVQDVNAIFKQLGTLVQEQGKQVDTI 249

Query: 224 ENNIYTAVTSTNHASNELSRALRYQRRSNR 253
           ++NI    ++   A+  L +A RYQR+ N+
Sbjct: 250 DSNINGLTSNLQGANQHLRKAERYQRQRNK 279

>Kwal_26.8414
          Length = 260

 Score = 52.8 bits (125), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 50/82 (60%)

Query: 173 INNEEFAYQQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVT 232
           ++ +E  +   + ++R EEI+ I   + E+N +F  LG++V++Q + VD+I+NNI     
Sbjct: 158 VSQDELNFHTLVQQERSEEISRIHSAVQEVNAIFHQLGTLVREQGDDVDNIDNNISGLAG 217

Query: 233 STNHASNELSRALRYQRRSNRW 254
           +   A+ +L +A + QR+ NR 
Sbjct: 218 NLQRANEQLGKADQSQRKKNRC 239

>Sklu_2256.2 YOL018C, Contig c2256 2912-4045 reverse complement
          Length = 377

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 45/72 (62%)

Query: 183 ELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNELS 242
           + +++R+EEI  + RG++E++ +F+++ +++  Q  +VD I+ N+   V     A  EL 
Sbjct: 243 QFLQQREEEITELARGVLEVSTIFREMQNLIIDQGTVVDRIDYNLENTVIELKQAQKELD 302

Query: 243 RALRYQRRSNRW 254
           RA  YQ+R+ + 
Sbjct: 303 RATHYQKRTQKC 314

>CAGL0G08932g 855763..856866 similar to sp|Q08144 Saccharomyces
           cerevisiae YOL018c TLG2 member of the syntaxin family of
           t-SNAREs, start by similarity
          Length = 367

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 43/67 (64%)

Query: 188 RDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNELSRALRY 247
           RDEEI  + +G++E++ +F+++ S++  Q  ++D I+ N+   V     A NEL++A  Y
Sbjct: 241 RDEEITQLAQGVLEVSTIFREMQSLIIDQGTIIDRIDYNLENTVIELKSAQNELNKATTY 300

Query: 248 QRRSNRW 254
           Q+R+ + 
Sbjct: 301 QKRTQKC 307

>Scas_607.2
          Length = 417

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 45/73 (61%)

Query: 182 QELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNEL 241
           Q+ +++RDEEI  + +G++E++ +F+++  ++  Q  +VD I+ N+         A+ EL
Sbjct: 242 QQFLQQRDEEITQLAKGVLEVSTIFREMQGLIIDQGTVVDRIDYNLQNTTIQLKEANKEL 301

Query: 242 SRALRYQRRSNRW 254
            +A  YQ+R+ + 
Sbjct: 302 GQATVYQKRTQKC 314

>Scas_697.44
          Length = 281

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 48/86 (55%), Gaps = 2/86 (2%)

Query: 168 IEREPINNEEFAYQQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNI 227
           I RE    ++  +Q  + ++R ++I+ I   + E+N +F  LGS+VQ+Q E VD I+ NI
Sbjct: 176 IRRE--TGDDVDFQTIIQQERSQQISRIHTAVKEVNAIFHQLGSLVQEQGEQVDTIDGNI 233

Query: 228 YTAVTSTNHASNELSRALRYQRRSNR 253
                +   A  +L RA   QR+ NR
Sbjct: 234 SQLSGNMQKADEQLRRADENQRQRNR 259

>Kwal_34.16287
          Length = 362

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 43/72 (59%)

Query: 183 ELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNELS 242
           + +++R++EI  + RG++E++ +F+++  +V  Q  ++D I+ N+   V     A  EL 
Sbjct: 228 QYLQQREQEITQLARGVLEVSSIFREMQDLVVDQGTIIDRIDYNLENTVLELKGAQRELD 287

Query: 243 RALRYQRRSNRW 254
           RA  YQ RS + 
Sbjct: 288 RATVYQTRSQKC 299

>CAGL0G04807g complement(458085..458822) similar to sp|Q12241
           Saccharomyces cerevisiae YOR106w VAM3 syntaxin,
           hypothetical start
          Length = 245

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 51/87 (58%)

Query: 168 IEREPINNEEFAYQQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNI 227
           +E+  IN++E  +   +   R  +I+ I   + E+N +F+ LG++V++Q   VD ++ NI
Sbjct: 139 MEQGLINDDELDFHTIVQEDRSRQISRIHSSVQEVNAIFKQLGTLVREQGTQVDTVDENI 198

Query: 228 YTAVTSTNHASNELSRALRYQRRSNRW 254
                + + A+ +L+RA  +QR+ NR 
Sbjct: 199 ANFDNNMHRANEQLNRADEHQRQRNRC 225

>YOR106W (VAM3) [4909] chr15 (519121..519972) Syntaxin homolog
           (t-SNARE), required for vacuolar assembly [852 bp, 283
           aa]
          Length = 283

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 45/75 (60%)

Query: 180 YQQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASN 239
           +Q  + ++R ++I  I   + E+N +F  LGS+V++Q E V  I+ NI     +  +A+ 
Sbjct: 188 FQTIIHQERSQQIGRIHTAVQEVNAIFHQLGSLVKEQGEQVTTIDENISHLHDNMQNANK 247

Query: 240 ELSRALRYQRRSNRW 254
           +L+RA ++QR  N+ 
Sbjct: 248 QLTRADQHQRDRNKC 262

>AEL026C [2480] [Homologous to ScYOL018C (TLG2) - SH]
           (585366..586415) [1050 bp, 349 aa]
          Length = 349

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 42/71 (59%)

Query: 183 ELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNELS 242
           + +  RD EI  + +G+++++ +F+++ +++  Q  +VD I+ N+         A  EL 
Sbjct: 234 QYLEDRDAEITQLAKGVLKVSTIFREMQTLILDQGTVVDRIDYNLENTNIDLKQAQRELD 293

Query: 243 RALRYQRRSNR 253
           +A+ YQ+R+ +
Sbjct: 294 QAVGYQKRTQK 304

>Scas_721.106
          Length = 377

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 5/73 (6%)

Query: 185 IRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNELSRA 244
           +++R+  +  IE  I E+  +FQ L S+VQ+Q E++  I+ N+     +   A  EL   
Sbjct: 289 LQERNRAVETIESTIQEVGNLFQQLASMVQEQGEVIQRIDANVEDVDLNITGAQREL--- 345

Query: 245 LRYQRR--SNRWC 255
           L+Y  R  SNRW 
Sbjct: 346 LKYFDRVKSNRWL 358

>YLR026C (SED5) [3444] chr12 complement(195451..196473) Syntaxin
           homolog (t-SNARE) required in ER to Golgi transport,
           found on Golgi membrane which receives transport
           vesicles [1023 bp, 340 aa]
          Length = 340

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 5/73 (6%)

Query: 185 IRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNELSRA 244
           +++R+  +  IE  I E+  +FQ L S+VQ+Q E++  I+ N+     + + A  EL   
Sbjct: 252 LQERNRAVETIESTIQEVGNLFQQLASMVQEQGEVIQRIDANVDDIDLNISGAQREL--- 308

Query: 245 LRYQRR--SNRWC 255
           L+Y  R  SNRW 
Sbjct: 309 LKYFDRIKSNRWL 321

>CAGL0D01914g 201005..202012 highly similar to sp|Q01590
           Saccharomyces cerevisiae YLR026c SED5, start by
           similarity
          Length = 335

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 5/73 (6%)

Query: 185 IRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNELSRA 244
           +++R+  +  IE  I E+  +FQ L S+VQ+Q E++  I+ N+     +   A  EL   
Sbjct: 247 LQERNRAVETIESTIQEVGNLFQQLASMVQEQGEVIQRIDANVDEVDLNITGAQREL--- 303

Query: 245 LRYQRR--SNRWC 255
           L+Y  R  SNRW 
Sbjct: 304 LKYFDRVKSNRWL 316

>Scas_720.32
          Length = 310

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 39/69 (56%)

Query: 185 IRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNELSRA 244
           +++R +E+  +E+ + ELN++F D+  +V +Q E VD I+ N+  A           ++A
Sbjct: 212 VQQRHQELLQLEKSMAELNQLFNDMEELVIEQQENVDVIDKNVEDAQQDVEQGVGYTNKA 271

Query: 245 LRYQRRSNR 253
           +   RR+ R
Sbjct: 272 VDSARRARR 280

>Kwal_26.7532
          Length = 303

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 41/83 (49%), Gaps = 9/83 (10%)

Query: 175 NEEFAYQQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTST 234
           N   AY QE    R   +  IE  I E+  +FQ L  +VQ+Q E++  I+ N+     + 
Sbjct: 209 NASSAYLQE----RSRAVETIESTIQEVGNLFQQLAHMVQEQGEVIQRIDANVEDIDLNI 264

Query: 235 NHASNELSRALRYQRR--SNRWC 255
           + A  EL   L+Y  R  SNRW 
Sbjct: 265 SGAQREL---LKYFDRVSSNRWL 284

>AFR210C [3402] [Homologous to ScYLR026C (SED5) - SH]
           (811271..812260) [990 bp, 329 aa]
          Length = 329

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 5/76 (6%)

Query: 182 QELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNEL 241
           Q+ +++R   +  IE  I E+  +FQ L  +VQ+Q E +  I+ N+     +   A  EL
Sbjct: 238 QQYLQERGRAVETIESTIQEVGNLFQQLAHMVQEQGETIQRIDANVEDIDINIAGAQREL 297

Query: 242 SRALRYQRR--SNRWC 255
              L+Y  R  SNRW 
Sbjct: 298 ---LKYFDRISSNRWM 310

>Sklu_2338.5 YLR026C, Contig c2338 7666-8589 reverse complement
          Length = 307

 Score = 37.0 bits (84), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 5/82 (6%)

Query: 176 EEFAYQQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTN 235
           EE A     +++R+  +  IE  I E+  +FQ L  +VQ+Q E +  I+ N+     + +
Sbjct: 210 EEQAANNTYLQERNRAVETIESTIQEVGNLFQQLAHMVQEQGETIQRIDANVEDIDLNIS 269

Query: 236 HASNELSRALRYQRR--SNRWC 255
            A  EL   ++Y  R  SNRW 
Sbjct: 270 GAQREL---IKYFDRVSSNRWL 288

>KLLA0F17798g 1629735..1630688 similar to sp|Q01590 Saccharomyces
           cerevisiae YLR026c SED5 syntaxin (T-SNARE) singleton,
           start by similarity
          Length = 317

 Score = 35.0 bits (79), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 5/76 (6%)

Query: 182 QELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNEL 241
           Q  +++R   I  IE  I E+  +FQ L  +VQ+Q E +  I++N+     + + A  EL
Sbjct: 226 QRYLQERSNAIETIESTIQEVGNLFQQLAHMVQEQGETIQRIDDNVGDIEMNIHGAQREL 285

Query: 242 SRALRY--QRRSNRWC 255
              L+Y     +NRW 
Sbjct: 286 ---LKYFDNISNNRWM 298

>CAGL0L00561g 63339..64133 similar to sp|P39926 Saccharomyces
           cerevisiae YMR183c SSO2 syntaxin or sp|P32867
           Saccharomyces cerevisiae YPL232w SSO1, hypothetical
           start
          Length = 264

 Score = 32.7 bits (73), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 45/89 (50%), Gaps = 2/89 (2%)

Query: 167 VIEREPINNEEFAYQQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENN 226
           + +R  ++NE+       +  R +EI N+E+ + +L  +F+++  +V QQ E +D I+ N
Sbjct: 147 IFKRYLLSNEDAKMALNEVEHRMKEIKNLEKRMNDLAILFKEMEELVVQQEEPIDKIDTN 206

Query: 227 IYTAVTSTNHASNELSRALRY--QRRSNR 253
           +   V           +A+    Q+R N+
Sbjct: 207 VEKVVVDLESGITHTEQAIHIAEQKRKNK 235

>AEL296W [2209] [Homologous to ScYGL164C - SH]
           complement(86307..87626) [1320 bp, 439 aa]
          Length = 439

 Score = 28.9 bits (63), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 1/60 (1%)

Query: 26  DIVSNLFEMNGQLGTFQHF-IKGLESNYRNGKANTMVVENISNRSMEVIHKVSLLVKTLN 84
           D+   L E NG +       + G     +NGKA    V  +  +  E+IH++ L++  +N
Sbjct: 88  DLKDELAEFNGDMEMLSSASVAGKLPASKNGKAGVDAVSLMEAKMSELIHRIELVIPLIN 147

>YHR198C (YHR198C) [2483] chr8 complement(496313..497278) Protein of
           unknown function, has moderate similarity to
           uncharacterized S. cerevisiae Yhr199p [966 bp, 321 aa]
          Length = 321

 Score = 28.5 bits (62), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 172 PINNEEFAYQQELIRK---RDEEIAN----IERGIVELNEVFQDLGSIVQQQSELVDHIE 224
           P+ N +F + +E + K   +  ++AN    + +G+ ELN+ F   GS+ +    +++ + 
Sbjct: 204 PVRNTDFKHLKEGLVKTISKHPDVANNKDTLAKGLSELNDAFSRKGSVRKNDDLIIELLA 263

Query: 225 N 225
           N
Sbjct: 264 N 264

>Scas_638.10
          Length = 1081

 Score = 28.1 bits (61), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 21/27 (77%)

Query: 196 ERGIVELNEVFQDLGSIVQQQSELVDH 222
           + G ++L EVFQ+L S++QQ SE +D+
Sbjct: 276 QDGKMDLTEVFQNLLSLMQQSSEQLDN 302

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.131    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,147,056
Number of extensions: 274645
Number of successful extensions: 1476
Number of sequences better than 10.0: 75
Number of HSP's gapped: 1465
Number of HSP's successfully gapped: 76
Length of query: 269
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 169
Effective length of database: 13,134,309
Effective search space: 2219698221
Effective search space used: 2219698221
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)