Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR091W32832216540.0
KLLA0E21879g33332911391e-157
Kwal_55.2155935131611151e-153
YDR267C33032511011e-151
Scas_615.1134934310701e-146
CAGL0M08646g33733410571e-145
Sklu_1710.12402308481e-114
Kwal_23.53514742501942e-16
CAGL0J10340g3382421905e-16
YGL100W (SEH1)3492411801e-14
Scas_652.163452431782e-14
KLLA0E23529g8262611793e-14
AEL246C8152611741e-13
Scas_679.288151781713e-13
CAGL0I03454g3031831641e-12
AFL038C3302491641e-12
KLLA0F06754g3442491622e-12
YCR072C5152071615e-12
YBR198C (TAF5)7982711616e-12
Sklu_2431.127492631608e-12
Kwal_23.63245141781591e-11
AFL118W8322051591e-11
Sklu_2173.25151781581e-11
CAGL0J03476g5171781572e-11
Kwal_14.16113342471552e-11
Kwal_27.120537552591572e-11
Scas_631.174741891562e-11
AFR199C3342501533e-11
YGL137W (SEC27)8892051554e-11
YDL145C (COP1)12012961545e-11
Scas_673.114342441526e-11
CAGL0I03718g12011641546e-11
CAGL0C00737g8161711536e-11
CAGL0H08932g9022061537e-11
Scas_720.955151541527e-11
Scas_630.66211651511e-10
AEL269C4551731491e-10
AER263C5131541492e-10
CAGL0M05335g8062751502e-10
KLLA0C08547g5151541482e-10
AGR180W8061871492e-10
YLR222C (UTP13)8172151483e-10
KLLA0F04884g12122961474e-10
YCR084C (TUP1)7132211474e-10
Scas_721.328222621474e-10
AGL196C9352311465e-10
Scas_624.1112052961466e-10
CAGL0G09845g5002771456e-10
Scas_713.509832371449e-10
KLLA0F10263g6821561421e-09
AAR057W9223191422e-09
AGL234W6291571412e-09
YFL009W (CDC4)7792181412e-09
Scas_704.406081541412e-09
CAGL0E00561g8361561402e-09
Kwal_23.64297501571393e-09
YNL317W (PFS2)4652011384e-09
Kwal_27.115858231611385e-09
YCR057C (PWP2)9233191385e-09
CAGL0M04081g4552011375e-09
ADL082C5692381376e-09
KLLA0B01958g8901801376e-09
Scas_592.4*3182171347e-09
Kwal_56.2452612102961378e-09
Scas_721.115*3182171348e-09
Kwal_56.239209371841369e-09
YLR208W (SEC13)2972871331e-08
ADR077C12041641361e-08
CAGL0C03608g6432171341e-08
CAGL0L00781g6731541341e-08
KLLA0A04928g8612441341e-08
CAGL0A00605g6402251341e-08
KLLA0F13244g8141461342e-08
Kwal_47.174658001321342e-08
Scas_629.126711651332e-08
KLLA0E12287g3262201312e-08
KLLA0A08822g5822351332e-08
YNL006W (LST8)3032251302e-08
KLLA0D16390g9361851332e-08
CAGL0J08778g2982891302e-08
CAGL0E02805g8402411322e-08
Scas_707.227302121314e-08
Kwal_56.245962941931284e-08
Kwal_55.220674512071294e-08
Sklu_2364.45552251295e-08
Scas_720.83d9152541305e-08
KLLA0D07546g6472241288e-08
Sklu_2160.37601281288e-08
ACR199C2952951251e-07
YLR429W (CRN1)6511201271e-07
Kwal_23.57696271541271e-07
Scas_571.46011501261e-07
CAGL0K09284g9113191261e-07
Scas_603.55893071252e-07
YIL046W (MET30)6401541243e-07
Scas_702.168161721243e-07
KLLA0C16643g3021981213e-07
Kwal_27.122393161991213e-07
Scas_718.6*5462691224e-07
Scas_674.202971991204e-07
YLR129W (DIP2)9431821225e-07
ADL184W4492271215e-07
Scas_695.153272211196e-07
KLLA0F27511g6231911216e-07
ACL116W8042711207e-07
Kwal_47.175675902271208e-07
YBL008W (HIR1)8401901208e-07
Scas_558.37252281209e-07
AFL007C5512251199e-07
AGL024W7561451209e-07
Sklu_2416.54592511181e-06
CAGL0L02629g7952231191e-06
KLLA0E21263g4291761181e-06
YBR175W (SWD3)3151951171e-06
CAGL0M04279g9401851191e-06
Scas_658.14421741181e-06
AGR168W8251911191e-06
KLLA0E18986g9901571181e-06
YMR116C (ASC1)3192101162e-06
KLLA0E07073g4522021162e-06
YPL151C (PRP46)4511691152e-06
Scas_585.84601691135e-06
KLLA0C08976g9112531136e-06
Sklu_2420.24411741126e-06
Scas_721.73252201116e-06
Kwal_23.62409132541136e-06
Kwal_56.241637291201136e-06
YIR012W (SQT1)4312371127e-06
ACR137W4251751127e-06
Kwal_33.155917141761127e-06
KLLA0F11231g4342541117e-06
AGR207C3201871108e-06
Kwal_26.87764331751119e-06
ACR017W4232351101e-05
Kwal_27.103855361761111e-05
Sklu_2291.49972591111e-05
KLLA0D02530g7071221101e-05
KLLA0E24508g3271821081e-05
Kwal_26.75702181411061e-05
YGL003C (CDH1)5662461092e-05
Scas_720.457551191092e-05
CAGL0J04818g654841082e-05
CAGL0K00957g7933061082e-05
Scas_719.526282571082e-05
Kwal_26.86284222341073e-05
Scas_670.215952241073e-05
AER114W633811073e-05
Kwal_23.50357442071064e-05
CAGL0G04345g7111801064e-05
CAGL0L04950g805881065e-05
YGR200C (ELP2)7882651055e-05
Sklu_1963.23141861036e-05
KLLA0E23617g4171161046e-05
KLLA0E11297g5122351047e-05
ACR097W4672351037e-05
KLLA0B14410g7061821038e-05
KLLA0E04741g4591781029e-05
Kwal_33.154757832991021e-04
Sklu_2114.211401281021e-04
AER448W7142081021e-04
AER280C5101421011e-04
AAL009C303219992e-04
YPL183C10131051002e-04
CAGL0L03201g579238993e-04
KLLA0C07425g444216993e-04
Scas_605.18424232983e-04
Scas_442.2*795289984e-04
AFL014C557192984e-04
KLLA0D04840g303172964e-04
KLLA0F22000g793273984e-04
Scas_700.27*433209975e-04
YDR364C (CDC40)455181975e-04
Kwal_0.212303161965e-04
KLLA0F10791g545203966e-04
Kwal_56.244781296220967e-04
CAGL0M06193g316206957e-04
KLLA0E03982g37278957e-04
KLLA0B11077g567166958e-04
Kwal_14.1710574113958e-04
Kwal_56.23895367129948e-04
CAGL0H03729g30390949e-04
AER255C467188940.001
CAGL0B01529g369148940.001
Kwal_27.12586509173940.001
YPR178W (PRP4)465282940.001
Scas_465.41002114950.001
Sklu_2406.11426226940.001
YMR049C (ERB1)80788940.001
Scas_701.451276259940.001
ADR176W461128930.001
CAGL0D02090g277251910.002
YJL112W (MDV1)714155930.002
YOR212W (STE4)423231920.002
AEL250C417111920.002
YDR142C (PEX7)375140910.002
Sklu_2442.2303125900.002
CAGL0M02277g427156900.003
Scas_693.221145130910.003
AER337W445104900.003
Sklu_2317.3368129890.003
KLLA0F26653g79197900.004
Kwal_56.236851102186900.004
CAGL0L10890g457144890.004
AGL190W370131880.004
CAGL0J06512g545192880.005
CAGL0A02772g441204880.006
CAGL0J03344g543113880.006
Kwal_55.21144570153880.007
AAR102C59146880.007
KLLA0D00814g408122870.007
YKR036C (CAF4)659353880.007
Scas_693.36375147870.007
CAGL0K00275g715216880.007
YDL195W (SEC31)1273181880.008
YGL004C (RPN14)41781870.008
YPR137W (RRP9)57337870.009
Kwal_27.11126996229870.009
Sklu_2435.1357550870.009
CAGL0L02761g419236860.010
CAGL0G00704g44097860.011
YDR128W1148126860.012
CAGL0L09647g429243850.013
Scas_649.1080642850.014
Kwal_55.21450503258850.015
Scas_692.25488126850.015
Sklu_2172.6263167830.016
Scas_680.1134786840.016
Scas_652.7380114840.018
Scas_657.13411294840.018
Scas_705.257137840.019
ACL034W550113840.019
ABR101C82742840.019
Sklu_2318.1711220840.021
KLLA0F21406g705233830.024
Kwal_26.765574390830.024
CAGL0K03377g97852830.024
Kwal_27.12667721208830.026
KLLA0E11143g49399830.026
Scas_692.2945689820.027
KLLA0F05159g1231223830.027
AGR242C419180820.031
CAGL0B00748g81280820.035
YER082C (UTP7)55497820.035
Kwal_56.22345396122810.036
CAGL0C01441g100583820.036
Kwal_26.8975445105810.038
Sklu_2092.4520194810.039
Sklu_2438.4573113810.042
Sklu_2167.5303131790.054
KLLA0E24354g39294800.055
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR091W
         (322 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....   641   0.0  
KLLA0E21879g complement(1944865..1945866) similar to sgd|S000267...   443   e-157
Kwal_55.21559                                                         434   e-153
YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Prote...   428   e-151
Scas_615.11                                                           416   e-146
CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...   411   e-145
Sklu_1710.1 YDR267C, Contig c1710 17-739                              331   e-114
Kwal_23.5351                                                           79   2e-16
CAGL0J10340g complement(1008637..1009653) highly similar to sp|P...    78   5e-16
YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in com...    74   1e-14
Scas_652.16                                                            73   2e-14
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    74   3e-14
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    72   1e-13
Scas_679.28                                                            70   3e-13
CAGL0I03454g 292823..293734 similar to sp|Q04491 Saccharomyces c...    68   1e-12
AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH] (367581..36...    68   1e-12
KLLA0F06754g complement(650475..651509) similar to sp|P53011 Sac...    67   2e-12
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...    67   5e-12
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    67   6e-12
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      66   8e-12
Kwal_23.6324                                                           66   1e-11
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    66   1e-11
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            65   1e-11
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    65   2e-11
Kwal_14.1611                                                           64   2e-11
Kwal_27.12053                                                          65   2e-11
Scas_631.17                                                            65   2e-11
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    64   3e-11
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    64   4e-11
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    64   5e-11
Scas_673.11                                                            63   6e-11
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    64   6e-11
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    64   6e-11
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    64   7e-11
Scas_720.95                                                            63   7e-11
Scas_630.6                                                             63   1e-10
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    62   1e-10
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...    62   2e-10
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    62   2e-10
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    62   2e-10
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    62   2e-10
YLR222C (UTP13) [3622] chr12 complement(579320..581773) Componen...    62   3e-10
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    61   4e-10
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    61   4e-10
Scas_721.32                                                            61   4e-10
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    61   5e-10
Scas_624.11                                                            61   6e-10
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    60   6e-10
Scas_713.50                                                            60   9e-10
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    59   1e-09
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    59   2e-09
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    59   2e-09
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...    59   2e-09
Scas_704.40                                                            59   2e-09
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    59   2e-09
Kwal_23.6429                                                           58   3e-09
YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation facto...    58   4e-09
Kwal_27.11585                                                          58   5e-09
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    58   5e-09
CAGL0M04081g complement(450572..451939) highly similar to sp|P42...    57   5e-09
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...    57   6e-09
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    57   6e-09
Scas_592.4*                                                            56   7e-09
Kwal_56.24526                                                          57   8e-09
Scas_721.115*                                                          56   8e-09
Kwal_56.23920                                                          57   9e-09
YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the C...    56   1e-08
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    57   1e-08
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    56   1e-08
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...    56   1e-08
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    56   1e-08
CAGL0A00605g complement(67281..69203) similar to sp|P53197 Sacch...    56   1e-08
KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomy...    56   2e-08
Kwal_47.17465                                                          56   2e-08
Scas_629.12                                                            56   2e-08
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    55   2e-08
KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces c...    56   2e-08
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    55   2e-08
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    56   2e-08
CAGL0J08778g 866175..867071 highly similar to sp|Q04491 Saccharo...    55   2e-08
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    55   2e-08
Scas_707.22                                                            55   4e-08
Kwal_56.24596                                                          54   4e-08
Kwal_55.22067                                                          54   4e-08
Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement         54   5e-08
Scas_720.83d                                                           55   5e-08
KLLA0D07546g complement(647984..649927) some similarities with s...    54   8e-08
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         54   8e-08
ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH] (698881..6...    53   1e-07
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    54   1e-07
Kwal_23.5769                                                           54   1e-07
Scas_571.4                                                             53   1e-07
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    53   1e-07
Scas_603.5                                                             53   2e-07
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    52   3e-07
Scas_702.16                                                            52   3e-07
KLLA0C16643g complement(1457590..1458498) highly similar to sp|Q...    51   3e-07
Kwal_27.12239                                                          51   3e-07
Scas_718.6*                                                            52   4e-07
Scas_674.20                                                            51   4e-07
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    52   5e-07
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    51   5e-07
Scas_695.15                                                            50   6e-07
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...    51   6e-07
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    51   7e-07
Kwal_47.17567                                                          51   8e-07
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    51   8e-07
Scas_558.3                                                             51   9e-07
AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH] (424004..42...    50   9e-07
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...    51   9e-07
Sklu_2416.5 YNL317W, Contig c2416 8692-10071                           50   1e-06
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...    50   1e-06
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    50   1e-06
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    50   1e-06
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    50   1e-06
Scas_658.1                                                             50   1e-06
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    50   1e-06
KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomy...    50   1e-06
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    49   2e-06
KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces c...    49   2e-06
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    49   2e-06
Scas_585.8                                                             48   5e-06
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    48   6e-06
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                            48   6e-06
Scas_721.7                                                             47   6e-06
Kwal_23.6240                                                           48   6e-06
Kwal_56.24163                                                          48   6e-06
YIR012W (SQT1) [2677] chr9 (378483..379778) Protein that may be ...    48   7e-06
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    48   7e-06
Kwal_33.15591                                                          48   7e-06
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    47   7e-06
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    47   8e-06
Kwal_26.8776                                                           47   9e-06
ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH] complement(...    47   1e-05
Kwal_27.10385                                                          47   1e-05
Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement         47   1e-05
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    47   1e-05
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    46   1e-05
Kwal_26.7570                                                           45   1e-05
YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of...    47   2e-05
Scas_720.45                                                            47   2e-05
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    46   2e-05
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    46   2e-05
Scas_719.52                                                            46   2e-05
Kwal_26.8628                                                           46   3e-05
Scas_670.21                                                            46   3e-05
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    46   3e-05
Kwal_23.5035                                                           45   4e-05
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    45   4e-05
CAGL0L04950g complement(562491..564908) highly similar to sp|Q04...    45   5e-05
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    45   5e-05
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         44   6e-05
KLLA0E23617g 2095246..2096499 similar to sp|P13712 Saccharomyces...    45   6e-05
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...    45   7e-05
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    44   7e-05
KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces...    44   8e-05
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    44   9e-05
Kwal_33.15475                                                          44   1e-04
Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement          44   1e-04
AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH] complement(...    44   1e-04
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    44   1e-04
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    43   2e-04
YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protei...    43   2e-04
CAGL0L03201g complement(366795..368534) some similarities with s...    43   3e-04
KLLA0C07425g complement(647673..649007) highly similar to sp|Q12...    43   3e-04
Scas_605.18                                                            42   3e-04
Scas_442.2*                                                            42   4e-04
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    42   4e-04
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    42   4e-04
KLLA0F22000g complement(2044973..2047354) similar to sp|P42935 S...    42   4e-04
Scas_700.27*                                                           42   5e-04
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    42   5e-04
Kwal_0.212                                                             42   5e-04
KLLA0F10791g complement(991642..993279) similar to sp|P26309 Sac...    42   6e-04
Kwal_56.24478                                                          42   7e-04
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    41   7e-04
KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces c...    41   7e-04
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    41   8e-04
Kwal_14.1710                                                           41   8e-04
Kwal_56.23895                                                          41   8e-04
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    41   9e-04
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    41   0.001
CAGL0B01529g 137174..138283 highly similar to sp|P39108 Saccharo...    41   0.001
Kwal_27.12586                                                          41   0.001
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    41   0.001
Scas_465.4                                                             41   0.001
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      41   0.001
YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein w...    41   0.001
Scas_701.45                                                            41   0.001
ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH] complement(...    40   0.001
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    40   0.002
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    40   0.002
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    40   0.002
AEL250C [2256] [Homologous to ScYBR195C (MSI1) - SH] (168010..16...    40   0.002
YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal...    40   0.002
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            39   0.002
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    39   0.003
Scas_693.22                                                            40   0.003
AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH] complement(...    39   0.003
Sklu_2317.3 YDR142C, Contig c2317 5804-6910                            39   0.003
KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces...    39   0.004
Kwal_56.23685                                                          39   0.004
CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024 Saccha...    39   0.004
AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH] complement(...    39   0.004
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    39   0.005
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    39   0.006
CAGL0J03344g complement(322226..323857) highly similar to sp|P40...    39   0.006
Kwal_55.21144                                                          39   0.007
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    39   0.007
KLLA0D00814g complement(76687..77913) similar to sp|P39984 Sacch...    38   0.007
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    39   0.007
Scas_693.36                                                            38   0.007
CAGL0K00275g complement(25300..27447) similar to sp|P36037 Sacch...    39   0.007
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    39   0.008
YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein c...    38   0.008
YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component o...    38   0.009
Kwal_27.11126                                                          38   0.009
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         38   0.009
CAGL0L02761g complement(320826..322085) similar to sp|P18851 Sac...    38   0.010
CAGL0G00704g 65805..67127 similar to sp|P39706 Saccharomyces cer...    38   0.011
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    38   0.012
CAGL0L09647g 1032740..1034029 highly similar to sp|P35184 Saccha...    37   0.013
Scas_649.10                                                            37   0.014
Kwal_55.21450                                                          37   0.015
Scas_692.25                                                            37   0.015
Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement       37   0.016
Scas_680.11                                                            37   0.016
Scas_652.7                                                             37   0.018
Scas_657.13                                                            37   0.018
Scas_705.2                                                             37   0.019
ACL034W [1015] [Homologous to ScYER082C (KRE31) - SH] complement...    37   0.019
ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH] (567357..569...    37   0.019
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          37   0.021
KLLA0F21406g complement(1996260..1998377) similar to sp|P47025 S...    37   0.024
Kwal_26.7655                                                           37   0.024
CAGL0K03377g complement(306529..309465) similar to sp|Q03177 Sac...    37   0.024
Kwal_27.12667                                                          37   0.026
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    37   0.026
Scas_692.29                                                            36   0.027
KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces c...    37   0.027
AGR242C [4553] [Homologous to ScYIR012W (SQT1) - SH] (1203152..1...    36   0.031
CAGL0B00748g 65727..68165 similar to sp|P25569 Saccharomyces cer...    36   0.035
YER082C (UTP7) [1514] chr5 complement(324268..325932) Component ...    36   0.035
Kwal_56.22345                                                          36   0.036
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    36   0.036
Kwal_26.8975                                                           36   0.038
Sklu_2092.4 YMR131C, Contig c2092 3964-5526                            36   0.039
Sklu_2438.4 YER082C, Contig c2438 8089-9810 reverse complement         36   0.042
Sklu_2167.5 YGL213C, Contig c2167 8275-9186                            35   0.054
KLLA0E24354g complement(2163651..2164829) similar to sgd|S000602...    35   0.055
YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associa...    35   0.057
AER439W [2939] [Homologous to ScYGL213C (SKI8) - SH] complement(...    35   0.066
Kwal_33.14971                                                          35   0.067
YER066W (YER066W) [1497] chr5 (290240..290797) Protein containin...    34   0.067
Scas_711.11                                                            35   0.070
Kwal_14.906                                                            35   0.075
Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement          35   0.082
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    35   0.082
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...    35   0.092
CAGL0L06952g complement(780793..781836) highly similar to sp|P40...    34   0.100
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    34   0.11 
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    34   0.11 
KLLA0A08800g 770989..772308 similar to sp|P39706 Saccharomyces c...    34   0.12 
Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement       34   0.12 
Kwal_47.19083                                                          34   0.13 
Kwal_27.10785                                                          34   0.13 
YBR234C (ARC40) [413] chr2 complement(685395..686549) Component ...    34   0.13 
AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248) [...    34   0.13 
AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146) [...    34   0.13 
ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH] (1158218.....    34   0.13 
Kwal_47.17572                                                          34   0.14 
Scas_699.5                                                             34   0.14 
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    34   0.14 
Sklu_2233.2 YMR049C, Contig c2233 5630-8059 reverse complement         34   0.15 
CAGL0I07073g complement(681102..682283) similar to sp|Q02793 Sac...    34   0.15 
Kwal_33.13515                                                          34   0.15 
KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces c...    34   0.15 
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...    34   0.15 
KLLA0C09262g 805512..807188 similar to sp|P40055 Saccharomyces c...    34   0.18 
KLLA0A08866g 776960..778231 weakly similar to sp|P53196 Saccharo...    33   0.19 
YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein ...    34   0.19 
YAR003W (SWD1) [68] chr1 (155009..156289) Component of SET1 and ...    33   0.20 
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            33   0.20 
ADL054W [1687] [Homologous to ScYER124C (DSE1) - SH] complement(...    34   0.20 
Scas_670.22                                                            33   0.21 
Scas_684.7                                                             33   0.21 
KLLA0F17237g 1577197..1578768 similar to sp|Q04225 Saccharomyces...    33   0.21 
CAGL0M09845g 975007..977817 highly similar to sp|Q06078 Saccharo...    34   0.21 
YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...    34   0.21 
CAGL0G01628g complement(151262..152392) similar to sp|P53962 Sac...    33   0.22 
AAL119W [68] [Homologous to ScYFR021W (AUT10) - SH] complement(1...    33   0.23 
Scas_706.24                                                            33   0.23 
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         33   0.23 
Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement         33   0.23 
Sklu_2113.2 YCL039W, Contig c2113 2538-4865                            33   0.24 
CAGL0F07337g complement(714870..716735) similar to sp|P26309 Sac...    33   0.24 
KLLA0E21241g 1890314..1892197 similar to sgd|S0002773 Saccharomy...    33   0.25 
KLLA0D15873g 1334131..1335426 similar to sp|P35184 Saccharomyces...    33   0.25 
KLLA0C02849g 255963..257285 some similarities with sp|P53851 Sac...    33   0.27 
Sklu_2364.5 YAR003W, Contig c2364 9220-10515 reverse complement        33   0.28 
YEL056W (HAT2) [1372] chr5 (47168..48373) Histone acetyltransfer...    33   0.29 
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    33   0.29 
Kwal_0.40                                                              33   0.29 
CAGL0K07095g 698028..699143 highly similar to sp|P38328 Saccharo...    33   0.30 
Kwal_23.5962                                                           33   0.32 
ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH] complement...    33   0.33 
KLLA0F13750g complement(1274110..1275972) similar to sp|P46680 S...    33   0.34 
KLLA0C07513g complement(656060..657379) similar to sp|P39946 Sac...    33   0.38 
YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anapha...    33   0.40 
YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein req...    33   0.40 
Kwal_34.15818                                                          33   0.40 
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    32   0.41 
KLLA0F10615g 978492..979604 similar to sp|P38328 Saccharomyces c...    32   0.42 
YBR195C (MSI1) [378] chr2 complement(610571..611839) Chromatin a...    32   0.45 
CAGL0D05588g 533235..534668 highly similar to sp|P33750 Saccharo...    32   0.52 
YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translat...    32   0.59 
KLLA0D12760g complement(1090428..1091909) weakly similar to sgd|...    32   0.59 
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    32   0.62 
Kwal_55.20441                                                          32   0.62 
CAGL0H00781g complement(77292..78833) similar to tr|Q12523 Sacch...    32   0.64 
Kwal_14.884                                                            32   0.66 
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    32   0.77 
Kwal_33.15136                                                          32   0.78 
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    32   0.86 
YCR067C (SED4) [593] chr3 complement(233120..236317) Protein inv...    32   0.90 
YPL126W (NAN1) [5319] chr16 (310209..312899) Nucleolar protein a...    32   0.94 
YPR054W (SMK1) [5484] chr16 (666275..667441) Sporulation-specifi...    31   0.98 
Sklu_2133.4 YBR234C, Contig c2133 6409-7530                            31   1.00 
Scas_717.60d                                                           31   1.0  
Kwal_14.1675                                                           31   1.0  
AAR078W [264] [Homologous to ScYLR196W (PWP1) - SH] complement(4...    32   1.0  
YMR131C (RRB1) [4088] chr13 complement(533162..534697) Protein i...    32   1.0  
ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1...    31   1.1  
CAGL0K10692g 1039413..1040930 similar to sp|P43601 Saccharomyces...    31   1.1  
CAGL0M05291g complement(566250..567509) similar to sp|P13712 Sac...    31   1.1  
KLLA0E20779g complement(1841092..1842207) similar to sp|P40066 S...    31   1.1  
CAGL0J01265g complement(118375..119928) highly similar to sp|Q04...    31   1.1  
Scas_607.8                                                             31   1.1  
Sklu_1659.2 YMR092C, Contig c1659 410-2251                             31   1.1  
AFL006C [3187] [Homologous to ScYAR003W (SWD1) - SH] (425925..42...    31   1.1  
CAGL0F06853g 671942..673108 highly similar to sp|P20484 Saccharo...    31   1.1  
Kwal_47.17555                                                          31   1.2  
Scas_721.128                                                           31   1.2  
CAGL0K03861g complement(359448..360989) highly similar to sp|Q04...    31   1.2  
Sklu_675.1 YMR146C, Contig c675 761-1687                               31   1.3  
KLLA0E06435g complement(581935..584832) similar to sp|P38164 Sac...    31   1.4  
Kwal_0.356                                                             31   1.5  
ABL089W [503] [Homologous to ScYBR045C (GIP1) - SH] complement(2...    31   1.5  
AFL022W [3171] [Homologous to ScYBR234C (ARC40) - SH] complement...    31   1.5  
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    31   1.6  
Sklu_2371.4 YDR030C, Contig c2371 8070-9506 reverse complement         30   1.9  
CAGL0J07854g complement(765463..766761) similar to sp|P53851 Sac...    30   1.9  
YEL058W (PCM1) [1370] chr5 (43252..44925) Hexosephosphate mutase...    30   2.1  
KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomy...    30   2.1  
Sklu_2393.10 YIL162W, Contig c2393 16513-18165                         30   2.1  
Scas_512.3                                                             30   2.2  
Scas_469.3                                                             30   2.2  
Scas_700.47                                                            30   2.9  
Kwal_56.24332                                                          30   2.9  
AGR067W [4377] [Homologous to ScYDR128W - SH] complement(842182....    30   3.1  
KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177 Saccha...    30   3.1  
CAGL0D04884g 475678..477369 highly similar to tr|Q06506 Saccharo...    30   3.3  
Sklu_2139.2 YFR021W, Contig c2139 1540-3165 reverse complement         30   3.4  
YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear po...    29   4.0  
YGR225W (AMA1) [2174] chr7 (945146..946328,946422..946927) Prote...    30   4.1  
Kwal_56.23035                                                          29   4.3  
CAGL0A00561g complement(63710..64948) similar to sp|P53196 Sacch...    29   4.3  
Sklu_1048.1 YIR012W, Contig c1048 895-2196                             29   4.4  
AGL017W [4294] [Homologous to ScYPL009C - SH] complement(689404....    30   4.5  
Sklu_2431.8 YBR195C, Contig c2431 12732-14009 reverse complement       29   4.6  
CAGL0J08998g 882655..886500 highly similar to sp|P38968 Saccharo...    30   4.6  
Scas_719.7*                                                            30   4.6  
Scas_685.11                                                            29   4.9  
Scas_659.9                                                             29   5.5  
Scas_595.3*                                                            29   5.6  
KLLA0A01650g complement(146030..147235) similar to sp|Q02793 Sac...    29   5.7  
Scas_655.1                                                             29   5.7  
AFR634W [3826] [Homologous to ScYNL253W - SH] complement(1593772...    29   5.8  
Scas_710.33                                                            29   5.9  
AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH] (137221..13...    29   6.7  
CAGL0J01287g 120215..122047 similar to sp|P46680 Saccharomyces c...    29   7.4  
CAGL0E01485g complement(138830..142840) similar to tr|Q08281 Sac...    29   8.1  
YHR191C (CTF8) [2476] chr8 complement(486228..486629) Protein wi...    28   8.1  
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    28   9.0  
Kwal_26.7738                                                           28   9.3  
CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharo...    28   9.6  

>ACR091W [1138] [Homologous to ScYDR267C - SH]
           complement(520609..521595) [987 bp, 328 aa]
          Length = 328

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/322 (100%), Positives = 322/322 (100%)

Query: 1   MPNLHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVR 60
           MPNLHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVR
Sbjct: 1   MPNLHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVR 60

Query: 61  SVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLA 120
           SVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLA
Sbjct: 61  SVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLA 120

Query: 121 TCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQ 180
           TCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQ
Sbjct: 121 TCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQ 180

Query: 181 DDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQE 240
           DDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQE
Sbjct: 181 DDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQE 240

Query: 241 TVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQAGRWEVVARVDCAHTVYEINVV 300
           TVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQAGRWEVVARVDCAHTVYEINVV
Sbjct: 241 TVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQAGRWEVVARVDCAHTVYEINVV 300

Query: 301 KWLALDGRVLLVTGGDDGCVNV 322
           KWLALDGRVLLVTGGDDGCVNV
Sbjct: 301 KWLALDGRVLLVTGGDDGCVNV 322

>KLLA0E21879g complement(1944865..1945866) similar to sgd|S0002675
           Saccharomyces cerevisiae YDR267c, start by similarity
          Length = 333

 Score =  443 bits (1139), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 223/329 (67%), Positives = 264/329 (80%), Gaps = 9/329 (2%)

Query: 1   MPNLHLVRSLKLHGDRCWSVDISKG-LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAV 59
           M  L L++SL LH D+CWSVD++ G ++ATGS DRKIKLVD+R+F+++EELDDTAHKK V
Sbjct: 1   MAGLKLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTV 60

Query: 60  RSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGE----TELLAVIEGHENEVKSVAWSHD 115
           RSVAWRPH N+LAAGSFD+TVSIWG+DDD Y+ E    TELLA+IEGHENE+K VAWSHD
Sbjct: 61  RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHD 120

Query: 116 GAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVR 175
           G  LATCSRDKSVWIWEADE+ EEFEC SVLQEHSQDVKH++WH S  LLASSSYDDTVR
Sbjct: 121 GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVR 180

Query: 176 IWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDK 235
           IW + DDDWEC AVL+GH GTVW SDFE++ + +RLCSGSDD TVRIW CL DD   +++
Sbjct: 181 IWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW-CLEDDNGEYEQ 239

Query: 236 EWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQAGRWEVVARVDCAHTVY 295
           EWIQE++LP  HTRAVYSV+WS  G IAS GSDG L +YKE + G W V    +  H VY
Sbjct: 240 EWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDG-WIVECIHELTHGVY 298

Query: 296 EINVVKWLALDGR--VLLVTGGDDGCVNV 322
           E N+VKW+    +  +LL+T GDDG VNV
Sbjct: 299 ETNMVKWVEYGSKDVILLITAGDDGHVNV 327

>Kwal_55.21559
          Length = 351

 Score =  434 bits (1115), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 212/316 (67%), Positives = 261/316 (82%), Gaps = 7/316 (2%)

Query: 13  HGDRCWSVDISKGLLATGSADRKIKLVDVRN--FKLVEELDDTAHKKAVRSVAWRPHCNV 70
           H D+ WS+D SKGL+AT S+DRKIKLV+++N  F+LVEELDD+ HKK+VRSV++RPH ++
Sbjct: 32  HTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSI 91

Query: 71  LAAGSFDTTVSIWGRDDD----DYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDK 126
           LAAGSFD+T+SIWG+++D    D   ETELLA+IEGHENEVK+V+WSH G YLA+CSRDK
Sbjct: 92  LAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDK 151

Query: 127 SVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWEC 186
           SVWIWEADEL EE+EC SVLQEH+QDVKH+VWH+   LLASSSYDDT+R+W E  DDWEC
Sbjct: 152 SVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWEC 211

Query: 187 AAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAV 246
           AAVL+GH GTVWCSDFE++E+ +RL S SDD+TVR+W  + ++ +  D  W QE +LP V
Sbjct: 212 AAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDV-WAQEAILPNV 270

Query: 247 HTRAVYSVSWSADGLIASVGSDGVLAVYKEVQAGRWEVVARVDCAHTVYEINVVKWLALD 306
           H+RAVYSVSWS DG IASVGSDG+L VYKEV+ G WEVV +   AH +YEINVVKW  +D
Sbjct: 271 HSRAVYSVSWSLDGYIASVGSDGLLVVYKEVKKGEWEVVVQQHEAHGIYEINVVKWATVD 330

Query: 307 GRVLLVTGGDDGCVNV 322
             VLL+TGGDDGC N+
Sbjct: 331 DSVLLLTGGDDGCANI 346

>YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Protein
           containing seven WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to WD40 protein Ciao1 (human CIAO1), which
           binds and inhibits Wilms tumor suppressor protein (human
           WT1) transactivation activity [993 bp, 330 aa]
          Length = 330

 Score =  428 bits (1101), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 212/325 (65%), Positives = 262/325 (80%), Gaps = 5/325 (1%)

Query: 1   MPNLHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVR--NFKLVEELDDTAHKKA 58
           M +++L++SLKL+ ++ WS D S+G+LATGS DRKIKLV V+  +F L++ LD+TAHKKA
Sbjct: 1   MASINLIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKA 60

Query: 59  VRSVAWRPHCNVLAAGSFDTTVSIWGRDDD-DYSGETELLAVIEGHENEVKSVAWSHDGA 117
           +RSVAWRPH ++LAAGSFD+TVSIW +++  D + E +LLA+IEGHENEVK VAWS+DG 
Sbjct: 61  IRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY 120

Query: 118 YLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
           YLATCSRDKSVWIWE DE  EE+EC SVLQEHSQDVKH++WH S  LLASSSYDDTVRIW
Sbjct: 121 YLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIW 180

Query: 178 AEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEW 237
            + DDDWEC AVL+GH GTVW SDF++ E   RLCSGSDD+TVR+W+ + DD D   +EW
Sbjct: 181 KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDD-QQEW 239

Query: 238 IQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQAGRWEVVARVDCAHTVYEI 297
           + E +LP VH R VY+V+W  +GLIASVG+DGVLAVY+EV  G W+V A+    H VYEI
Sbjct: 240 VCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVD-GEWKVFAKRALCHGVYEI 298

Query: 298 NVVKWLALDGRVLLVTGGDDGCVNV 322
           NVVKWL L+G+ +L TGGDDG VN 
Sbjct: 299 NVVKWLELNGKTILATGGDDGIVNF 323

>Scas_615.11
          Length = 349

 Score =  416 bits (1070), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 215/343 (62%), Positives = 259/343 (75%), Gaps = 25/343 (7%)

Query: 4   LHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRN-----FKLVEELDDTAHKKA 58
           + L +SLKL  D+ WS+D S GLLATGS DRKIK+++V N       L++ LDDT HKKA
Sbjct: 3   IKLAKSLKLQNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKA 62

Query: 59  VRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDY-------------SGETELLAVIEGHEN 105
           +R VAWRPH N+LAAGSFD+TVSIW R+DD               S E +LLA+IEGHEN
Sbjct: 63  IRCVAWRPHSNLLAAGSFDSTVSIWTREDDLEEEEDDDEGEGTTNSLEMDLLAIIEGHEN 122

Query: 106 EVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLL 165
           EVK +AWSHDGA L++CSRDKSVWIWE D+  EE+EC SVLQEHSQDVKH+VWH    LL
Sbjct: 123 EVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLL 182

Query: 166 ASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETG--IRLCSGSDDTTVRIW 223
           ASSSYDDT+R+W + DDDWECAAVL+GH GTVWCSDFE+ + G  IRLCSGSDD+TVR+W
Sbjct: 183 ASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242

Query: 224 RCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQAG--- 280
           R + DD D   +EWI E +LP VH R +YSVSWS +GLIAS GSDG LAVYKEV  G   
Sbjct: 243 RYIDDDED-GQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNGDDE 301

Query: 281 -RWEVVARVDCAHTVYEINVVKWLALDGRVLLVTGGDDGCVNV 322
             WEV+A+ +  H VYE N+VKW+ ++G ++L TGGDDGCVN+
Sbjct: 302 HDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNL 344

>CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces
           cerevisiae YDR267c, start by similarity
          Length = 337

 Score =  411 bits (1057), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 210/334 (62%), Positives = 251/334 (75%), Gaps = 14/334 (4%)

Query: 1   MPNLHLVRSLKLHGDRCWSVDIS--KGLLATGSADRKIKLVDVRNFK--LVEELDDTAHK 56
           MP L L +SLKLH D+ WS+D    +GLLATGS DR IK++ ++N K  L++ LDDT HK
Sbjct: 1   MP-LQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHK 59

Query: 57  KAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSG----ETELLAVIEGHENEVKSVAW 112
           KAVRSVAWRPH ++LAAGSFD+T+SIW + D D       E ELLA+IEGHENEVK ++W
Sbjct: 60  KAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISW 119

Query: 113 SHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDD 172
           S DG  LATCSRDKSVWIWE DE  EE+EC SVLQEHSQDVKH+VWH    LLASSSYDD
Sbjct: 120 SQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDD 179

Query: 173 TVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADV 232
           TVRIW + DDDWECAAVL+GH GT+WCSDF + E  IRLCSGSDD+TVR+W+ + DD D 
Sbjct: 180 TVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDED- 238

Query: 233 FDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQ----AGRWEVVARV 288
             +EW+ E+ LP  H   +Y V+WS  G IASVG+DGVLAVYKE Q       WE+ A  
Sbjct: 239 DQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSEWEISATY 298

Query: 289 DCAHTVYEINVVKWLALDGRVLLVTGGDDGCVNV 322
             AHTVYEIN VKW+ +DG+ +L+T GDDG VN+
Sbjct: 299 KAAHTVYEINTVKWVNIDGKEMLITAGDDGRVNL 332

>Sklu_1710.1 YDR267C, Contig c1710 17-739
          Length = 240

 Score =  331 bits (848), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 163/230 (70%), Positives = 196/230 (85%), Gaps = 1/230 (0%)

Query: 93  ETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQD 152
           ETELLA++EGHENEVKSV+WSH G YLATCSRDKSVWIWEADE  EEFEC SVLQEHSQD
Sbjct: 8   ETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQD 67

Query: 153 VKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLC 212
           VKH+VWH+   LLASSSYDDT+RIW + DDDW+CAAVL+GH GTVWCSDFE++E+ +RLC
Sbjct: 68  VKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLC 127

Query: 213 SGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLA 272
           SGSDDTTVRIW+ + D+ D  ++ W  ++VLP+ H+RAVYSVSWS  GLIAS GSDG+LA
Sbjct: 128 SGSDDTTVRIWKYIEDNED-DEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLA 186

Query: 273 VYKEVQAGRWEVVARVDCAHTVYEINVVKWLALDGRVLLVTGGDDGCVNV 322
           +Y+E + G+WE++A+ + AH VYE NVVKW  +DG  LLVTGGDDGCVN+
Sbjct: 187 IYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNI 236

>Kwal_23.5351
          Length = 474

 Score = 79.3 bits (194), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 73/250 (29%), Positives = 113/250 (45%), Gaps = 30/250 (12%)

Query: 57  KAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEG-HENEVKSVAWSHD 115
           + V  VA  P    LAAGS++  V I       +    E++  ++G H++++  VAWS D
Sbjct: 183 RPVSQVARSPDGASLAAGSWNGDVKIL------HPQSLEVVRSLDGAHDDKIGGVAWSSD 236

Query: 116 GAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVR 175
              LAT   D  V IW     S       VL+ H   V  + +H S   +AS+S+D T R
Sbjct: 237 SQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTWR 296

Query: 176 IW-AEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFD 234
           +W  E++ + +      GH   V+C DF+    G  LCS   D+   +W   T       
Sbjct: 297 LWDVERETELQLQ---EGHAKEVYCLDFQ--CDGSLLCSAGLDSVGHVWDMRTG------ 345

Query: 235 KEWIQETVLPAVHTRAVYSVSWSADGLIASVGS-DGVLAVYKEVQAGRWEVVARVDCAHT 293
               +  ++   H + +Y VSWS +G   + GS DG + V+   +A +   +     AH 
Sbjct: 346 ----RSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSI----LAHN 397

Query: 294 --VYEINVVK 301
             V E+N  K
Sbjct: 398 SIVSEVNFEK 407

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 112/272 (41%), Gaps = 68/272 (25%)

Query: 3   NLHLVRSLK-LHGDR----CWSVDISKGLLATGSADRKIKL--VDVRNFKLVEELDDTAH 55
           +L +VRSL   H D+     WS D    LLATG AD  +K+     ++      +    H
Sbjct: 213 SLEVVRSLDGAHDDKIGGVAWSSD--SQLLATGGADNLVKIWNPQAQSHSEASRVVLRGH 270

Query: 56  KKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETEL------------------- 96
           +  V  V + P    +A+ SFD T  +W     D   ETEL                   
Sbjct: 271 EARVSKVKFHPSDRFVASASFDMTWRLW-----DVERETELQLQEGHAKEVYCLDFQCDG 325

Query: 97  ----------------------LAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIW--- 131
                                 L V+EGH   +  V+WS +G ++AT S D +V +W   
Sbjct: 326 SLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIR 385

Query: 132 EADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLS 191
           +A++ S     NS++ E + + ++  +      L SSSYD T+ ++A     W   A L 
Sbjct: 386 KANKPSSILAHNSIVSEVNFEKENGNF------LVSSSYDRTIGVFAT--GSWIKLASLQ 437

Query: 192 GHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           GH   +   D  R   G  L S   D +V+IW
Sbjct: 438 GHTDKILSVDISRG--GANLWSSGWDRSVKIW 467

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/224 (26%), Positives = 102/224 (45%), Gaps = 21/224 (9%)

Query: 9   SLKLHGDRC-WSVDISK-------GLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVR 60
           S +LHG +  +S  +S+         LA GS +  +K++  ++ ++V  LD  AH   + 
Sbjct: 171 SYELHGSQVVFSRPVSQVARSPDGASLAAGSWNGDVKILHPQSLEVVRSLD-GAHDDKIG 229

Query: 61  SVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLA 120
            VAW     +LA G  D  V IW      +S  + +  V+ GHE  V  V +     ++A
Sbjct: 230 GVAWSSDSQLLATGGADNLVKIWNPQAQSHSEASRV--VLRGHEARVSKVKFHPSDRFVA 287

Query: 121 TCSRDKSVWIWEADELSEEFECNSVLQE-HSQDVKHIVWHASRLLLASSSYDDTVRIWAE 179
           + S D +  +W+      E E    LQE H+++V  + +     LL S+  D    +W  
Sbjct: 288 SASFDMTWRLWDV-----ERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDM 342

Query: 180 QDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           +        VL GH   ++   +  +  G  + +GS D TV++W
Sbjct: 343 RTG--RSLMVLEGHAKPIYGVSW--SPNGHHVATGSGDGTVQVW 382

>CAGL0J10340g complement(1008637..1009653) highly similar to
           sp|P53011 Saccharomyces cerevisiae YGL100w SEH1 nuclear
           pore protein, start by similarity
          Length = 338

 Score = 77.8 bits (190), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 114/242 (47%), Gaps = 27/242 (11%)

Query: 102 GHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHAS 161
           GHE+ V  VA+   G  +ATCS D+ + +++ D+ +  +E N   + H   +  + W + 
Sbjct: 7   GHEDIVHDVAYDFYGRTMATCSSDQHIKVFKLDKDATRWEVNDSWRAHDSSIVSLDWASP 66

Query: 162 RL--LLASSSYDDTVRIWAEQDDDWECAA-------VLSGHGGTVWCSDFERAETGIRLC 212
               ++AS+SYD T++IW E  +  EC+         L+   G+++C  F  +  G+R+ 
Sbjct: 67  EYGRIIASASYDKTIKIWEEDPNQEECSGRRWTRLCTLNDSKGSLYCVKFAPSHLGLRIA 126

Query: 213 SGSDDTTVRIWRCLTDDADVFDKEWIQE------TVLPAVHTRAVYSVSWSADGL----I 262
           S  +D  +R++  L D +++  + W          V PA + ++ + +SW         I
Sbjct: 127 SIGNDGIMRMYDAL-DPSNL--RSWTMTAEVKVLPVAPANNLQSAFGLSWCFTRFSPEKI 183

Query: 263 ASVGSDGVLAVYKEVQAGRWEVVARVDCAHTVYEINVVKWLALDGRV--LLVTGGDDGCV 320
           A    D    +Y+  + G +    ++   HT   I  + W  L GR   L+ TG  DG V
Sbjct: 184 AVCALDQAY-IYQRGKDGHFYQAGKLP-GHTSL-IRSISWAPLIGRPYHLIATGCKDGRV 240

Query: 321 NV 322
            +
Sbjct: 241 RI 242

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 59/132 (44%), Gaps = 33/132 (25%)

Query: 53  TAHKKAVRSVAWRP----HCNVLAAGSFDTTVSIWGRDD-------------DDYSGE-- 93
             H   +RS++W P      +++A G  D  V I+  +D             DDY+ E  
Sbjct: 209 PGHTSLIRSISWAPLIGRPYHLIATGCKDGRVRIFRVNDSPSKSNTPNLSDSDDYNMEDQ 268

Query: 94  ------------TELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFE 141
                        ELL+  + H+ EV SV+W+  G  L++   D  V +W++   S E++
Sbjct: 269 GIKQRQNNTDLEVELLSEHDDHKGEVWSVSWNLTGTILSSTGEDGKVRLWKS-TYSNEYK 327

Query: 142 CNSVLQEHSQDV 153
           C S++    QD+
Sbjct: 328 CMSIITS-KQDI 338

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 70/317 (22%), Positives = 131/317 (41%), Gaps = 51/317 (16%)

Query: 19  SVDISKGLLATGSADRKIKLVDVRNFKLVEELDDT--AHKKAVRSVAW--RPHCNVLAAG 74
           + D     +AT S+D+ IK+  +       E++D+  AH  ++ S+ W    +  ++A+ 
Sbjct: 16  AYDFYGRTMATCSSDQHIKVFKLDKDATRWEVNDSWRAHDSSIVSLDWASPEYGRIIASA 75

Query: 75  SFDTTVSIWGRDDD--DYSGET-ELLAVIEGHENEVKSV--AWSHDGAYLATCSRDKSVW 129
           S+D T+ IW  D +  + SG     L  +   +  +  V  A SH G  +A+   D  + 
Sbjct: 76  SYDKTIKIWEEDPNQEECSGRRWTRLCTLNDSKGSLYCVKFAPSHLGLRIASIGNDGIMR 135

Query: 130 IWEADE--------LSEEFECNSVLQEHS-QDVKHIVWHASRL---LLASSSYDDTVRIW 177
           +++A +        ++ E +   V   ++ Q    + W  +R     +A  + D      
Sbjct: 136 MYDALDPSNLRSWTMTAEVKVLPVAPANNLQSAFGLSWCFTRFSPEKIAVCALDQAYIYQ 195

Query: 178 AEQDDDWECAAVLSGHGGTV----WCSDFERAETGIRLCSGSDDTTVRIWRCL------- 226
             +D  +  A  L GH   +    W     R    I   +G  D  VRI+R         
Sbjct: 196 RGKDGHFYQAGKLPGHTSLIRSISWAPLIGRPYHLI--ATGCKDGRVRIFRVNDSPSKSN 253

Query: 227 ------TDDADVFD---KEWIQETVLPAV-------HTRAVYSVSWSADG-LIASVGSDG 269
                 +DD ++ D   K+    T L          H   V+SVSW+  G +++S G DG
Sbjct: 254 TPNLSDSDDYNMEDQGIKQRQNNTDLEVELLSEHDDHKGEVWSVSWNLTGTILSSTGEDG 313

Query: 270 VLAVYKEVQAGRWEVVA 286
            + ++K   +  ++ ++
Sbjct: 314 KVRLWKSTYSNEYKCMS 330

>YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in
           complex with nuclear pore proteins, member of WD (WD-40)
           repeat family [1050 bp, 349 aa]
          Length = 349

 Score = 73.9 bits (180), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 115/241 (47%), Gaps = 25/241 (10%)

Query: 102 GHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHAS 161
           GH++ V  V +   G ++ATCS D+ + +++ D+ +  +E +   + H   +  I W + 
Sbjct: 7   GHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASP 66

Query: 162 RL--LLASSSYDDTVRIWAEQDDDWECAA-------VLSGHGGTVWCSDFERAETGIRLC 212
               ++AS+SYD TV++W E  D  EC+         L+   G+++   F  A  G++L 
Sbjct: 67  EYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLA 126

Query: 213 SGSDDTTVRIWRCLTDDADV----FDKEWIQETVLPAVHTRAVYSVSW-----SADGLIA 263
              +D  +R++  L + +D+       E    ++ PA H ++ + +SW     S + L  
Sbjct: 127 CLGNDGILRLYDAL-EPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPEKLAV 185

Query: 264 SVGSDGVLAVYKEVQAGRWEVVARVDCAHTVYEINVVKWLALDGR--VLLVTGGDDGCVN 321
           S     +  +Y+  + G+  V A++    ++  I  + W    GR   L+ TG  DG + 
Sbjct: 186 SALEQAI--IYQRGKDGKLHVAAKLPGHKSL--IRSISWAPSIGRWYQLIATGCKDGRIR 241

Query: 322 V 322
           +
Sbjct: 242 I 242

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 72/151 (47%), Gaps = 29/151 (19%)

Query: 6   LVRSLKLHGDRCWSVDISK--GLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVA 63
           L+RS+       W+  I +   L+ATG  D +I++     FK+ E+L   A ++++ +  
Sbjct: 214 LIRSIS------WAPSIGRWYQLIATGCKDGRIRI-----FKITEKLSPLASEESLTN-- 260

Query: 64  WRPHCNVLAAGSFDTTVSIWGRDDDDYSG--------ETELLAVIEGHENEVKSVAWSHD 115
                + +   S D  +   GR D +           + ELL+  + H  EV SV+W+  
Sbjct: 261 -----SNMFDNSADVDMDAQGRSDSNTEEKAELQSNLQVELLSEHDDHNGEVWSVSWNLT 315

Query: 116 GAYLATCSRDKSVWIWEADELSEEFECNSVL 146
           G  L++   D  V +W+A   S EF+C SV+
Sbjct: 316 GTILSSAGDDGKVRLWKA-TYSNEFKCMSVI 345

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 74/324 (22%), Positives = 133/324 (41%), Gaps = 64/324 (19%)

Query: 27  LATGSADRKIKLVDVRNFKLVEELDDT--AHKKAVRSVAW--RPHCNVLAAGSFDTTVSI 82
           +AT S+D+ IK+  +       EL D+  AH  ++ ++ W    +  ++A+ S+D TV +
Sbjct: 24  VATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGRIIASASYDKTVKL 83

Query: 83  WGRDDD--DYSGET-ELLAVIEGHENEVKSV--AWSHDGAYLATCSRDKSVWIWEADE-- 135
           W  D D  + SG     L  +   +  + SV  A +H G  LA    D  + +++A E  
Sbjct: 84  WEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLACLGNDGILRLYDALEPS 143

Query: 136 ------LSEEFECNSVLQ-EHSQDVKHIVWHASRL---LLASSSYDDTVRIWAEQDDDWE 185
                 L+ E +  S+    H Q    + W  SR     LA S+ +  +     +D    
Sbjct: 144 DLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPEKLAVSALEQAIIYQRGKDGKLH 203

Query: 186 CAAVLSGHGGTV----WCSDFERAETGIRLCSGSDDTTVRIWR------------CLTD- 228
            AA L GH   +    W     R    I   +G  D  +RI++             LT+ 
Sbjct: 204 VAAKLPGHKSLIRSISWAPSIGRWYQLI--ATGCKDGRIRIFKITEKLSPLASEESLTNS 261

Query: 229 -----------------DADVFDKEWIQETVLPAV------HTRAVYSVSWSADG-LIAS 264
                            D++  +K  +Q  +   +      H   V+SVSW+  G +++S
Sbjct: 262 NMFDNSADVDMDAQGRSDSNTEEKAELQSNLQVELLSEHDDHNGEVWSVSWNLTGTILSS 321

Query: 265 VGSDGVLAVYKEVQAGRWEVVARV 288
            G DG + ++K   +  ++ ++ +
Sbjct: 322 AGDDGKVRLWKATYSNEFKCMSVI 345

 Score = 31.6 bits (70), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 81/203 (39%), Gaps = 18/203 (8%)

Query: 1   MPNLHLVRSLKLHGDRCWS---VDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKK 57
           M  L +  +  L  D C S      S   LA  + ++ I     ++ KL        HK 
Sbjct: 154 MKVLSIPPANHLQSDFCLSWCPSRFSPEKLAVSALEQAIIYQRGKDGKLHVAAKLPGHKS 213

Query: 58  AVRSVAWRPHC----NVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
            +RS++W P       ++A G  D  + I+          TE L+ +   E+   S  + 
Sbjct: 214 LIRSISWAPSIGRWYQLIATGCKDGRIRIFKI--------TEKLSPLASEESLTNSNMFD 265

Query: 114 HDGAYLATCSRDKSVWIWEADELSEEFECNSVLQ--EHSQDVKHIVWHASRLLLASSSYD 171
           +                 E  EL    +   + +  +H+ +V  + W+ +  +L+S+  D
Sbjct: 266 NSADVDMDAQGRSDSNTEEKAELQSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDD 325

Query: 172 DTVRIW-AEQDDDWECAAVLSGH 193
             VR+W A   ++++C +V++  
Sbjct: 326 GKVRLWKATYSNEFKCMSVITAQ 348

>Scas_652.16
          Length = 345

 Score = 73.2 bits (178), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 116/243 (47%), Gaps = 29/243 (11%)

Query: 102 GHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHAS 161
           GHE+ +  V +   G ++ATCS D+ + +++ D+ + E+E +   + H   +  + W + 
Sbjct: 10  GHEDLIHDVVYDFYGRHVATCSSDQHIKVFKLDKETSEWELSDSWKAHDSSIVSVDWASP 69

Query: 162 RL--LLASSSYDDTVRIWAEQDDD-------WECAAVLSGHGGTVWCSDFERAETGIRLC 212
               ++ S+SYD TV++W E  D        W     L+   G+++   F     G++L 
Sbjct: 70  EYGRIIVSASYDKTVKLWEEDPDQPEGSGRRWTKLCTLNDSKGSLYTVKFAPPHLGLKLA 129

Query: 213 SGSDDTTVRIWRCLTDDADVFDKEWIQET------VLPAVHTRAVYSVSW-----SADGL 261
              +D T+RI+  L + +D+  + W   +      V PA H ++ + ++W     S + L
Sbjct: 130 CIGNDATLRIYEAL-EPSDL--RSWTLTSEVKVLPVPPANHLQSDFCIAWCPSRFSPEKL 186

Query: 262 IASVGSDGVLAVYKEVQAGRWEVVARVDCAHTVYEINVVKWLALDGR--VLLVTGGDDGC 319
           + S       ++Y+  + G+  +VA+++    +  I  + W    GR   L+ TG  DG 
Sbjct: 187 VVSTLDQA--SIYQRGKDGKLYIVAKLNGHKGL--IRDISWAPSIGRWYHLIATGCKDGK 242

Query: 320 VNV 322
           + +
Sbjct: 243 LRI 245

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 78/318 (24%), Positives = 130/318 (40%), Gaps = 59/318 (18%)

Query: 27  LATGSADRKIKLVDVRNFKLVEELDDT--AHKKAVRSVAW--RPHCNVLAAGSFDTTVSI 82
           +AT S+D+ IK+  +       EL D+  AH  ++ SV W    +  ++ + S+D TV +
Sbjct: 27  VATCSSDQHIKVFKLDKETSEWELSDSWKAHDSSIVSVDWASPEYGRIIVSASYDKTVKL 86

Query: 83  WGRDDDDYSGETEL---LAVIEGHENEVKSVAWS--HDGAYLATCSRDKSVWIWEADE-- 135
           W  D D   G       L  +   +  + +V ++  H G  LA    D ++ I+EA E  
Sbjct: 87  WEEDPDQPEGSGRRWTKLCTLNDSKGSLYTVKFAPPHLGLKLACIGNDATLRIYEALEPS 146

Query: 136 ------LSEEFECNSVLQ-EHSQDVKHIVWHASRL---LLASSSYDDTVRIWAEQDDDWE 185
                 L+ E +   V    H Q    I W  SR     L  S+ D        +D    
Sbjct: 147 DLRSWTLTSEVKVLPVPPANHLQSDFCIAWCPSRFSPEKLVVSTLDQASIYQRGKDGKLY 206

Query: 186 CAAVLSGHGGTVWCSDFERAETGIR----LCSGSDDTTVRIWRCLT-------------- 227
             A L+GH G +   D   A +  R    + +G  D  +RI+R +               
Sbjct: 207 IVAKLNGHKGLI--RDISWAPSIGRWYHLIATGCKDGKLRIFRLVEKLSDNSSKDAINDS 264

Query: 228 -DDADVFDKEWIQETVLPAV---------------HTRAVYSVSWSADG-LIASVGSDGV 270
            DD DV D E I E    ++               H   ++SVSW+  G +++S G DG 
Sbjct: 265 YDDEDV-DMEDIAENKEKSLLGSSVSVELLSEHDDHNAEIWSVSWNLTGTILSSAGDDGK 323

Query: 271 LAVYKEVQAGRWEVVARV 288
           + ++K   +  ++ ++ +
Sbjct: 324 VRLWKSTYSNEFKCMSVI 341

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 75/154 (48%), Gaps = 18/154 (11%)

Query: 3   NLHLVRSLKLHG----DRCWSVDISK--GLLATGSADRKIKLVDVRNFKLVEELDDTAHK 56
            L++V  L  H     D  W+  I +   L+ATG  D K+++     F+LVE+L D + K
Sbjct: 204 KLYIVAKLNGHKGLIRDISWAPSIGRWYHLIATGCKDGKLRI-----FRLVEKLSDNSSK 258

Query: 57  KAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDG 116
            A+   ++      +   + +   S+ G      S   ELL+  + H  E+ SV+W+  G
Sbjct: 259 DAIND-SYDDEDVDMEDIAENKEKSLLGS-----SVSVELLSEHDDHNAEIWSVSWNLTG 312

Query: 117 AYLATCSRDKSVWIWEADELSEEFECNSVLQEHS 150
             L++   D  V +W++   S EF+C SV+  +S
Sbjct: 313 TILSSAGDDGKVRLWKS-TYSNEFKCMSVITSNS 345

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 73.6 bits (179), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 75/261 (28%), Positives = 112/261 (42%), Gaps = 32/261 (12%)

Query: 70  VLAAGSFDTTVSIWGRDDDDYSG-------ETELLAVIEGHENEVKSVAWSHDGAYLATC 122
           + AAG  D+T+ +W  D             +    A + GH   V SVA+S D  YL + 
Sbjct: 512 LTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVAFSPDNRYLLSA 571

Query: 123 SRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDD 182
           S DK+V +W  D     F C    + H+  V ++ +        ++S+D T R+W+   D
Sbjct: 572 SEDKTVRLWSLD----TFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWS--CD 625

Query: 183 DWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETV 242
                 + SGH   V CS F     G  + +GS D T R+W   T D+            
Sbjct: 626 HIYPLRIFSGHLNDVDCSTFH--PNGCYVFTGSSDKTCRMWDIQTGDS----------VR 673

Query: 243 LPAVHTRAVYSVSWSADGLIASVGS-DGVLAVYKEVQAGRWEVVARVDCAHTVYEINVVK 301
           L   HT  V ++  S DG   + GS DG + V+ ++  G+     +    + +Y I   K
Sbjct: 674 LFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVW-DIGTGKRIKQMKGHGKNPIYSITFNK 732

Query: 302 WLALDGRVLLVTGGDDGCVNV 322
               +G   LVTGG D  V V
Sbjct: 733 ----EGNC-LVTGGADQSVRV 748

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/207 (25%), Positives = 86/207 (41%), Gaps = 23/207 (11%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
            H   V SVA+ P    L + S D TV +W  D          L   +GH + V  V +S
Sbjct: 551 GHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLD------TFTCLVCYKGHNHPVWYVKFS 604

Query: 114 HDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDT 173
             G Y  T S D++  +W  D +        +   H  DV    +H +   + + S D T
Sbjct: 605 PLGHYFITASHDQTARLWSCDHIYPL----RIFSGHLNDVDCSTFHPNGCYVFTGSSDKT 660

Query: 174 VRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVF 233
            R+W  Q  D     +  GH   V     E +  G  L +GS+D T+ +W       D+ 
Sbjct: 661 CRMWDIQTGD--SVRLFLGHTSPVTA--LEVSPDGRWLTTGSEDGTIIVW-------DIG 709

Query: 234 DKEWIQETVLPAVHTRAVYSVSWSADG 260
             + I++  +       +YS++++ +G
Sbjct: 710 TGKRIKQ--MKGHGKNPIYSITFNKEG 734

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 57/129 (44%), Gaps = 17/129 (13%)

Query: 12  LHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVL 71
            H + C+        + TGS+D+  ++ D++    V       H   V ++   P    L
Sbjct: 645 FHPNGCY--------VFTGSSDKTCRMWDIQTGDSVRLF--LGHTSPVTALEVSPDGRWL 694

Query: 72  AAGSFDTTVSIWGRDDDDYSGETELLAVIEGH-ENEVKSVAWSHDGAYLATCSRDKSVWI 130
             GS D T+ +W        G  + +  ++GH +N + S+ ++ +G  L T   D+SV +
Sbjct: 695 TTGSEDGTIIVWD------IGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRV 748

Query: 131 WEADELSEE 139
           W+    + E
Sbjct: 749 WDIKRFTNE 757

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/261 (28%), Positives = 114/261 (43%), Gaps = 32/261 (12%)

Query: 70  VLAAGSFDTTVSIWGRDDDDYSGETELLA-------VIEGHENEVKSVAWSHDGAYLATC 122
           ++AAG  D+ + +W  D      +    A        + GH   V SV++S D  YL + 
Sbjct: 501 LVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSA 560

Query: 123 SRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDD 182
           S DK+V +W  D     + C    + H+  V  + +       A+ S+D T R+W+   D
Sbjct: 561 SEDKTVRLWSLD----TYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWS--CD 614

Query: 183 DWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETV 242
                 + +GH   V C  F     G  + +GS D T R+W   T D+            
Sbjct: 615 HIYPLRIFAGHLNDVDCVTFH--PNGTYVLTGSSDKTCRMWDIQTGDS----------VR 662

Query: 243 LPAVHTRAVYSVSWSADGLIASVGS-DGVLAVYKEVQAGRWEVVARVDCAHTVYEINVVK 301
           L   HT +V SV+ S DG   + GS DGV+ V+ ++  G+     R      VY ++  K
Sbjct: 663 LFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVW-DIGTGKRIKQMRGHGKSAVYSLSFNK 721

Query: 302 WLALDGRVLLVTGGDDGCVNV 322
               +G + LV+GG D  V V
Sbjct: 722 ----EGNI-LVSGGADQSVRV 737

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 58/124 (46%), Gaps = 9/124 (7%)

Query: 17  CWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSF 76
           C +   +   + TGS+D+  ++ D++    V       H  +V SVA  P    L  GS 
Sbjct: 631 CVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLF--LGHTASVVSVAVSPDGRWLTTGSE 688

Query: 77  DTTVSIWGRDDDDYSGETELLAVIEGH-ENEVKSVAWSHDGAYLATCSRDKSVWIWEADE 135
           D  + +W        G  + +  + GH ++ V S++++ +G  L +   D+SV +W+  +
Sbjct: 689 DGVIIVWD------IGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLKK 742

Query: 136 LSEE 139
            + E
Sbjct: 743 FTNE 746

 Score = 28.9 bits (63), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 27  LATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRD 86
           L TGS D  I + D+   K ++++     K AV S+++    N+L +G  D +V +W  D
Sbjct: 683 LTTGSEDGVIIVWDIGTGKRIKQMRGHG-KSAVYSLSFNKEGNILVSGGADQSVRVW--D 739

Query: 87  DDDYSGETEL 96
              ++ E  L
Sbjct: 740 LKKFTNEPSL 749

>Scas_679.28
          Length = 815

 Score = 70.5 bits (171), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 78/178 (43%), Gaps = 14/178 (7%)

Query: 47  VEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENE 106
           V E    AH+K + ++A  P+ ++ A  S+D T  IW  ++       EL A +  H+  
Sbjct: 482 VSEYTRRAHEKDINALAISPNDSIFATASYDKTCKIWDLENG------ELTATLSNHKRG 535

Query: 107 VKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLA 166
           +  VA+      +ATCS DK++ IW  D     F     L+ H+  V+  ++   +L L 
Sbjct: 536 LWDVAFCQYDKLIATCSGDKTIKIWSLD----TFSVMKTLEGHTNAVQRCMFINKQLQLV 591

Query: 167 SSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWR 224
           SS  D  ++IW     D  C   L GH   +W         G  + S   D   + W+
Sbjct: 592 SSGADGLIKIWDCSTGD--CLKTLDGHDNRIWA--LTEINDGDMIVSADADGVFQFWK 645

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 97/227 (42%), Gaps = 27/227 (11%)

Query: 58  AVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGET--ELLAVIE----GHENEVKSVA 111
            + +V  R +   L   S D T+  W       + E   +++ V E     HE ++ ++A
Sbjct: 439 GLPNVMLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALA 498

Query: 112 WSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYD 171
            S + +  AT S DK+  IW+     E  E  + L  H + +  + +     L+A+ S D
Sbjct: 499 ISPNDSIFATASYDKTCKIWDL----ENGELTATLSNHKRGLWDVAFCQYDKLIATCSGD 554

Query: 172 DTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDA- 230
            T++IW+   D +     L GH   V    F   +  ++L S   D  ++IW C T D  
Sbjct: 555 KTIKIWSL--DTFSVMKTLEGHTNAVQRCMFINKQ--LQLVSSGADGLIKIWDCSTGDCL 610

Query: 231 DVFDKEWIQETVLPAVHTRAVYSVSWSADG-LIASVGSDGVLAVYKE 276
              D            H   +++++   DG +I S  +DGV   +K+
Sbjct: 611 KTLDG-----------HDNRIWALTEINDGDMIVSADADGVFQFWKD 646

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/244 (20%), Positives = 107/244 (43%), Gaps = 23/244 (9%)

Query: 91  SGETELLAV----IEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVL 146
           S E E L +     EGHE+ + S+  + DG ++AT S+D +  +W+ + +  +F+     
Sbjct: 369 SSEQEELPINVEMYEGHEDLLNSLDTTDDGLWMATASKDHTAIVWKYNSIINKFQPYVKF 428

Query: 147 QEHSQDV-----KHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSD 201
             HS  V      +++       L ++S D T++ W       + +  +      V  S+
Sbjct: 429 IGHSATVTAVGLPNVMLRGYPEFLLTASNDLTIKKWKIP----KPSTTVEEDCQIVKVSE 484

Query: 202 FERA--ETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSW-SA 258
           + R   E  I   + S + ++           ++D E  + T   + H R ++ V++   
Sbjct: 485 YTRRAHEKDINALAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQY 544

Query: 259 DGLIASVGSDGVLAVYKEVQAGRWEVVARVDCAHTVYEINVVKWLALDGRVLLVTGGDDG 318
           D LIA+   D  + ++       + V+  ++  HT     V + + ++ ++ LV+ G DG
Sbjct: 545 DKLIATCSGDKTIKIW---SLDTFSVMKTLE-GHTNA---VQRCMFINKQLQLVSSGADG 597

Query: 319 CVNV 322
            + +
Sbjct: 598 LIKI 601

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 63/142 (44%), Gaps = 11/142 (7%)

Query: 1   MPNLHLVRSLKLHGDRCWSVDISK--GLLATGSADRKIKLVDVRNFKLVEELDDTAHKKA 58
           + N  L  +L  H    W V   +   L+AT S D+ IK+  +  F +++ L+   H  A
Sbjct: 520 LENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDTFSVMKTLE--GHTNA 577

Query: 59  VRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAY 118
           V+   +      L +   D  + IW    D  +G+   L  ++GH+N + ++   +DG  
Sbjct: 578 VQRCMFINKQLQLVSSGADGLIKIW----DCSTGDC--LKTLDGHDNRIWALTEINDGDM 631

Query: 119 LATCSRDKSVWIWE-ADELSEE 139
           + +   D     W+   EL +E
Sbjct: 632 IVSADADGVFQFWKDCTELEKE 653

>CAGL0I03454g 292823..293734 similar to sp|Q04491 Saccharomyces
           cerevisiae YLR208w SEC13 protein transport protein,
           start by similarity
          Length = 303

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 87/183 (47%), Gaps = 26/183 (14%)

Query: 26  LLATGSADRKIKLVDVRNFKLVE-ELDDTAHKKAVRSVAWRPHCNV-------------- 70
           +L  GSAD KI +V++++ ++   ++ D AHK  V S++W P                  
Sbjct: 120 ILLCGSADGKISVVELKDGQIASTKILDNAHKFGVNSISWAPLMKTDSSDDGDETTAVKQ 179

Query: 71  LAAGSFDTTVSIWGRDDDDYSGETELLA-VIEGHENEVKSVAWSHD---GAYLATCSRDK 126
             +G  D  V IW  DDD    ET ++A  +EGH++ V +V WS      +Y+A+ S DK
Sbjct: 180 FISGGNDNLVKIWKFDDDQ---ETYVVADTLEGHKDAVTAVDWSPTTLLQSYVASVSNDK 236

Query: 127 SVWIWEADELSEEFECNSVL---QEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQ-DD 182
              +W  D  S++ +   +     +  Q +  + W  S  LLA S  D  V IW E  D 
Sbjct: 237 QCLVWTQDHSSKKNDWKKISVNEGKFEQKLGSVSWSLSGNLLAVSDDDKNVTIWKESGDG 296

Query: 183 DWE 185
            WE
Sbjct: 297 KWE 299

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 73/179 (40%), Gaps = 34/179 (18%)

Query: 96  LLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKH 155
           ++ +   HE  +   A ++ G  LATCS DK+V I+E ++++        L  H   V +
Sbjct: 1   MVKIENAHEGVIHHAALNYYGTRLATCSSDKTVKIFEINDVNNSSSLLETLVGHEGPVWY 60

Query: 156 IVWHASRL---LLASSSYDDTVRIWAEQDDDWECAAVLSGHGG-------------TVWC 199
             W    L   LLA+  YD  V IW E           SGHGG             +V C
Sbjct: 61  ADWCHPSLGENLLATCGYDGKVLIWKE-----------SGHGGKMQIIGKHAVHSASVNC 109

Query: 200 SDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSA 258
             +   E G+ L  GS D  + +        ++ D +     +L   H   V S+SW+ 
Sbjct: 110 VKWAPHEYGLILLCGSADGKISV-------VELKDGQIASTKILDNAHKFGVNSISWAP 161

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 115/293 (39%), Gaps = 41/293 (13%)

Query: 52  DTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVA 111
           + AH+  +   A   +   LA  S D TV I+  + +D +  + LL  + GHE  V    
Sbjct: 5   ENAHEGVIHHAALNYYGTRLATCSSDKTVKIF--EINDVNNSSSLLETLVGHEGPVWYAD 62

Query: 112 WSHDG---AYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVW--HASRLLLA 166
           W H       LATC  D  V IW+      + +       HS  V  + W  H   L+L 
Sbjct: 63  WCHPSLGENLLATCGYDGKVLIWKESGHGGKMQIIGKHAVHSASVNCVKWAPHEYGLILL 122

Query: 167 SSSYDDTVRIWAEQDDDWECAAVLS-----GHGGTVWC-------SDFERAETGIR-LCS 213
             S D  + +   +D       +L      G     W        SD     T ++   S
Sbjct: 123 CGSADGKISVVELKDGQIASTKILDNAHKFGVNSISWAPLMKTDSSDDGDETTAVKQFIS 182

Query: 214 GSDDTTVRIWRCLTDDADVFDKEWIQETVLPA----VHTRAVYSVSWSADGL----IASV 265
           G +D  V+IW+        FD +  QET + A     H  AV +V WS   L    +ASV
Sbjct: 183 GGNDNLVKIWK--------FDDD--QETYVVADTLEGHKDAVTAVDWSPTTLLQSYVASV 232

Query: 266 GSDGVLAVYKEVQAGRWEVVARVDCAHTVYE--INVVKWLALDGRVLLVTGGD 316
            +D    V+ +  + +     ++      +E  +  V W +L G +L V+  D
Sbjct: 233 SNDKQCLVWTQDHSSKKNDWKKISVNEGKFEQKLGSVSW-SLSGNLLAVSDDD 284

>AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH]
           (367581..368573) [993 bp, 330 aa]
          Length = 330

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 110/249 (44%), Gaps = 29/249 (11%)

Query: 96  LLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKH 155
           +     GHE+ V  + +   G ++ATCS D+ + ++  D+ + E+  +   + H   V  
Sbjct: 1   MKPFTTGHEDLVHDICYDFYGRHVATCSSDQHIKVFRLDKDTNEWTLSDSWKGHDSSVVA 60

Query: 156 IVWHASRL--LLASSSYDDTVRIWAEQDD-------DWECAAVLSGHGGTVWCSDFERAE 206
           + W +     +LAS SY+ T+++W E  D        W     L+   G ++   F    
Sbjct: 61  LDWASPEYGRILASVSYNKTIKVWEEDPDAPEGSGRRWTRLCTLNDATGPLYSVKFAPGH 120

Query: 207 TGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQET------VLPAVHTRAVYSVSW---- 256
            G+RL +  +D  +RI+  L + +D+  + W   +        PA H ++ +S+ W    
Sbjct: 121 LGLRLGAIGNDGVLRIYDAL-EPSDL--RSWTLTSEVKVLATPPASHLQSDFSLDWCPSR 177

Query: 257 -SADGLIASVGSDGVLAVYKEVQAGRWEVVARVDCAHTVYEINVVKWLALDGR--VLLVT 313
            SA+ L+          VY+  +AG+    AR+     +  I  V W    GR   L+ T
Sbjct: 178 FSAERLVVCALDQAF--VYERNKAGKLFQAARLPGHQGL--IRSVSWAPSFGRWHQLIAT 233

Query: 314 GGDDGCVNV 322
           G  DG V +
Sbjct: 234 GSKDGRVRI 242

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 54/125 (43%), Gaps = 24/125 (19%)

Query: 45  KLVEELDDTAHKKAVRSVAWRPHC----NVLAAGSFDTTVSIWGRDDDDYSG-------- 92
           KL +      H+  +RSV+W P       ++A GS D  V I+   +   +         
Sbjct: 201 KLFQAARLPGHQGLIRSVSWAPSFGRWHQLIATGSKDGRVRIFQLTEKLDATDDASTDDA 260

Query: 93  -----------ETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFE 141
                        +LL+    H+ EV SV+W+  G  L++   D  V +W++   S EF+
Sbjct: 261 STDDAGPAPHISVQLLSEHADHKGEVWSVSWNLTGTILSSSGDDGKVRLWKS-SFSNEFK 319

Query: 142 CNSVL 146
           C SV+
Sbjct: 320 CMSVI 324

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 73/307 (23%), Positives = 121/307 (39%), Gaps = 44/307 (14%)

Query: 27  LATGSADRKIKLVDVRNFKLVEELDDT--AHKKAVRSVAW--RPHCNVLAAGSFDTTVSI 82
           +AT S+D+ IK+  +        L D+   H  +V ++ W    +  +LA+ S++ T+ +
Sbjct: 24  VATCSSDQHIKVFRLDKDTNEWTLSDSWKGHDSSVVALDWASPEYGRILASVSYNKTIKV 83

Query: 83  WGRDDDDYSGETEL---LAVIEGHENEVKSVAWS--HDGAYLATCSRDKSVWIWEADE-- 135
           W  D D   G       L  +      + SV ++  H G  L     D  + I++A E  
Sbjct: 84  WEEDPDAPEGSGRRWTRLCTLNDATGPLYSVKFAPGHLGLRLGAIGNDGVLRIYDALEPS 143

Query: 136 ------LSEEFECNSVLQ-EHSQDVKHIVWHASRL---LLASSSYDDTVRIWAEQDDDWE 185
                 L+ E +  +     H Q    + W  SR     L   + D        +     
Sbjct: 144 DLRSWTLTSEVKVLATPPASHLQSDFSLDWCPSRFSAERLVVCALDQAFVYERNKAGKLF 203

Query: 186 CAAVLSGHGGTV----WCSDFERAETGIRLCSGSDDTTVRIWRC---LTDDADVFDKEWI 238
            AA L GH G +    W   F R    I   +GS D  VRI++    L    D    +  
Sbjct: 204 QAARLPGHQGLIRSVSWAPSFGRWHQLI--ATGSKDGRVRIFQLTEKLDATDDASTDDAS 261

Query: 239 QETVLPAVHTRA------------VYSVSWSADG-LIASVGSDGVLAVYKEVQAGRWEVV 285
            +   PA H               V+SVSW+  G +++S G DG + ++K   +  ++ +
Sbjct: 262 TDDAGPAPHISVQLLSEHADHKGEVWSVSWNLTGTILSSSGDDGKVRLWKSSFSNEFKCM 321

Query: 286 ARVDCAH 292
           + V CA 
Sbjct: 322 S-VICAQ 327

>KLLA0F06754g complement(650475..651509) similar to sp|P53011
           Saccharomyces cerevisiae YGL100w SEH1 nuclear pore
           protein, start by similarity
          Length = 344

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 115/249 (46%), Gaps = 29/249 (11%)

Query: 96  LLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKH 155
           +   + GH + V  +++   G  +ATCS D+ + +++ D+ + E+E +   + H   +  
Sbjct: 1   MKPFLTGHSDLVHDISYDFYGRRVATCSSDQHIKVFKLDKETNEWELSESWKAHDSSIVS 60

Query: 156 IVWHASRL--LLASSSYDDTVRIWAEQDD-------DWECAAVLSGHGGTVWCSDFERAE 206
           + W A     ++AS SYD T+++W E  D        W+    L+   G ++   F  + 
Sbjct: 61  LDWAAPEFGRIIASVSYDKTIKLWEEDPDALELSGKRWQKLCTLNDATGPLFSVKFAPSH 120

Query: 207 TGIRLCSGSDDTTVRIWRCLTDDADVFDKEWI---QETVL---PAVHTRAVYSVSW---- 256
            G+RL +  +D  +R++  L + +D+  + W    + TVL   PA H ++ + +SW    
Sbjct: 121 LGLRLAALGNDGKLRLYDAL-ESSDL--RSWTLTSEITVLNTPPASHLQSDFCLSWCPSR 177

Query: 257 -SADGLIASVGSDGVLAVYKEVQAGRWEVVARVDCAHTVYEINVVKWLALDGR--VLLVT 313
            S + L+ S        +Y+  + G+      +   HT   I  + W    GR   L+ T
Sbjct: 178 FSTERLVISAMDQAT--IYQRNKQGKLVPAGHLK-GHTGL-IRSIAWAPSVGRWYQLIAT 233

Query: 314 GGDDGCVNV 322
           G  DG + +
Sbjct: 234 GCKDGKLRI 242

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 95  ELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQ 147
           EL++    H+ EV SV+W+  G  L++   D  + +W+A   S EF C SV+Q
Sbjct: 290 ELISEHSDHQGEVWSVSWNLTGTILSSTGDDGKIRLWKA-SYSNEFRCMSVVQ 341

 Score = 35.4 bits (80), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 79/338 (23%), Positives = 127/338 (37%), Gaps = 75/338 (22%)

Query: 19  SVDISKGLLATGSADRKIKLVDVRNFKLVEELDD-------TAHKKAVRSVAW--RPHCN 69
           S D     +AT S+D+ IK+     FKL +E ++        AH  ++ S+ W       
Sbjct: 16  SYDFYGRRVATCSSDQHIKV-----FKLDKETNEWELSESWKAHDSSIVSLDWAAPEFGR 70

Query: 70  VLAAGSFDTTVSIWGRDDD--DYSGET-ELLAVIEGHENEVKSV--AWSHDGAYLATCSR 124
           ++A+ S+D T+ +W  D D  + SG+  + L  +      + SV  A SH G  LA    
Sbjct: 71  IIASVSYDKTIKLWEEDPDALELSGKRWQKLCTLNDATGPLFSVKFAPSHLGLRLAALGN 130

Query: 125 DKSVWIWEADE---------LSEEFECNSVLQEHSQDVKHIVWHASRL---LLASSSYDD 172
           D  + +++A E          SE    N+    H Q    + W  SR     L  S+ D 
Sbjct: 131 DGKLRLYDALESSDLRSWTLTSEITVLNTPPASHLQSDFCLSWCPSRFSTERLVISAMDQ 190

Query: 173 TVRIWAEQDDDWECAAVLSGHGGTV----WCSDFERAETGIRLCSGSDDTTVRIWRC--- 225
                  +      A  L GH G +    W     R    I   +G  D  +RI++    
Sbjct: 191 ATIYQRNKQGKLVPAGHLKGHTGLIRSIAWAPSVGRWYQLI--ATGCKDGKLRIFKVTES 248

Query: 226 -----------------LTDDADVFDK--------------EWIQETVLPAVHTRAVYSV 254
                            +  D    D               E I E    + H   V+SV
Sbjct: 249 RNNGTNIINEENDNNANIERDGPPIDSSAIDADGSVANLHVELISEH---SDHQGEVWSV 305

Query: 255 SWSADG-LIASVGSDGVLAVYKEVQAGRWEVVARVDCA 291
           SW+  G +++S G DG + ++K   +  +  ++ V  A
Sbjct: 306 SWNLTGTILSSTGDDGKIRLWKASYSNEFRCMSVVQAA 343

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score = 66.6 bits (161), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 94/207 (45%), Gaps = 30/207 (14%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNV-LAAGSFDTTVSIWG 84
           LL T  A  K+K V   +  +        H   +   A+ PH +  +  G+ D T  IW 
Sbjct: 119 LLYTPRAVFKVKPVTRSSSAIA------GHGSTILCSAFAPHTSSRMVTGAGDNTARIWD 172

Query: 85  RDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFEC-N 143
            D          +  ++GH N V  V+WS DG  +AT S D ++ +W+     +  +C  
Sbjct: 173 CDTQ------TPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDP----KSGQCLG 222

Query: 144 SVLQEHSQ-------DVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGT 196
             L+ HS+       +  H+V   S+  LASSS D T++IW        C   +SGH  +
Sbjct: 223 DALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSR--VCQYTMSGHTNS 280

Query: 197 VWCSDFERAETGIRLCSGSDDTTVRIW 223
           V C  +     G+ L SGS D TVR+W
Sbjct: 281 VSCVKW--GGQGL-LYSGSHDRTVRVW 304

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 75/154 (48%), Gaps = 13/154 (8%)

Query: 70  VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVW 129
           ++   S D T+ +W     +    T+ +A + GH+  V  VA+S DG Y+ + S D S+ 
Sbjct: 373 MMVTASDDYTMFLW-----NPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIK 427

Query: 130 IWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAV 189
           +W+      + +  S  + H   V  + W +   LL S S D T+++W  +    + +  
Sbjct: 428 LWDG----RDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTR--KLSVD 481

Query: 190 LSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           L GH   V+  D+  +  G R+CSG  D  VR+W
Sbjct: 482 LPGHKDEVYTVDW--SVDGKRVCSGGKDKMVRLW 513

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 78/173 (45%), Gaps = 15/173 (8%)

Query: 8   RSLKLHGDRCWSVDISKGLLATGSADRKIKL-VDVRNFKLVEELDDTAHKKAVRSVAWRP 66
           ++L+ +   C     S+ ++ T S D  + L   +++ K +  +  T H+K V  VA+ P
Sbjct: 355 KALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARM--TGHQKLVNHVAFSP 412

Query: 67  HCNVLAAGSFDTTVSIW-GRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRD 125
               + + SFD ++ +W GRD        + ++   GH   V  VAWS D   L +CS+D
Sbjct: 413 DGRYIVSASFDNSIKLWDGRDG-------KFISTFRGHVASVYQVAWSSDCRLLVSCSKD 465

Query: 126 KSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWA 178
            ++ +W+        +    L  H  +V  + W      + S   D  VR+W 
Sbjct: 466 TTLKVWDVRTRKLSVD----LPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLWT 514

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/262 (24%), Positives = 115/262 (43%), Gaps = 48/262 (18%)

Query: 24  KGLLATGSADRKIKLVDVRNF-KLVEELDDTAHKKAVRSVAWRPHCNV-----LAAGSFD 77
           +GLL +GS DR +++ D+ +  + +  L   AH        W  H ++     L  G+FD
Sbjct: 289 QGLLYSGSHDRTVRVWDINSQGRCINILKSHAH--------WVNHLSLSTDYALRIGAFD 340

Query: 78  TTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELS 137
            T    G+     + E      +E +E   K    S +   + T S D ++++W   + +
Sbjct: 341 HT----GKKPS--TPEEAQKKALENYEKICKKNGNSEE--MMVTASDDYTMFLWNPLKST 392

Query: 138 EEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTV 197
           +     + +  H + V H+ +      + S+S+D+++++W  +D  +   +   GH  +V
Sbjct: 393 KPI---ARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKF--ISTFRGHVASV 447

Query: 198 ----WCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYS 253
               W SD         L S S DTT+++W   T    V          LP  H   VY+
Sbjct: 448 YQVAWSSDCRL------LVSCSKDTTLKVWDVRTRKLSVD---------LPG-HKDEVYT 491

Query: 254 VSWSADG-LIASVGSDGVLAVY 274
           V WS DG  + S G D ++ ++
Sbjct: 492 VDWSVDGKRVCSGGKDKMVRLW 513

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 82/191 (42%), Gaps = 23/191 (12%)

Query: 98  AVIEGHENEVKSVAWS-HDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHI 156
           + I GH + +   A++ H  + + T + D +  IW+ D  +        L+ H   V  +
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMH----TLKGHYNWVLCV 192

Query: 157 VWHASRLLLASSSYDDTVRIWAEQDDDWECAA-VLSGHGGTVWCSDFE-----RAETGIR 210
            W     ++A+ S D+T+R+W  +    +C    L GH   +    +E     +  +  R
Sbjct: 193 SWSPDGEVIATGSMDNTIRLWDPKSG--QCLGDALRGHSKWITSLSWEPIHLVKPGSKPR 250

Query: 211 LCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGV 270
           L S S D T++IW  ++           Q T+  + HT +V  V W   GL+ S   D  
Sbjct: 251 LASSSKDGTIKIWDTVS--------RVCQYTM--SGHTNSVSCVKWGGQGLLYSGSHDRT 300

Query: 271 LAVYKEVQAGR 281
           + V+     GR
Sbjct: 301 VRVWDINSQGR 311

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 40/81 (49%), Gaps = 11/81 (13%)

Query: 187 AAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAV 246
           ++ ++GHG T+ CS F    T  R+ +G+ D T RIW C        D +    T+    
Sbjct: 136 SSAIAGHGSTILCSAFA-PHTSSRMVTGAGDNTARIWDC--------DTQTPMHTL--KG 184

Query: 247 HTRAVYSVSWSADGLIASVGS 267
           H   V  VSWS DG + + GS
Sbjct: 185 HYNWVLCVSWSPDGEVIATGS 205

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 66.6 bits (161), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 115/271 (42%), Gaps = 44/271 (16%)

Query: 68  CNVLAAGSFDTTVSIWGRDDDDYSG-----------ETELLAVIEGHENEVKSVAWSHDG 116
           C + AAG  D+ + IW  D    +            E      + GH   V S ++S D 
Sbjct: 478 CRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSFSPDN 537

Query: 117 AYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLL----ASSSYDD 172
            YL + S DK+V +W  D        ++ L  + +   H VW  S   L    A++S+D 
Sbjct: 538 KYLLSGSEDKTVRLWSMD-------THTALVSY-KGHNHPVWDVSFSPLGHYFATASHDQ 589

Query: 173 TVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADV 232
           T R+W+   D      + +GH   V C  F     G  + +GS D T R+W   T D+  
Sbjct: 590 TARLWS--CDHIYPLRIFAGHLNDVDCVSFH--PNGCYVFTGSSDKTCRMWDVSTGDS-- 643

Query: 233 FDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGS-DGVLAVYKEVQAGRWEVVARVDCA 291
                     L   HT  V S++   DG   S GS DG++ V+ ++  G+     R    
Sbjct: 644 --------VRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVW-DIGTGKRLKQMRGHGK 694

Query: 292 HTVYEINVVKWLALDGRVLLVTGGDDGCVNV 322
           + +Y ++  K    +G V L++GG D  V V
Sbjct: 695 NAIYSLSYSK----EGNV-LISGGADHTVRV 720

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 99/225 (44%), Gaps = 32/225 (14%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
            H   V S ++ P    L +GS D TV +W  D       T L++  +GH + V  V++S
Sbjct: 523 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDT-----HTALVSY-KGHNHPVWDVSFS 576

Query: 114 HDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDT 173
             G Y AT S D++  +W  D +        +   H  DV  + +H +   + + S D T
Sbjct: 577 PLGHYFATASHDQTARLWSCDHIYPL----RIFAGHLNDVDCVSFHPNGCYVFTGSSDKT 632

Query: 174 VRIWAEQDDDWECAAVLSGHGGTVW----CSDFERAETGIRLCSGSDDTTVRIWRCLTDD 229
            R+W     D     +  GH   V     C D      G  L +GS+D  + +W      
Sbjct: 633 CRMWDVSTGD--SVRLFLGHTAPVISIAVCPD------GRWLSTGSEDGIINVW------ 678

Query: 230 ADVFDKEWIQETVLPAVHTRAVYSVSWSADG-LIASVGSDGVLAV 273
            D+   + +++  +      A+YS+S+S +G ++ S G+D  + V
Sbjct: 679 -DIGTGKRLKQ--MRGHGKNAIYSLSYSKEGNVLISGGADHTVRV 720

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 66.2 bits (160), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 78/263 (29%), Positives = 115/263 (43%), Gaps = 40/263 (15%)

Query: 72  AAGSFDTTVSIWGRDDDDY-----SGETELL--AVIEGHENEVKSVAWSHDGAYLATCSR 124
           AAG  D+ + +W  D         S + E +    + GH   V S ++S D  YL + S 
Sbjct: 437 AAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLIGHSGTVYSTSFSPDNKYLLSASE 496

Query: 125 DKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLL----ASSSYDDTVRIWAEQ 180
           DK+V +W  D  S      S++     +  H VW  S   L    A++S+D T R+W+  
Sbjct: 497 DKTVRLWSMDTYS------SLVSYKGHN--HPVWDVSFSPLGHYFATASHDQTARLWS-- 546

Query: 181 DDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQE 240
            D      + +GH   V C  F     G  + +GS D T R+W   T D+          
Sbjct: 547 CDHIYPLRIFAGHLNDVDCVSFH--PNGTYVFTGSTDKTCRMWDIGTGDS---------- 594

Query: 241 TVLPAVHTRAVYSVSWSADGLIASVGS-DGVLAVYKEVQAGRWEVVARVDCAHTVYEINV 299
             L   HT  V S + S DG   S GS DG++ V+ ++  G+     R    + VY ++ 
Sbjct: 595 VRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVW-DIGTGKRLKQMRGHGKNAVYSLSY 653

Query: 300 VKWLALDGRVLLVTGGDDGCVNV 322
            K    +G V LV+GG D  V V
Sbjct: 654 SK----EGTV-LVSGGADHSVRV 671

>Kwal_23.6324
          Length = 514

 Score = 65.9 bits (159), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 84/178 (47%), Gaps = 22/178 (12%)

Query: 54  AHKKAVRSVAWRPHCN-VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAW 112
            H   +   A+ PH +  +  GS D T  IW     D +  T +   ++GH N V  VAW
Sbjct: 140 GHGSTILCSAFAPHTSGRMVTGSGDNTARIW-----DCNTNTPMY-TLKGHFNWVLCVAW 193

Query: 113 SHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLL-------L 165
             DG  +AT S D ++ +W++++     E    L+ H++ +  + W    L+       L
Sbjct: 194 CPDGELIATGSMDNTIRLWDSNKGESYGE---ALRGHAKWITSLTWEPMHLVKAGDQPRL 250

Query: 166 ASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           AS+S D T++IW        C   LSGH  +V C  +     GI L SGS D T+R W
Sbjct: 251 ASASKDGTIKIWDTTRR--VCVLTLSGHTNSVSCVKW--GGRGI-LYSGSHDKTIRAW 303

 Score = 60.1 bits (144), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 74/154 (48%), Gaps = 15/154 (9%)

Query: 26  LLATGSADRKIKLVD-VRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIW- 83
           L+ T S D  + L D ++  K +  +  T H+K V  VA+ P    + + SFD ++ +W 
Sbjct: 372 LMVTASDDFTMYLWDPLKASKPITRM--TGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD 429

Query: 84  GRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECN 143
           GR+          +A   GH   V  VAWS D   L +CS+D ++ +W  D  +++   +
Sbjct: 430 GRNG-------TFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW--DVRTKKLSVD 480

Query: 144 SVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
             L  H+ +V  + W      + S+  D  VRIW
Sbjct: 481 --LPGHNDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 71/154 (46%), Gaps = 13/154 (8%)

Query: 70  VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVW 129
           ++   S D T+ +W     D    ++ +  + GH+  V  VA+S DG Y+ + S D S+ 
Sbjct: 372 LMVTASDDFTMYLW-----DPLKASKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIK 426

Query: 130 IWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAV 189
           +W+           +  + H   V  + W +   LL S S D T+++W  +    + +  
Sbjct: 427 LWDG----RNGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTK--KLSVD 480

Query: 190 LSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           L GH   V+  D+  +  G R+CS   D  VRIW
Sbjct: 481 LPGHNDEVYTVDW--SVDGKRVCSAGKDKMVRIW 512

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/262 (24%), Positives = 112/262 (42%), Gaps = 48/262 (18%)

Query: 24  KGLLATGSADRKIKLVDVR-NFKLVEELDDTAHKKAVRSVAWRPHCNV-----LAAGSFD 77
           +G+L +GS D+ I+  D+    K +  L   AH        W  H ++     L  G+FD
Sbjct: 288 RGILYSGSHDKTIRAWDMAAGGKCINILKSHAH--------WINHLSLNTDYALRVGAFD 339

Query: 78  TTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELS 137
            T       +   S E      ++ +E   K      +   + T S D ++++W+  + S
Sbjct: 340 HT------GEKPSSPEEARAKALKNYEKIAKKNGQLEE--LMVTASDDFTMYLWDPLKAS 391

Query: 138 EEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTV 197
           +     + +  H + V H+ +      + S+S+D+++++W  ++  +   A   GH  +V
Sbjct: 392 KPI---TRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTF--IATFRGHVASV 446

Query: 198 ----WCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYS 253
               W SD         L S S DTT+++W   T    V          LP  H   VY+
Sbjct: 447 YQVAWSSDCRL------LVSCSKDTTLKVWDVRTKKLSV---------DLPG-HNDEVYT 490

Query: 254 VSWSADG-LIASVGSDGVLAVY 274
           V WS DG  + S G D ++ ++
Sbjct: 491 VDWSVDGKRVCSAGKDKMVRIW 512

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 39/81 (48%), Gaps = 11/81 (13%)

Query: 187 AAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAV 246
           ++ ++GHG T+ CS F    +G R+ +GS D T RIW C T+      K           
Sbjct: 135 SSAIAGHGSTILCSAFAPHTSG-RMVTGSGDNTARIWDCNTNTPMYTLKG---------- 183

Query: 247 HTRAVYSVSWSADGLIASVGS 267
           H   V  V+W  DG + + GS
Sbjct: 184 HFNWVLCVAWCPDGELIATGS 204

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 77/190 (40%), Gaps = 21/190 (11%)

Query: 98  AVIEGHENEVKSVAWS-HDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHI 156
           + I GH + +   A++ H    + T S D +  IW+ +  +  +     L+ H   V  +
Sbjct: 136 SAIAGHGSTILCSAFAPHTSGRMVTGSGDNTARIWDCNTNTPMY----TLKGHFNWVLCV 191

Query: 157 VWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFE-----RAETGIRL 211
            W     L+A+ S D+T+R+W + +        L GH   +    +E     +A    RL
Sbjct: 192 AWCPDGELIATGSMDNTIRLW-DSNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRL 250

Query: 212 CSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVL 271
            S S D T++IW          D       +  + HT +V  V W   G++ S   D  +
Sbjct: 251 ASASKDGTIKIW----------DTTRRVCVLTLSGHTNSVSCVKWGGRGILYSGSHDKTI 300

Query: 272 AVYKEVQAGR 281
             +     G+
Sbjct: 301 RAWDMAAGGK 310

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 65.9 bits (159), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 93/205 (45%), Gaps = 13/205 (6%)

Query: 24  KGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIW 83
           K  +  GS D KI++ +    + V  +D  AH   +R++A  P  + + + S D TV +W
Sbjct: 67  KSWIIVGSDDFKIRVFNYNTGEKV--VDFEAHPDYIRALAVHPTRSYVLSASDDLTVKLW 124

Query: 84  GRDDDDYSGETELLAVIEGHENEVKSVAWS-HDGAYLATCSRDKSVWIWEADELSEEFEC 142
                ++     L    EGHE+ V SV ++  D    AT   D +V IW   + +  F  
Sbjct: 125 -----NWEKNWALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSNFTL 179

Query: 143 NSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDF 202
            + L++    V +  +     L+ SS  D TV++W  Q     C A L GH   V  + +
Sbjct: 180 RAHLEKGVNFVDYYPFQDKPYLITSSD-DRTVKVWDYQTK--SCVATLEGHLSNVSYAVY 236

Query: 203 ERAETGIRLCSGSDDTTVRIWRCLT 227
                 I   SGS+D TV+IW   T
Sbjct: 237 HPMLPII--ISGSEDGTVKIWNSNT 259

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 83/175 (47%), Gaps = 23/175 (13%)

Query: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKLVD-VRNFKLVEELDDTAHKKAVRSVAWR 65
           +R+L +H  R +        + + S D  +KL +  +N+ L +  +   H+  V SV + 
Sbjct: 100 IRALAVHPTRSY--------VLSASDDLTVKLWNWEKNWALEQTFE--GHEHFVMSVTFN 149

Query: 66  PH-CNVLAAGSFDTTVSIW--GRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATC 122
           P   N  A    D TV IW  G++  +++    L A +E   N V    +  D  YL T 
Sbjct: 150 PKDPNTFATACLDHTVKIWSLGQETSNFT----LRAHLEKGVNFVDYYPF-QDKPYLITS 204

Query: 123 SRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
           S D++V +W+    S    C + L+ H  +V + V+H    ++ S S D TV+IW
Sbjct: 205 SDDRTVKVWDYQTKS----CVATLEGHLSNVSYAVYHPMLPIIISGSEDGTVKIW 255

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 70/179 (39%), Gaps = 22/179 (12%)

Query: 27  LATGSADRKIKL----VDVRNFKLVEELDDTAHKKAVRSVAWRPHCN--VLAAGSFDTTV 80
            AT   D  +K+     +  NF L   L+     K V  V + P  +   L   S D TV
Sbjct: 156 FATACLDHTVKIWSLGQETSNFTLRAHLE-----KGVNFVDYYPFQDKPYLITSSDDRTV 210

Query: 81  SIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEF 140
            +W     DY  ++  +A +EGH + V    +      + + S D +V IW ++    E 
Sbjct: 211 KVW-----DYQTKS-CVATLEGHLSNVSYAVYHPMLPIIISGSEDGTVKIWNSNTYKLER 264

Query: 141 ECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWC 199
             N  L+       H      R  +A + +D+   + A  +D  E    L   G  VWC
Sbjct: 265 TLNLGLERSWCVAAHPT--GKRNFIA-AGFDNGFTVLAIGND--EPRLSLDPVGKLVWC 318

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 65.5 bits (158), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 84/178 (47%), Gaps = 22/178 (12%)

Query: 54  AHKKAVRSVAWRPHCNV-LAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAW 112
            H   +   A+ PH +  +  G+ D T  IW     D + +T + + ++GH N V  V+W
Sbjct: 141 GHGSTILCSAFAPHTSSRMITGAGDNTARIW-----DCNTQTPM-STLKGHFNWVLCVSW 194

Query: 113 SHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQ-------DVKHIVWHASRLLL 165
           S DG  +AT S D ++ +WE ++          L+ H +       +  H+V    +  L
Sbjct: 195 SPDGELIATGSMDNTIRLWEGNKGQ---PVGDALRGHGKWITSLSWEPIHLVKPGQKPRL 251

Query: 166 ASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           AS+S D T++IW        C   LSGH  +V C   +    G+ L SGS D T+R W
Sbjct: 252 ASASKDGTIKIWDTTRR--VCLITLSGHTSSVSC--IKWGGQGV-LYSGSHDKTIRAW 304

 Score = 59.7 bits (143), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 73/154 (47%), Gaps = 13/154 (8%)

Query: 70  VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVW 129
           ++   S D T+ +W     +    T+ +  + GH+  V  VA+S DG ++ + S D S+ 
Sbjct: 373 LMVTASDDFTMYLW-----NPLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIK 427

Query: 130 IWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAV 189
           +W       + +  S  + H   V  + W +   LL S S D T+++W  +    + A  
Sbjct: 428 LWNG----RDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTK--KLAVD 481

Query: 190 LSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           L GH   V+  D+  +  G R+CSG  D  VR+W
Sbjct: 482 LPGHKDEVYTVDW--SVDGKRVCSGGKDKMVRLW 513

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 70/155 (45%), Gaps = 15/155 (9%)

Query: 26  LLATGSADRKIKL-VDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIW- 83
           L+ T S D  + L   +++ K +  +  T H+K V  VA+ P    + + SFD ++ +W 
Sbjct: 373 LMVTASDDFTMYLWNPLKSTKPITRM--TGHQKLVNHVAFSPDGRHIVSASFDNSIKLWN 430

Query: 84  GRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECN 143
           GRD        + ++   GH   V  VAWS D   L +CS+D ++ +W+        +  
Sbjct: 431 GRDG-------KFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTKKLAVD-- 481

Query: 144 SVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWA 178
             L  H  +V  + W      + S   D  VR+W 
Sbjct: 482 --LPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLWT 514

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 62/262 (23%), Positives = 113/262 (43%), Gaps = 48/262 (18%)

Query: 24  KGLLATGSADRKIKLVDVR-NFKLVEELDDTAHKKAVRSVAWRPHCNV-----LAAGSFD 77
           +G+L +GS D+ I+  D+    K +  L   AH        W  H ++     L  G+FD
Sbjct: 289 QGVLYSGSHDKTIRAWDMNLGGKCINILKSHAH--------WVNHLSLSTDYALRIGAFD 340

Query: 78  TTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELS 137
            T       ++      +    I     EV+ +        + T S D ++++W   + +
Sbjct: 341 HTSEKPSTPEEAQKRALKNYEKIAKRNGEVEEL--------MVTASDDFTMYLWNPLKST 392

Query: 138 EEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTV 197
           +     + +  H + V H+ +      + S+S+D+++++W  +D  +   +   GH  +V
Sbjct: 393 KPI---TRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGRDGKF--ISTFRGHVASV 447

Query: 198 ----WCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYS 253
               W SD         L S S DTT+++W       DV  K+   +  LP  H   VY+
Sbjct: 448 YQVAWSSDCRL------LVSCSKDTTLKVW-------DVKTKKLAVD--LPG-HKDEVYT 491

Query: 254 VSWSADG-LIASVGSDGVLAVY 274
           V WS DG  + S G D ++ ++
Sbjct: 492 VDWSVDGKRVCSGGKDKMVRLW 513

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 41/83 (49%), Gaps = 15/83 (18%)

Query: 187 AAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAV 246
           ++ ++GHG T+ CS F    T  R+ +G+ D T RIW C T            +T +  +
Sbjct: 136 SSAIAGHGSTILCSAFA-PHTSSRMITGAGDNTARIWDCNT------------QTPMSTL 182

Query: 247 --HTRAVYSVSWSADGLIASVGS 267
             H   V  VSWS DG + + GS
Sbjct: 183 KGHFNWVLCVSWSPDGELIATGS 205

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 76/185 (41%), Gaps = 31/185 (16%)

Query: 98  AVIEGHENEVKSVAWS-HDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHI 156
           + I GH + +   A++ H  + + T + D +  IW+ +  +      S L+ H   V  +
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQTPM----STLKGHFNWVLCV 192

Query: 157 VWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFE-----RAETGIRL 211
            W     L+A+ S D+T+R+W E +        L GHG  +    +E     +     RL
Sbjct: 193 SWSPDGELIATGSMDNTIRLW-EGNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRL 251

Query: 212 CSGSDDTTVRIWR-----CLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVG 266
            S S D T++IW      CL               +  + HT +V  + W   G++ S  
Sbjct: 252 ASASKDGTIKIWDTTRRVCL---------------ITLSGHTSSVSCIKWGGQGVLYSGS 296

Query: 267 SDGVL 271
            D  +
Sbjct: 297 HDKTI 301

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 81/178 (45%), Gaps = 22/178 (12%)

Query: 54  AHKKAVRSVAWRPHCNV-LAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAW 112
            H   +   A+ PH +  +  G  D T  IW  D D  + +  L     GH N V  V+W
Sbjct: 143 GHGATILCSAFAPHTSSRVVTGGGDNTARIW--DCDTQTPKVTL----NGHRNWVLCVSW 196

Query: 113 SHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQ-------DVKHIVWHASRLLL 165
           S DG  +AT S D ++ +W+A+           L+ HS+       +  H+V   S+  L
Sbjct: 197 SADGEVIATGSMDNTIRLWDAESGK---PLGDALRGHSKWITSLTWEPIHLVEPGSKPRL 253

Query: 166 ASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           AS+S D T+RIW        C   L GH  +V C  +     GI L SGS D TVR W
Sbjct: 254 ASASKDGTIRIWDSSRR--VCLMTLGGHTNSVSCVKW--GGEGI-LYSGSHDKTVRAW 306

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 77/157 (49%), Gaps = 13/157 (8%)

Query: 67  HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDK 126
           H  ++   S D T+ +W    +   G T+ ++ + GH+  V  VA+S DG Y+ + S D 
Sbjct: 372 HEELMVTASDDFTMFLW----NPLKG-TKPISRMTGHQKLVNHVAFSPDGKYIVSASFDN 426

Query: 127 SVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWEC 186
           S+ +W+     +E    S  + H   V  + W +   LL S S D T+++W  +    + 
Sbjct: 427 SIKLWDG----KEGTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTR--KL 480

Query: 187 AAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           +  L GH   V+  D+  +  G R+CSG  D  +R+W
Sbjct: 481 SVDLPGHQDEVYTVDW--SVDGKRVCSGGKDKMMRLW 515

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 66/153 (43%), Gaps = 13/153 (8%)

Query: 26  LLATGSADRKIKL-VDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWG 84
           L+ T S D  + L   ++  K +  +  T H+K V  VA+ P    + + SFD ++ +W 
Sbjct: 375 LMVTASDDFTMFLWNPLKGTKPISRM--TGHQKLVNHVAFSPDGKYIVSASFDNSIKLWD 432

Query: 85  RDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNS 144
                   E   L+   GH   V  VAWS D   L +CS+D ++ +W+        +   
Sbjct: 433 ------GKEGTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVD--- 483

Query: 145 VLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
            L  H  +V  + W      + S   D  +R+W
Sbjct: 484 -LPGHQDEVYTVDWSVDGKRVCSGGKDKMMRLW 515

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 63/265 (23%), Positives = 112/265 (42%), Gaps = 54/265 (20%)

Query: 24  KGLLATGSADRKIKLVDVR-NFKLVEELDDTAHKKAVRSVAWRPHCNV-----LAAGSFD 77
           +G+L +GS D+ ++  D++ N K +  L   AH        W  H ++     L  G+FD
Sbjct: 291 EGILYSGSHDKTVRAWDMKQNGKCINILKSHAH--------WVNHLSLSTDYALRVGAFD 342

Query: 78  TT---VSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEAD 134
            T    +      D      E +A   G   E+           + T S D ++++W   
Sbjct: 343 YTGVKPANAKEARDKALQNYEKVARKNGKHEEL-----------MVTASDDFTMFLWNPL 391

Query: 135 ELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHG 194
           + ++     S +  H + V H+ +      + S+S+D+++++W  ++  +   +   GH 
Sbjct: 392 KGTKPI---SRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTF--LSTFRGHV 446

Query: 195 GTV----WCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRA 250
            +V    W SD         L S S DTT+++W   T    V          LP  H   
Sbjct: 447 ASVYQVAWSSDCRL------LVSCSKDTTLKVWDVKTRKLSVD---------LPG-HQDE 490

Query: 251 VYSVSWSADG-LIASVGSDGVLAVY 274
           VY+V WS DG  + S G D ++ ++
Sbjct: 491 VYTVDWSVDGKRVCSGGKDKMMRLW 515

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 62/146 (42%), Gaps = 24/146 (16%)

Query: 134 DELSEEFEC------NSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECA 187
           D +   F C      N+V   H+ D+   ++ +S L    +S +D + +  +    ++  
Sbjct: 74  DPVPYTFSCTVKNTKNAVTTTHTVDIVDNIY-SSLLKPGHNSTEDIITLDFQPRAVFKVK 132

Query: 188 AV------LSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQET 241
            +      ++GHG T+ CS F    T  R+ +G  D T RIW C T    V         
Sbjct: 133 PITRSSSAIAGHGATILCSAFA-PHTSSRVVTGGGDNTARIWDCDTQTPKVTLNG----- 186

Query: 242 VLPAVHTRAVYSVSWSADGLIASVGS 267
                H   V  VSWSADG + + GS
Sbjct: 187 -----HRNWVLCVSWSADGEVIATGS 207

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 77/190 (40%), Gaps = 21/190 (11%)

Query: 98  AVIEGHENEVKSVAWS-HDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHI 156
           + I GH   +   A++ H  + + T   D +  IW+ D  + +   N     H   V  +
Sbjct: 139 SAIAGHGATILCSAFAPHTSSRVVTGGGDNTARIWDCDTQTPKVTLNG----HRNWVLCV 194

Query: 157 VWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFER---AETG--IRL 211
            W A   ++A+ S D+T+R+W + +        L GH   +    +E     E G   RL
Sbjct: 195 SWSADGEVIATGSMDNTIRLW-DAESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRL 253

Query: 212 CSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVL 271
            S S D T+RIW          D       +    HT +V  V W  +G++ S   D  +
Sbjct: 254 ASASKDGTIRIW----------DSSRRVCLMTLGGHTNSVSCVKWGGEGILYSGSHDKTV 303

Query: 272 AVYKEVQAGR 281
             +   Q G+
Sbjct: 304 RAWDMKQNGK 313

>Kwal_14.1611
          Length = 334

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/247 (23%), Positives = 113/247 (45%), Gaps = 25/247 (10%)

Query: 96  LLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKH 155
           +   I GHE+ V  +++   G ++ATCS D+ + ++     + E++ +   + H   V  
Sbjct: 1   MKPFITGHEDLVHDISYDFYGRHVATCSSDQHIKVFRLVRETNEWQLSDSWKAHDSSVVG 60

Query: 156 IVWHASRL--LLASSSYDDTVRIWAEQDDDWECAA-------VLSGHGGTVWCSDFERAE 206
           + W +     ++AS SYD  V +W E+ D  EC+         L+   G ++   F    
Sbjct: 61  LDWASPEYGRIIASVSYDKQVNLWEEEPDAAECSGRRWTKLCTLNDATGPLFSVKFAPGH 120

Query: 207 TGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVL----PAVHTRAVYSVSW-----S 257
            G++L +  +D  +RI+  + + +D+       E  +    PA H ++ + ++W     S
Sbjct: 121 LGLKLGAIGNDGILRIYEAM-EPSDLRSWTLTSEVKVLPSPPASHLQSDFCLTWCPSRFS 179

Query: 258 ADGLIASVGSDGVLAVYKEVQAGRWEVVARVDCAHTVYEINVVKWLALDGR--VLLVTGG 315
            + LI       +  +Y++ +AG+  V A+++    +  I  V W    GR   L+ T  
Sbjct: 180 PEKLIVCALDQAL--IYQKDKAGKLYVAAKLEGHAGL--IRSVSWAPSVGRWYQLIATAC 235

Query: 316 DDGCVNV 322
            DG V +
Sbjct: 236 KDGKVRI 242

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 53/126 (42%), Gaps = 29/126 (23%)

Query: 54  AHKKAVRSVAWRPHC----NVLAAGSFDTTVSIW-----GRDDDD--------------- 89
            H   +RSV+W P       ++A    D  V I+      +DD D               
Sbjct: 210 GHAGLIRSVSWAPSVGRWYQLIATACKDGKVRIFKLMETAQDDQDAMSVDQVEEESENGS 269

Query: 90  ----YSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSV 145
                S + EL++  + H  EV SV+W+  G  L++   D  V +W+A   S EF+C SV
Sbjct: 270 ESIPSSLKVELVSESDDHRGEVWSVSWNLTGTILSSAGDDGKVRLWKA-SYSSEFKCMSV 328

Query: 146 LQEHSQ 151
           +    +
Sbjct: 329 ISAQQK 334

 Score = 35.8 bits (81), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 75/321 (23%), Positives = 130/321 (40%), Gaps = 58/321 (18%)

Query: 19  SVDISKGLLATGSADRKIKLVDVRNFKLVEELDD-------TAHKKAVRSVAW--RPHCN 69
           S D     +AT S+D+ IK+     F+LV E ++        AH  +V  + W    +  
Sbjct: 16  SYDFYGRHVATCSSDQHIKV-----FRLVRETNEWQLSDSWKAHDSSVVGLDWASPEYGR 70

Query: 70  VLAAGSFDTTVSIWGRDDD--DYSGET-ELLAVIEGHENEVKSVAWS--HDGAYLATCSR 124
           ++A+ S+D  V++W  + D  + SG     L  +      + SV ++  H G  L     
Sbjct: 71  IIASVSYDKQVNLWEEEPDAAECSGRRWTKLCTLNDATGPLFSVKFAPGHLGLKLGAIGN 130

Query: 125 DKSVWIWEADE--------LSEEFEC-NSVLQEHSQDVKHIVWHASRL---LLASSSYDD 172
           D  + I+EA E        L+ E +   S    H Q    + W  SR     L   + D 
Sbjct: 131 DGILRIYEAMEPSDLRSWTLTSEVKVLPSPPASHLQSDFCLTWCPSRFSPEKLIVCALDQ 190

Query: 173 TVRIWAEQDDDWECAAVLSGHGGTV----WCSDFERAETGIRLCSGSDDTTVRIWRCL-- 226
            +    ++      AA L GH G +    W     R    I   +   D  VRI++ +  
Sbjct: 191 ALIYQKDKAGKLYVAAKLEGHAGLIRSVSWAPSVGRWYQLI--ATACKDGKVRIFKLMET 248

Query: 227 -TDDADVFDKEWIQETV------LPAV-----------HTRAVYSVSWSADG-LIASVGS 267
             DD D    + ++E        +P+            H   V+SVSW+  G +++S G 
Sbjct: 249 AQDDQDAMSVDQVEEESENGSESIPSSLKVELVSESDDHRGEVWSVSWNLTGTILSSAGD 308

Query: 268 DGVLAVYKEVQAGRWEVVARV 288
           DG + ++K   +  ++ ++ +
Sbjct: 309 DGKVRLWKASYSSEFKCMSVI 329

 Score = 32.3 bits (72), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 59/136 (43%), Gaps = 31/136 (22%)

Query: 89  DYSGETELLAVIEGHENEVKSVAWSHDGA----YLATCSRDKSVWIWEADELSE------ 138
           D +G+  + A +EGH   ++SV+W+         +AT  +D  V I++  E ++      
Sbjct: 197 DKAGKLYVAAKLEGHAGLIRSVSWAPSVGRWYQLIATACKDGKVRIFKLMETAQDDQDAM 256

Query: 139 --------------------EFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW- 177
                               + E  S   +H  +V  + W+ +  +L+S+  D  VR+W 
Sbjct: 257 SVDQVEEESENGSESIPSSLKVELVSESDDHRGEVWSVSWNLTGTILSSAGDDGKVRLWK 316

Query: 178 AEQDDDWECAAVLSGH 193
           A    +++C +V+S  
Sbjct: 317 ASYSSEFKCMSVISAQ 332

>Kwal_27.12053
          Length = 755

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 110/259 (42%), Gaps = 32/259 (12%)

Query: 72  AAGSFDTTVSIWGRDDDDY-------SGETELLAVIEGHENEVKSVAWSHDGAYLATCSR 124
           AAG  D+ + IW  D +          GE      + GH   V S ++S D  YL + S 
Sbjct: 443 AAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYSTSFSPDNRYLLSASE 502

Query: 125 DKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDW 184
           DK+V +W  D  +         + H+  +  + +       A++S+D T R+W+   D  
Sbjct: 503 DKTVRLWSTDTYTSLVN----YKGHNHPIWDVAFSPLGHYFATASHDQTARLWS--CDHI 556

Query: 185 ECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLP 244
               + +GH   V    F     G  + +GS D T R+W   + D+            L 
Sbjct: 557 YPLRIFAGHLNDVDTVSFH--PNGTYVFTGSSDKTCRMWDITSGDS----------VRLF 604

Query: 245 AVHTRAVYSVSWSADGLIASVGS-DGVLAVYKEVQAGRWEVVARVDCAHTVYEINVVKWL 303
             HT  V S + S DG   S GS DGV+ V+ ++  G+     R    + VY ++  K  
Sbjct: 605 LGHTAPVTSTAVSPDGRWLSTGSEDGVINVW-DIGTGKRLKQMRGHGKNAVYSLSYSK-- 661

Query: 304 ALDGRVLLVTGGDDGCVNV 322
             +G V L++GG D  V V
Sbjct: 662 --EGHV-LISGGADHSVRV 677

>Scas_631.17
          Length = 474

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 89/189 (47%), Gaps = 25/189 (13%)

Query: 93  ETELLAVI----EGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQE 148
           +T+ L VI     GH+ ++  +AW+    +L + + D  V I   D   +  +  + LQ 
Sbjct: 214 DTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLVKIHSFDPDVKIIKELTALQG 273

Query: 149 HSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLS---GHGGTVWCSDFERA 205
           H+  V ++ +H S   +AS+S+D T R+W     D E    L    GHG  V+   F+  
Sbjct: 274 HTGRVVNVDFHPSGRFVASASFDMTWRLW-----DIESETELQFQEGHGKEVYSLSFQ-- 326

Query: 206 ETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGL-IAS 264
             G  LCSG  D    +W   T  + + + +          H + +YSV WS DG  IA+
Sbjct: 327 NDGALLCSGGLDNAAIVWDVRTGKS-IMNLQG---------HAKPIYSVDWSPDGYHIAT 376

Query: 265 VGSDGVLAV 273
            G DGV+ +
Sbjct: 377 GGGDGVINI 385

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 109/229 (47%), Gaps = 22/229 (9%)

Query: 2   PNLHLVR---SLKLHGDRCWSVDI--SKGLLATGSADRKIKLVDVRNFKLVEELDDTAHK 56
           P++ +++   +L+ H  R  +VD   S   +A+ S D   +L D+ +   ++  +   H 
Sbjct: 260 PDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQE--GHG 317

Query: 57  KAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDG 116
           K V S++++    +L +G  D    +W    D  +G++  +  ++GH   + SV WS DG
Sbjct: 318 KEVYSLSFQNDGALLCSGGLDNAAIVW----DVRTGKS--IMNLQGHAKPIYSVDWSPDG 371

Query: 117 AYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASR-LLLASSSYDDTVR 175
            ++AT   D  + IW+  + +E     + L  H+  V  + +  S    L S  YD  +R
Sbjct: 372 YHIATGGGDGVINIWDIRKTTE----TTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIR 427

Query: 176 IWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWR 224
           I++   D+W     L GH   +   D + +E    + S   D ++++W+
Sbjct: 428 IYSS--DNWIQVKTLEGHTDKIL--DVDISEDAQLIVSSGWDRSLKLWK 472

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 118/283 (41%), Gaps = 34/283 (12%)

Query: 3   NLHLVRSLKLHGDRCWSV-DISK-------GLLATGSADRKIKLVDVRNFKLVEELDDTA 54
           N HL + ++L G +  S+  ISK        L ATGS    IK++D +   ++  +++  
Sbjct: 170 NQHLEK-MQLVGSQIVSIRPISKVCLMSDNALCATGSWAGDIKILDTKTLDVISGIEN-G 227

Query: 55  HKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSH 114
           H   +  +AW      L +G+ D  V I   D D      + L  ++GH   V +V +  
Sbjct: 228 HDGKIGGLAWNSTNTHLVSGADDCLVKIHSFDPD--VKIIKELTALQGHTGRVVNVDFHP 285

Query: 115 DGAYLATCSRDKSVWIWEADELSE-EFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDT 173
            G ++A+ S D +  +W+ +  +E +F+     + H ++V  + +     LL S   D+ 
Sbjct: 286 SGRFVASASFDMTWRLWDIESETELQFQ-----EGHGKEVYSLSFQNDGALLCSGGLDNA 340

Query: 174 VRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVF 233
             +W  +    +    L GH   ++  D+  +  G  + +G  D  + IW          
Sbjct: 341 AIVWDVRTG--KSIMNLQGHAKPIYSVDW--SPDGYHIATGGGDGVINIW---------- 386

Query: 234 DKEWIQETVLPAVHTRAVYSVSW--SADGLIASVGSDGVLAVY 274
           D     ET     H   V  V +  S    + S G D  + +Y
Sbjct: 387 DIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIY 429

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 75/169 (44%), Gaps = 27/169 (15%)

Query: 155 HIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSG 214
           H+V  A   L+   S+D  V+I  E          L GH G V   DF    +G  + S 
Sbjct: 243 HLVSGADDCLVKIHSFDPDVKIIKE-------LTALQGHTGRVVNVDFH--PSGRFVASA 293

Query: 215 SDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADG-LIASVGSDGVLAV 273
           S D T R+W          D E   E      H + VYS+S+  DG L+ S G D    V
Sbjct: 294 SFDMTWRLW----------DIESETELQFQEGHGKEVYSLSFQNDGALLCSGGLDNAAIV 343

Query: 274 YKEVQAGRWEVVARVDCAHTVYEINVVKWLALDGRVLLVTGGDDGCVNV 322
           + +V+ G+  ++     A  +Y ++   W + DG   + TGG DG +N+
Sbjct: 344 W-DVRTGK-SIMNLQGHAKPIYSVD---W-SPDG-YHIATGGGDGVINI 385

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 60/133 (45%), Gaps = 15/133 (11%)

Query: 7   VRSLKLHGDRCWSVDISKG--LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAW 64
           + +L+ H    +SVD S     +ATG  D  I + D+R  K  E     AH   V  V +
Sbjct: 352 IMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIR--KTTETTRLLAHNNIVTGVRF 409

Query: 65  RP---HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLAT 121
           +    HC  L +  +D  + I+  D+         +  +EGH +++  V  S D   + +
Sbjct: 410 QKSTGHC--LVSCGYDKQIRIYSSDN------WIQVKTLEGHTDKILDVDISEDAQLIVS 461

Query: 122 CSRDKSVWIWEAD 134
              D+S+ +W+ +
Sbjct: 462 SGWDRSLKLWKQE 474

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 107/250 (42%), Gaps = 27/250 (10%)

Query: 33  DRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRP-HCNVLAAGSFDTTVSIWGRDDDDYS 91
           +R I+L+   +  LV       H   V S++  P   N+L +GS D T+  W    +D  
Sbjct: 10  ERTIELIMSTDEILVLRGTLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQ 69

Query: 92  GETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQ 151
               + +  +GH + V+    +HDG Y  + S DK++ +W+     +  +C      H  
Sbjct: 70  YGVPVRS-FKGHSHIVQDCTVTHDGKYALSASWDKTLRLWDL----QSGKCIKRFVGHKS 124

Query: 152 DVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHG---GTVWCSDFERAETG 208
           DV  +        + S+S D TV++W    D   C   L GH      V  +  E+++  
Sbjct: 125 DVMSVSIDPRATQIVSASRDKTVKVWNTVGD---CVVTLLGHNDWVSNVRIAPSEKSDDA 181

Query: 209 IRLCSGSDDTTVRIW--RCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADG-LIASV 265
           + + S   D  V++W  +  T +AD               H   V +V+ S DG + AS 
Sbjct: 182 VTVISAGMDKVVKVWDLQSFTIEADFIG------------HNNYVTTVTPSPDGSIFASA 229

Query: 266 GSDGVLAVYK 275
           G DG + ++ 
Sbjct: 230 GKDGQIILWN 239

 Score = 34.7 bits (78), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 33/164 (20%), Positives = 70/164 (42%), Gaps = 17/164 (10%)

Query: 68  CNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKS 127
             V++AG  D  V +W  D   ++ E + +    GH N V +V  S DG+  A+  +D  
Sbjct: 182 VTVISAG-MDKVVKVW--DLQSFTIEADFI----GHNNYVTTVTPSPDGSIFASAGKDGQ 234

Query: 128 VWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQD----DD 183
           + +W  +E +  +  ++       +V  + +  +R  L +++    ++I+  ++    DD
Sbjct: 235 IILWNLNEKTALYTLDA-----KDEVFAVAFSPNRYWLTAATASG-IKIFDLEERTIVDD 288

Query: 184 WECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLT 227
            +                   +  G  L +G  D  +R+W+ +T
Sbjct: 289 LKPEFAGYNKAQDPHAVSLAWSADGQTLFAGYTDNIIRVWQVMT 332

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 64.3 bits (155), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 94/205 (45%), Gaps = 13/205 (6%)

Query: 24  KGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIW 83
           K  +  GS D +I++ +    + V  +D  AH   +RS+A  P    + +GS D TV +W
Sbjct: 67  KNWIIVGSDDFRIRVFNYNTGEKV--VDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLW 124

Query: 84  GRDDDDYSGETELLAVIEGHENEVKSVAWS-HDGAYLATCSRDKSVWIWEADELSEEFEC 142
                ++     L    EGHE+ V  VA++  D +  A+   D++V +W   + +  F  
Sbjct: 125 -----NWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTL 179

Query: 143 NSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDF 202
            +  QE   +         +  + ++S D T++IW  Q     C A L GH   V  + F
Sbjct: 180 -TTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTK--SCVATLEGHMSNVSFAVF 236

Query: 203 ERAETGIRLCSGSDDTTVRIWRCLT 227
               T   + SGS+D T++IW   T
Sbjct: 237 H--PTLPIIISGSEDGTLKIWNSST 259

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 75/165 (45%), Gaps = 13/165 (7%)

Query: 16  RCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPH-CNVLAAG 74
           R  +V  +K  + +GS D  +KL +  N   +E+  +  H+  V  VA+ P   +  A+G
Sbjct: 101 RSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFE-GHEHFVMCVAFNPKDPSTFASG 159

Query: 75  SFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSH--DGAYLATCSRDKSVWIWE 132
             D TV +W          T    +  G E  V  V +    D  Y+ T S D ++ IW+
Sbjct: 160 CLDRTVKVWS-----LGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWD 214

Query: 133 ADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
               S    C + L+ H  +V   V+H +  ++ S S D T++IW
Sbjct: 215 YQTKS----CVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIW 255

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 63.9 bits (154), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 76/296 (25%), Positives = 122/296 (41%), Gaps = 59/296 (19%)

Query: 8   RSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPH 67
           + +  H  R W       L+A  S+   I+L D R   L+   +D  H+  VR + + P 
Sbjct: 15  KGIAFHPSRPWV------LVALFSS--TIQLWDYRMGTLLHRFED--HEGPVRGLDFHPT 64

Query: 68  CNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKS 127
             +  +   D T+ +W  D +      + L  + GH + V++V +  +  ++ + S D++
Sbjct: 65  QPIFVSAGDDYTIKVWSLDTN------KCLYTLTGHLDYVRTVFFHRELPWIISASDDQT 118

Query: 128 VWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW---------- 177
           + IW      +E  C   L  H+  V    +H +  L+ S+S D+T+RIW          
Sbjct: 119 IRIWNWQN-RKEIAC---LTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDISGLRKRHS 174

Query: 178 ------------AEQD------DDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTT 219
                       A+Q+       D     +L GH   V  + F    T   + SGSDD  
Sbjct: 175 APGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFH--PTLPLIVSGSDDRQ 232

Query: 220 VRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSA-DGLIASVGSDGVLAVY 274
           V++WR          K W  +T     HT  V SV +     LI SVG D  L V+
Sbjct: 233 VKLWRMSA------TKAWEVDTCRG--HTNNVDSVIFHPHQNLIISVGEDKTLRVW 280

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 85/199 (42%), Gaps = 36/199 (18%)

Query: 3   NLHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSV 62
           +L  VR++  H +  W        + + S D+ I++ + +N K +  L  T H   V   
Sbjct: 94  HLDYVRTVFFHRELPW--------IISASDDQTIRIWNWQNRKEIACL--TGHNHFVMCA 143

Query: 63  AWRPHCNVLAAGSFDTTVSIW--------------GRDDDDYSGETELLA---------- 98
            + P  +++ + S D T+ IW                 ++  S +  LL           
Sbjct: 144 QFHPTDDLIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKF 203

Query: 99  VIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVW 158
           ++EGH   V   ++      + + S D+ V +W     ++ +E ++  + H+ +V  +++
Sbjct: 204 ILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSA-TKAWEVDTC-RGHTNNVDSVIF 261

Query: 159 HASRLLLASSSYDDTVRIW 177
           H  + L+ S   D T+R+W
Sbjct: 262 HPHQNLIISVGEDKTLRVW 280

 Score = 35.8 bits (81), Expect = 0.050,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 31/61 (50%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGR 85
           L+ +GS DR++KL  +   K  E      H   V SV + PH N++ +   D T+ +W  
Sbjct: 223 LIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTLRVWDL 282

Query: 86  D 86
           D
Sbjct: 283 D 283

 Score = 32.7 bits (73), Expect = 0.40,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 37/82 (45%), Gaps = 4/82 (4%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
            H + V   ++ P   ++ +GS D  V +W R     + E +      GH N V SV + 
Sbjct: 207 GHTRGVNWASFHPTLPLIVSGSDDRQVKLW-RMSATKAWEVD---TCRGHTNNVDSVIFH 262

Query: 114 HDGAYLATCSRDKSVWIWEADE 135
                + +   DK++ +W+ D+
Sbjct: 263 PHQNLIISVGEDKTLRVWDLDK 284

 Score = 29.3 bits (64), Expect = 6.2,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 36/86 (41%), Gaps = 10/86 (11%)

Query: 146 LQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVL---SGHGGTVWCSDF 202
            +  S   K I +H SR  +  + +  T+++W     D+    +L     H G V   DF
Sbjct: 7   FESKSTRAKGIAFHPSRPWVLVALFSSTIQLW-----DYRMGTLLHRFEDHEGPVRGLDF 61

Query: 203 ERAETGIRLCSGSDDTTVRIWRCLTD 228
               T     S  DD T+++W   T+
Sbjct: 62  H--PTQPIFVSAGDDYTIKVWSLDTN 85

>Scas_673.11
          Length = 434

 Score = 63.2 bits (152), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 103/244 (42%), Gaps = 33/244 (13%)

Query: 55  HKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSH 114
           H  +V ++A  P   ++  G  D    +W      +S   +    +EGH   V + A++H
Sbjct: 68  HTDSVFTIAHHPTLPLVVTGGGDNVAHLW----TSHSQPPKFAGTLEGHTESVVASAFTH 123

Query: 115 DGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLL----ASSSY 170
           DG +L T      + + ++++   ++   S LQE    V+ +VW     ++    A  + 
Sbjct: 124 DGQFLVTADMTGKIMVHKSNKSGSQWSLTSTLQE----VEEVVWLKCHPVISGVFAFGAT 179

Query: 171 DDTVRIWAEQDDDWECAAVLSGHGGTVWCS-----DFERAETGIRLCSGSDDTTVRIWRC 225
           D +V  +   D+D     ++SG      C+     + ++ E  + L + S D+++  W C
Sbjct: 180 DGSVWCYQINDNDGSVEQLMSGFIHQQDCTMGEFINIDQGENVLELVTCSVDSSIVGWNC 239

Query: 226 LT---------DDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKE 276
            T         D+    +  W+   V P+  T           G+IA+  ++GVLA+   
Sbjct: 240 FTAQPTFKITKDEIKGLEAPWVSLAVAPSKMTNG-------NSGIIAAGANNGVLAIINC 292

Query: 277 VQAG 280
             AG
Sbjct: 293 NNAG 296

 Score = 28.5 bits (62), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 26/62 (41%), Gaps = 2/62 (3%)

Query: 143 NSV--LQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCS 200
           NSV    +H+  V  I  H +  L+ +   D+   +W       + A  L GH  +V  S
Sbjct: 60  NSVAYFDKHTDSVFTIAHHPTLPLVVTGGGDNVAHLWTSHSQPPKFAGTLEGHTESVVAS 119

Query: 201 DF 202
            F
Sbjct: 120 AF 121

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 63.9 bits (154), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 49/164 (29%), Positives = 74/164 (45%), Gaps = 14/164 (8%)

Query: 60  RSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYL 119
           + +A+ P         F +T+ +W     DY   T LL   EGHE  V++V +       
Sbjct: 15  KGIAFHPSRPWALVALFSSTIQLW-----DYRMGT-LLHRFEGHEGPVRAVDFHPTQPIF 68

Query: 120 ATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAE 179
            +   D S+ +W      E   C   L  H   V+ + +H+    + S+S D TVRIW  
Sbjct: 69  VSAGDDASIKVWSL----ETNRCLYTLTGHLDYVRTVFFHSELPWVISASDDQTVRIWNW 124

Query: 180 QDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           Q+   +  A L+GH   V C+ F + E  +   S S D TVR+W
Sbjct: 125 QNR--KELACLTGHNHFVMCAQFHQTEDLV--VSASLDETVRVW 164

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 71/296 (23%), Positives = 122/296 (41%), Gaps = 59/296 (19%)

Query: 8   RSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPH 67
           + +  H  R W+      L+A  S+   I+L D R   L+   +   H+  VR+V + P 
Sbjct: 15  KGIAFHPSRPWA------LVALFSS--TIQLWDYRMGTLLHRFE--GHEGPVRAVDFHPT 64

Query: 68  CNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKS 127
             +  +   D ++ +W  + +        L  + GH + V++V +  +  ++ + S D++
Sbjct: 65  QPIFVSAGDDASIKVWSLETN------RCLYTLTGHLDYVRTVFFHSELPWVISASDDQT 118

Query: 128 VWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW---------- 177
           V IW      +E  C   L  H+  V    +H +  L+ S+S D+TVR+W          
Sbjct: 119 VRIWNWQN-RKELAC---LTGHNHFVMCAQFHQTEDLVVSASLDETVRVWDISGLRKKHS 174

Query: 178 -----------AEQDD-------DWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTT 219
                      A Q +       D +   +L GH   V  + F    T   + +G DD  
Sbjct: 175 APGVTSYEDSLASQQNLLDGAFGDCKVKFILEGHTRGVNWASFH--PTLPLIVTGGDDRQ 232

Query: 220 VRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSAD-GLIASVGSDGVLAVY 274
           V++WR  +      +K W  +T     HT  V  V +  D  LI SV  D  L ++
Sbjct: 233 VKLWRMSS------NKAWEVDTCRG--HTNNVDCVVFHPDQNLILSVAEDKTLRIW 280

 Score = 34.3 bits (77), Expect = 0.14,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 37/82 (45%), Gaps = 4/82 (4%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
            H + V   ++ P   ++  G  D  V +W R   + + E +      GH N V  V + 
Sbjct: 207 GHTRGVNWASFHPTLPLIVTGGDDRQVKLW-RMSSNKAWEVD---TCRGHTNNVDCVVFH 262

Query: 114 HDGAYLATCSRDKSVWIWEADE 135
            D   + + + DK++ IW+ D+
Sbjct: 263 PDQNLILSVAEDKTLRIWDLDK 284

 Score = 32.7 bits (73), Expect = 0.39,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 4/84 (4%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGR 85
           L+ TG  DR++KL  + + K  E      H   V  V + P  N++ + + D T+ IW  
Sbjct: 223 LIVTGGDDRQVKLWRMSSNKAWEVDTCRGHTNNVDCVVFHPDQNLILSVAEDKTLRIWDL 282

Query: 86  DD----DDYSGETELLAVIEGHEN 105
           D       +  E +   +I  H N
Sbjct: 283 DKRTPVKQFKRENDRFWLIRSHPN 306

 Score = 32.3 bits (72), Expect = 0.67,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 37/89 (41%), Gaps = 15/89 (16%)

Query: 146 LQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVL---SGHGGTVWCSDF 202
            +  S   K I +H SR     + +  T+++W     D+    +L    GH G V   DF
Sbjct: 7   FESKSTRAKGIAFHPSRPWALVALFSSTIQLW-----DYRMGTLLHRFEGHEGPVRAVDF 61

Query: 203 ERAETGIRLCSGSDDTTVRIW-----RCL 226
               T     S  DD ++++W     RCL
Sbjct: 62  H--PTQPIFVSAGDDASIKVWSLETNRCL 88

 Score = 29.6 bits (65), Expect = 3.9,   Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 16/26 (61%)

Query: 99  VIEGHENEVKSVAWSHDGAYLATCSR 124
           V + H   VK V+WS DG YLA  S+
Sbjct: 487 VAQMHVKNVKYVSWSQDGQYLAMMSK 512

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 63.5 bits (153), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 78/171 (45%), Gaps = 14/171 (8%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
           AH+K + +++  P+ ++ A  S+D T  +W  D    +GE   +A +  H+  +  V++ 
Sbjct: 493 AHEKDINAISMAPNDSIFATASYDKTCKLWNVD----TGEP--VATLANHKRGLWDVSFC 546

Query: 114 HDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDT 173
               ++ATCS DK+V IW      E F     L+ H+  V+   +   +  L S+  D  
Sbjct: 547 ESEKWIATCSGDKTVKIWSL----ESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGL 602

Query: 174 VRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWR 224
           +++W     D  C   L GH   +W       E G  + S   D+  + W+
Sbjct: 603 IKVWDIASGD--CIKNLDGHSNRIWA--LSVLEDGDLIISADADSVFQFWK 649

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 66/271 (24%), Positives = 105/271 (38%), Gaps = 82/271 (30%)

Query: 68  CNVLAAGSFDTTVSIWGRDDDDYSGETEL---LAVIEGHENEVKSVAWSHDGAYLATCSR 124
           C  LA  S    +    + D D + +T+L   + + EGH + + S+A + DG +LAT S+
Sbjct: 352 CIALATNSPSLRIIPLPKIDAD-TQDTDLPIEVNLYEGHSDLLNSLACTEDGQWLATASK 410

Query: 125 DKSVWIWEADELSEEFECNSVLQEHSQDV--------------KHIVWHASRL------- 163
           DK+  +W  +  S+ F   +    H+  V              K+I+  ++ L       
Sbjct: 411 DKTAILWHWNNTSKRFYIYATFVGHAASVSAVCLPNVMEKNYPKYIITASNDLTVKKWEI 470

Query: 164 ------------LLASSSY--------------------------DDTVRIWAEQDDDWE 185
                       ++ SS Y                          D T ++W    D  E
Sbjct: 471 PPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPNDSIFATASYDKTCKLW--NVDTGE 528

Query: 186 CAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPA 245
             A L+ H   +W   F  +E  I  CSG  D TV+IW       + F       TVL  
Sbjct: 529 PVATLANHKRGLWDVSFCESEKWIATCSG--DKTVKIWSL-----ESF-------TVLKT 574

Query: 246 V--HTRAVYSVSW-SADGLIASVGSDGVLAV 273
           +  HT AV   S+ +    + S G+DG++ V
Sbjct: 575 LEGHTNAVQRCSFMNKQKQLVSAGADGLIKV 605

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 63.5 bits (153), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 93/206 (45%), Gaps = 15/206 (7%)

Query: 24  KGLLATGSADRKIKLVDVRNFKLVEELDD-TAHKKAVRSVAWRPHCNVLAAGSFDTTVSI 82
           K  +  GS D K++   V N+   E++ D  AH   +RS+A  P    +  GS D TV +
Sbjct: 67  KNWIVVGSDDNKVR---VFNYNTGEKVADFVAHPDYIRSIAVHPSKPYILTGSDDLTVKL 123

Query: 83  WGRDDDDYSGETELLAVIEGHENEVKSVAWS-HDGAYLATCSRDKSVWIWEADELSEEFE 141
           W  ++D       L    +GHE+ V  VA++  D    A+   D  V +W   + +  F 
Sbjct: 124 WNWEND-----WSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFT 178

Query: 142 CNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSD 201
            ++  QE   +         +  + +SS D TV+I+  Q     C A L GH   V  + 
Sbjct: 179 LHTG-QEKGVNYVDYYPLPDKPYMITSSDDTTVKIFDYQTK--SCVATLEGHMSNVSFAV 235

Query: 202 FERAETGIRLCSGSDDTTVRIWRCLT 227
           F    T   + SGS+D TV++W   T
Sbjct: 236 FH--PTLPIIISGSEDGTVKLWNSST 259

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 54/129 (41%), Gaps = 17/129 (13%)

Query: 25  GLLATGSADRKIKL----VDVRNFKLVEELDDTAHKKAVRSVAWRPHCN--VLAAGSFDT 78
            + A+G  D K+K+        NF L      T  +K V  V + P  +   +   S DT
Sbjct: 154 NVFASGCLDHKVKVWSLGQSTPNFTL-----HTGQEKGVNYVDYYPLPDKPYMITSSDDT 208

Query: 79  TVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSE 138
           TV I+     DY  ++  +A +EGH + V    +      + + S D +V +W +     
Sbjct: 209 TVKIF-----DYQTKS-CVATLEGHMSNVSFAVFHPTLPIIISGSEDGTVKLWNSSTYKL 262

Query: 139 EFECNSVLQ 147
           E   N  L+
Sbjct: 263 EKTLNLGLE 271

>Scas_720.95
          Length = 515

 Score = 63.2 bits (152), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 74/154 (48%), Gaps = 13/154 (8%)

Query: 70  VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVW 129
           ++   S D T+ +W     +     + +A + GH+  V  VA+S DG Y+ + S D S+ 
Sbjct: 373 LMVTASDDFTMFLW-----NPLKSNKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIK 427

Query: 130 IWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAV 189
           +W+      + +  S  + H   V  + W A   LL S S D T+++W  +    + +  
Sbjct: 428 LWDG----RDGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTR--KLSVD 481

Query: 190 LSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           L GH   V+  D+  +  G R+CSG  D  VRIW
Sbjct: 482 LPGHKDEVYTVDW--SVDGKRVCSGGKDKMVRIW 513

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 70/154 (45%), Gaps = 15/154 (9%)

Query: 26  LLATGSADRKIKL-VDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIW- 83
           L+ T S D  + L   +++ K +  +  T H+K V  VA+ P    + + SFD ++ +W 
Sbjct: 373 LMVTASDDFTMFLWNPLKSNKPIARM--TGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD 430

Query: 84  GRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECN 143
           GRD        + ++   GH   V  VAWS D   L +CS+D ++ +W+        +  
Sbjct: 431 GRDG-------KFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTRKLSVD-- 481

Query: 144 SVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
             L  H  +V  + W      + S   D  VRIW
Sbjct: 482 --LPGHKDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 90/349 (25%), Positives = 146/349 (41%), Gaps = 88/349 (25%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDT--AHKKAVRSVAWRP-------HCNVLAAGSF 76
           ++ATGS D  I+L D ++ K    L D    H K + S+AW P           LA+ S 
Sbjct: 200 VIATGSMDNTIRLWDSKDGK---PLGDALRGHLKWITSLAWEPIHLVKPGESPRLASASK 256

Query: 77  DTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADEL 136
           D T+ IW     D +     L  + GH N V  + WS  G  + + S DK+V +W+   +
Sbjct: 257 DGTIRIW-----DITRRV-CLYTMSGHTNSVSCIKWSGQG-IIYSGSHDKTVRVWD---M 306

Query: 137 SEEFECNSVLQEHSQDVKHIVW---HASRL------------------------------ 163
           + + +C ++L+ H+  V H+     +A R+                              
Sbjct: 307 NADGKCINILKSHAHWVNHLSLSTDYALRVGAFDHTGAQPASAKDARDKALANYEKVVKK 366

Query: 164 ------LLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDD 217
                 L+ ++S D T+ +W     + +  A ++GH   V    F  +  G  + S S D
Sbjct: 367 NGKLEELMVTASDDFTMFLWNPLKSN-KPIARMTGHQKLVNHVAF--SPDGRYIVSASFD 423

Query: 218 TTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSAD-GLIASVGSDGVLAVYKE 276
            ++++W       D  D ++I        H  +VY V+WSAD  L+ S   D  L V   
Sbjct: 424 NSIKLW-------DGRDGKFISTF---RGHVASVYQVAWSADCRLLVSCSKDTTLKV--- 470

Query: 277 VQAGRWEVVAR---VDCAHTVYEINVVKWLALDGRVLLVTGGDDGCVNV 322
                W+V  R   VD      E+  V W ++DG+  + +GG D  V +
Sbjct: 471 -----WDVRTRKLSVDLPGHKDEVYTVDW-SVDGK-RVCSGGKDKMVRI 512

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 78/174 (44%), Gaps = 20/174 (11%)

Query: 27  LATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRD 86
           + TG+ D   ++ D         L  T H   V  V++ P+  V+A GS D T+ +W   
Sbjct: 159 MVTGAGDNTARIWDCDTQTPKATL--TGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSK 216

Query: 87  DDDYSGETELLAVIEGHENEVKSVAWSH-------DGAYLATCSRDKSVWIWEADELSEE 139
           D    G+      + GH   + S+AW         +   LA+ S+D ++ IW+       
Sbjct: 217 DGKPLGD-----ALRGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDI----TR 267

Query: 140 FECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGH 193
             C   +  H+  V  I W + + ++ S S+D TVR+W + + D +C  +L  H
Sbjct: 268 RVCLYTMSGHTNSVSCIKW-SGQGIIYSGSHDKTVRVW-DMNADGKCINILKSH 319

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 79/185 (42%), Gaps = 25/185 (13%)

Query: 98  AVIEGHENEVKSVAWSHD-GAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHI 156
           + I GH + +   A++ +  + + T + D +  IW+ D  + +    + L  H   V  +
Sbjct: 137 SAIAGHGSTILCSAFAPNTSSRMVTGAGDNTARIWDCDTQTPK----ATLTGHFNWVLCV 192

Query: 157 VWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFE-------RAETGI 209
            +  +  ++A+ S D+T+R+W  +D        L GH    W +          +     
Sbjct: 193 SYCPNGEVIATGSMDNTIRLWDSKDGK-PLGDALRGH--LKWITSLAWEPIHLVKPGESP 249

Query: 210 RLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDG 269
           RL S S D T+RIW       D+  +  +      + HT +V  + WS  G+I S   D 
Sbjct: 250 RLASASKDGTIRIW-------DITRRVCLYTM---SGHTNSVSCIKWSGQGIIYSGSHDK 299

Query: 270 VLAVY 274
            + V+
Sbjct: 300 TVRVW 304

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 11/81 (13%)

Query: 187 AAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAV 246
           ++ ++GHG T+ CS F    T  R+ +G+ D T RIW C        D +  + T+    
Sbjct: 136 SSAIAGHGSTILCSAFA-PNTSSRMVTGAGDNTARIWDC--------DTQTPKATL--TG 184

Query: 247 HTRAVYSVSWSADGLIASVGS 267
           H   V  VS+  +G + + GS
Sbjct: 185 HFNWVLCVSYCPNGEVIATGS 205

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 70/159 (44%), Gaps = 15/159 (9%)

Query: 165 LASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWR 224
           + + + D+T RIW    D     A L+GH   V C  +     G  + +GS D T+R+W 
Sbjct: 159 MVTGAGDNTARIW--DCDTQTPKATLTGHFNWVLCVSY--CPNGEVIATGSMDNTIRLW- 213

Query: 225 CLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQAGRWEV 284
                 D  D + + + +    H + + S++W    L+    S  + +  K+     W++
Sbjct: 214 ------DSKDGKPLGDAL--RGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDI 265

Query: 285 VARVDCAHTVY-EINVVKWLALDGRVLLVTGGDDGCVNV 322
             RV C +T+    N V  +   G+ ++ +G  D  V V
Sbjct: 266 TRRV-CLYTMSGHTNSVSCIKWSGQGIIYSGSHDKTVRV 303

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 31/66 (46%), Gaps = 4/66 (6%)

Query: 18  WSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFD 77
           WS D    LL + S D  +K+ DVR  KL   +D   HK  V +V W      + +G  D
Sbjct: 452 WSADCR--LLVSCSKDTTLKVWDVRTRKL--SVDLPGHKDEVYTVDWSVDGKRVCSGGKD 507

Query: 78  TTVSIW 83
             V IW
Sbjct: 508 KMVRIW 513

>Scas_630.6
          Length = 621

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 81/165 (49%), Gaps = 19/165 (11%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDD-----TAHKKAVRSVAWRPHCNVLAAGSFDTTV 80
           L+A GS DR +++ D     LVE LD        H+ +V SVA+      + +GS D TV
Sbjct: 439 LIAAGSLDRSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTV 498

Query: 81  SIWGRDDDDY-SGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEE 139
            +W   D    +G+ E+  +  GH++ V SVA S+D  Y+ + S+D+ V IW+ D  +  
Sbjct: 499 KLWNLGDTQSGTGKCEVTYI--GHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPI 556

Query: 140 FECNSVLQEHSQDVKHIVWHASRL-------LLASSSYDDTVRIW 177
                +LQ H + V  +    S +       L A+ S D   RIW
Sbjct: 557 L----MLQGHRKSVISVATVNSNVDDGKNYKLFATGSGDCKARIW 597

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/225 (27%), Positives = 99/225 (44%), Gaps = 43/225 (19%)

Query: 27  LATGSADRKIKLVDVRNFKL-VEELDDTAHKKA------------------VRSVAWRPH 67
           LATG  +R  ++ DV   +L V+ LDDT +                     +RS+ + P 
Sbjct: 294 LATG-CNRTTQIFDVATGELYVKLLDDTVNTAIVTTTTENNETVTTTADLYIRSICFSPD 352

Query: 68  CNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKS 127
              LA G+ D  + IW         E +++ V++GHE ++ S+ +  DG  L + S D+S
Sbjct: 353 GEFLATGAEDKLIRIWNIK------ERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRS 406

Query: 128 VWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQ------- 180
           + IW+     +  +C+  L          V      L+A+ S D +VRIW          
Sbjct: 407 IRIWDL----KTGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVER 462

Query: 181 -DDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWR 224
            D D E     +GH  +V+   F +   G  + SGS D TV++W 
Sbjct: 463 LDSDNESG---NGHQDSVYSVAFTK--DGQHVVSGSLDRTVKLWN 502

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 62/137 (45%), Gaps = 20/137 (14%)

Query: 103 HENEVKSVAWSHDGAYLAT-CSRDKSVWIWEADELSEEF---ECNSVLQEHSQD------ 152
           H++ V  V +S DG YLAT C+R   ++     EL  +      N+ +   + +      
Sbjct: 278 HDSVVCCVKFSQDGKYLATGCNRTTQIFDVATGELYVKLLDDTVNTAIVTTTTENNETVT 337

Query: 153 ------VKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAE 206
                 ++ I +      LA+ + D  +RIW  +  + +   VL GH   ++  D+    
Sbjct: 338 TTADLYIRSICFSPDGEFLATGAEDKLIRIWNIK--ERKIVMVLKGHEQDIYSLDY--FP 393

Query: 207 TGIRLCSGSDDTTVRIW 223
            G +L SGS D ++RIW
Sbjct: 394 DGQKLVSGSGDRSIRIW 410

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/173 (30%), Positives = 80/173 (46%), Gaps = 19/173 (10%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
            H KAV ++A++    +LA+   D   +IW    D  SGE   +  +EGH   +  V WS
Sbjct: 296 GHSKAVYTIAFQSDGALLASAGLDAVCAIW----DLRSGEP--IMKLEGHAGAISGVDWS 349

Query: 114 HDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEH---SQDVKHIVWHASRLLLASSSY 170
            +G  LAT   D +V +W+   +  E    S L  H   + DVK    + +   L S  +
Sbjct: 350 PNGYQLATAGADGTVRVWDIRNVGTE----SALLAHQVAALDVKFKKNNGT--FLVSCGH 403

Query: 171 DDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           D  V I+    D+W+  A L GH   V+  D    E G  + SG  D +++ W
Sbjct: 404 DRLVNIF--NADNWQKLASLEGHTDRVFTVDI--TEDGSTIYSGGKDRSLKQW 452

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 84/198 (42%), Gaps = 18/198 (9%)

Query: 27  LATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRD 86
           LATG     IK+V      + + +D  AH+  +  + W P  N L +G  D  V +W   
Sbjct: 187 LATGCWGGSIKVVSCETLGIAKSID-AAHEGKIGGLDWHPDGNHLLSGGGDNLVKLWDMT 245

Query: 87  DDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVL 146
            + +         + GH   V  V     G   A+ S D +  +W   +L  + E    L
Sbjct: 246 SNSFE-------ELRGHAGRVSRVKVHPSGRLAASASFDLTWILW---DLERKVELQ--L 293

Query: 147 QE-HSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERA 205
           QE HS+ V  I + +   LLAS+  D    IW  +    E    L GH G +   D+  +
Sbjct: 294 QEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSG--EPIMKLEGHAGAISGVDW--S 349

Query: 206 ETGIRLCSGSDDTTVRIW 223
             G +L +   D TVR+W
Sbjct: 350 PNGYQLATAGADGTVRVW 367

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 71/154 (46%), Gaps = 15/154 (9%)

Query: 26  LLATGSADRKIKL-VDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIW- 83
           L+ TGS D  + L   ++  K +  +  T H+K V  VA+ P    + + SFD ++ +W 
Sbjct: 371 LMVTGSDDFTMYLWNPLKGSKPILRM--TGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD 428

Query: 84  GRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECN 143
           GRD        + +A   GH   V  VAWS D   L +CS+D ++ +W+        +  
Sbjct: 429 GRDG-------KFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLTVD-- 479

Query: 144 SVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
             L  H+ +V  + W      + S   D  VR+W
Sbjct: 480 --LPGHNDEVYTVDWSVDGKRVCSGGKDKMVRLW 511

 Score = 61.2 bits (147), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 81/178 (45%), Gaps = 22/178 (12%)

Query: 54  AHKKAVRSVAWRPHCNV-LAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAW 112
            H   +   A+ PH +  +  G+ D T  IW     D   +T L   ++GH N V  VAW
Sbjct: 139 GHGATILCSAFAPHTSSRMVTGAGDNTARIW-----DCDTQTPL-CTLKGHSNWVLCVAW 192

Query: 113 SHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQ-------DVKHIVWHASRLLL 165
           S DG  +AT S D ++ +W++++          L+ H++       +  H+V    +  L
Sbjct: 193 SADGEVIATGSMDATIRLWDSEKGQ---SLGDALRGHTKWITSLSWEPIHLVKPGEKPRL 249

Query: 166 ASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           AS+S D T++IW        C   LSGH  +V C  +        L S S D TVR W
Sbjct: 250 ASASKDGTIKIWDTTRR--VCIYTLSGHTSSVSCIKWGGRNV---LYSASHDRTVRCW 302

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 117/299 (39%), Gaps = 81/299 (27%)

Query: 24  KGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIW 83
           K  LA+ S D  IK+ D      +  L  + H  +V  + W    NVL + S D TV  W
Sbjct: 246 KPRLASASKDGTIKIWDTTRRVCIYTL--SGHTSSVSCIKWGGR-NVLYSASHDRTVRCW 302

Query: 84  GRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAY------------------------- 118
                D +   + + +++ H + V  ++ S D A                          
Sbjct: 303 -----DMAAGGKCINILKSHAHWVNHLSLSTDYALRMGPFDHTGTKPASPEDAQARALRN 357

Query: 119 --------------LATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLL 164
                         + T S D ++++W   + S+       +  H + V H+ +      
Sbjct: 358 YEKVAKKNGTMEELMVTGSDDFTMYLWNPLKGSKPIL---RMTGHQKLVNHVAFSPDGRY 414

Query: 165 LASSSYDDTVRIWAEQDDDWECAAVLSGHGGTV----WCSDFERAETGIRLCSGSDDTTV 220
           + S+S+D+++++W  +D  +   A   GH  +V    W SD         L S S DTT+
Sbjct: 415 IVSASFDNSIKLWDGRDGKF--IATFRGHVASVYQVAWSSDCR------LLVSCSKDTTL 466

Query: 221 RIW----RCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADG-LIASVGSDGVLAVY 274
           ++W    R LT D             LP  H   VY+V WS DG  + S G D ++ ++
Sbjct: 467 KVWDVKTRKLTVD-------------LPG-HNDEVYTVDWSVDGKRVCSGGKDKMVRLW 511

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 40/81 (49%), Gaps = 11/81 (13%)

Query: 187 AAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAV 246
           ++ ++GHG T+ CS F    T  R+ +G+ D T RIW C T       K           
Sbjct: 134 SSAIAGHGATILCSAFA-PHTSSRMVTGAGDNTARIWDCDTQTPLCTLKG---------- 182

Query: 247 HTRAVYSVSWSADGLIASVGS 267
           H+  V  V+WSADG + + GS
Sbjct: 183 HSNWVLCVAWSADGEVIATGS 203

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 116/275 (42%), Gaps = 37/275 (13%)

Query: 61  SVAWRPHCNVLAAGSFDTTVSIWGRD-----DDDYSG-------ETELLAVIEGHENEVK 108
           S+ +   C + AAG  D+ + IW  D     +  YS        +    + + GH   V 
Sbjct: 478 SLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSGTVY 537

Query: 109 SVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASS 168
           S ++S D  YL + S DK+V +W  D  +         + H+  V  + +       AS+
Sbjct: 538 STSFSPDNMYLVSGSEDKTVKLWSMDTHTALVN----YKGHNHPVWDVKFSPLGHYFASA 593

Query: 169 SYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTD 228
           S+D T R+WA   D      + +GH   V    F     G  + +GS D T R+W   T 
Sbjct: 594 SHDQTARLWAC--DHIYPLRIFAGHTNDVDTVSFH--PNGCYVFTGSSDKTCRMWDVSTG 649

Query: 229 DADVFDKEWIQETVLPAVHTRAVYSVSWSADGL-IASVGSDGVLAVYKEVQAGRWEVVAR 287
           D+            L   HT  V S   S DG  +A+   DGV+ ++ ++  G+     R
Sbjct: 650 DS----------VRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLW-DIGTGKRIKQMR 698

Query: 288 VDCAHTVYEINVVKWLALDGRVLLVTGGDDGCVNV 322
               + V+ ++  K    +G V L++GG D  V V
Sbjct: 699 GHGKNAVHSLSFNK----EGNV-LISGGADHSVRV 728

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 95/216 (43%), Gaps = 24/216 (11%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
            H   V S ++ P    L +GS D TV +W  D          L   +GH + V  V +S
Sbjct: 531 GHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMD------THTALVNYKGHNHPVWDVKFS 584

Query: 114 HDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDT 173
             G Y A+ S D++  +W  D +        +   H+ DV  + +H +   + + S D T
Sbjct: 585 PLGHYFASASHDQTARLWACDHIYPL----RIFAGHTNDVDTVSFHPNGCYVFTGSSDKT 640

Query: 174 VRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVF 233
            R+W     D     +  GH   V  +  + +  G  L +GS+D  + +W       D+ 
Sbjct: 641 CRMWDVSTGD--SVRLFLGHTAPVLST--QVSPDGRWLATGSEDGVICLW-------DIG 689

Query: 234 DKEWIQETVLPAVHTRAVYSVSWSADG-LIASVGSD 268
             + I++  +      AV+S+S++ +G ++ S G+D
Sbjct: 690 TGKRIKQ--MRGHGKNAVHSLSFNKEGNVLISGGAD 723

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 74/154 (48%), Gaps = 13/154 (8%)

Query: 70  VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVW 129
           ++   S D T+ +W     +    T+ +  + GH+  V  VA+S DG Y+ + S D S+ 
Sbjct: 373 LMVTASDDFTMYLW-----NPLKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIK 427

Query: 130 IWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAV 189
           +W+      + +  S  + H   V  + W +   LL S S D T+++W  +    + +  
Sbjct: 428 LWDG----RDGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTR--KLSVD 481

Query: 190 LSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           L GH   V+  D+  +  G R+CSG  D  VRIW
Sbjct: 482 LPGHQDEVYTVDW--SVDGKRVCSGGKDKMVRIW 513

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 70/155 (45%), Gaps = 15/155 (9%)

Query: 26  LLATGSADRKIKL-VDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIW- 83
           L+ T S D  + L   +++ K +  +  T H+K V  VA+ P    + + SFD ++ +W 
Sbjct: 373 LMVTASDDFTMYLWNPLKSTKPITRM--TGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD 430

Query: 84  GRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECN 143
           GRD        + L+   GH   V  VAWS D   L +CS+D ++ +W+        +  
Sbjct: 431 GRDG-------KFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVD-- 481

Query: 144 SVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWA 178
             L  H  +V  + W      + S   D  VRIW 
Sbjct: 482 --LPGHQDEVYTVDWSVDGKRVCSGGKDKMVRIWT 514

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 80/178 (44%), Gaps = 22/178 (12%)

Query: 54  AHKKAVRSVAWRPHCNV-LAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAW 112
            H   +   A+ P+ +  +  G+ D T  IW     D   +T +   ++GH N V   +W
Sbjct: 141 GHGSTILCSAFAPNTSSRMVTGAGDNTACIW-----DCDTQTRM-CTLQGHHNWVLCCSW 194

Query: 113 SHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLL-------L 165
           S DG  +AT S D ++ +WE+   S+       L+ HS+ +  + W    L+       L
Sbjct: 195 SPDGELIATGSMDNTIRLWES---SKGKPYGDALRGHSKWITSLSWEPIHLVKPGDKPRL 251

Query: 166 ASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           A++S D T++IW        C   L GH  +V C  +        L SGS D T+R W
Sbjct: 252 ATASKDGTIKIWDTTRR--VCLLTLCGHTSSVSCVKWGGKNV---LYSGSHDKTIRCW 304

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 119/295 (40%), Gaps = 73/295 (24%)

Query: 24  KGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIW 83
           K  LAT S D  IK+ D    + V  L    H  +V  V W    NVL +GS D T+  W
Sbjct: 248 KPRLATASKDGTIKIWDTT--RRVCLLTLCGHTSSVSCVKWGGK-NVLYSGSHDKTIRCW 304

Query: 84  GRDDDDYSGETELLAVIEGHENEVKSVAWSHD-----GAY-------------------- 118
                D +   + + +++ H + V  ++ S D     GA+                    
Sbjct: 305 -----DMNLNGKCINILKSHAHWVNHLSLSTDYALRLGAFDHKGETPASPEEAQQKALKN 359

Query: 119 --------------LATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLL 164
                         + T S D ++++W   + ++     + +  H + V H+ +      
Sbjct: 360 YEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPI---TRMTGHQKLVNHVAFSPDGRY 416

Query: 165 LASSSYDDTVRIWAEQDDDWECAAVLSGHGGTV----WCSDFERAETGIRLCSGSDDTTV 220
           + S+S+D+++++W  +D  +   +   GH  +V    W SD         L S S DTT+
Sbjct: 417 IVSASFDNSIKLWDGRDGKF--LSTFRGHVASVYQVAWSSDCRL------LVSCSKDTTL 468

Query: 221 RIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADG-LIASVGSDGVLAVY 274
           ++W   T    V          LP  H   VY+V WS DG  + S G D ++ ++
Sbjct: 469 KVWDVKTRKLSV---------DLPG-HQDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 35/81 (43%), Gaps = 11/81 (13%)

Query: 187 AAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAV 246
           ++ ++GHG T+ CS F    T  R+ +G+ D T  IW C T                   
Sbjct: 136 SSAIAGHGSTILCSAFA-PNTSSRMVTGAGDNTACIWDCDTQ----------TRMCTLQG 184

Query: 247 HTRAVYSVSWSADGLIASVGS 267
           H   V   SWS DG + + GS
Sbjct: 185 HHNWVLCCSWSPDGELIATGS 205

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 80/187 (42%), Gaps = 14/187 (7%)

Query: 37  KLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETEL 96
           K +++ +     E    AH+K + +++  P+ ++ A  S+D T  IW  D    +GE E 
Sbjct: 469 KAIELPHIVKASEYTRRAHEKDINAISMSPNDSIFATASYDKTCKIWNVD----TGEVE- 523

Query: 97  LAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHI 156
            A +  H+  +  VA+      LATCS D+S+ +W      E F     L+ H+  V+ +
Sbjct: 524 -ATLANHKRGLWGVAFCEYDWLLATCSGDRSINLWSL----ESFTVLKTLEGHTNAVQRV 578

Query: 157 VWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSD 216
            +      L S+  D  V+IW       EC   L  H   +W      A  G  + +   
Sbjct: 579 SFINGNKQLVSTGADGLVKIW--DCSTGECVRTLDAHNNRIWA--LAVANDGQLIITADA 634

Query: 217 DTTVRIW 223
           D   + W
Sbjct: 635 DGVFQFW 641

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 76/160 (47%), Gaps = 19/160 (11%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGR 85
           LLAT S DR I L  + +F +++ L+   H  AV+ V++      L +   D  V IW  
Sbjct: 544 LLATCSGDRSINLWSLESFTVLKTLE--GHTNAVQRVSFINGNKQLVSTGADGLVKIW-- 599

Query: 86  DDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECN-- 143
             D  +GE   +  ++ H N + ++A ++DG  + T   D     WE D   EE E N  
Sbjct: 600 --DCSTGEC--VRTLDAHNNRIWALAVANDGQLIITADADGVFQFWE-DNSEEEHERNIE 654

Query: 144 --SVLQEHSQDVKHIV----WHASRLLLASSSYDDTVRIW 177
              +  E  Q +++ +    W+ + LL  + + D  +R++
Sbjct: 655 QEKLRVEQEQSLQNYISEGDWNNAFLL--AMTLDHPMRLY 692

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 55/123 (44%), Gaps = 15/123 (12%)

Query: 66  PHCNVLAAGSFDTTVSIW-----GRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLA 120
           P  N LA  +   T+ I        D +    ETE+    EGH + + S+  + DG +LA
Sbjct: 342 PSLNRLALATNSPTLRIIPTPQASEDKEVMEIETEMY---EGHTDLLNSLDATSDGLWLA 398

Query: 121 TCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHA------SRLLLASSSYDDTV 174
           T S+D SV +W  +E S  FE  +    H+  V  I             LL +S+ D T+
Sbjct: 399 TASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIALPNVMNRNWPEFLLTASN-DLTI 457

Query: 175 RIW 177
           + W
Sbjct: 458 KRW 460

>YLR222C (UTP13) [3622] chr12 complement(579320..581773) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis,
           overproduction causes chromosome instability and
           increased mitotic recombination, contains WD (WD-40)
           repeats [2454 bp, 817 aa]
          Length = 817

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/215 (27%), Positives = 90/215 (41%), Gaps = 27/215 (12%)

Query: 22  ISKG---LLATGSADRKIKL---------VDVRNFKLVEELDDTAHKKAVRSVAWRPHCN 69
           +SKG    L T S D  IK          +DV+  K V E    AH+K + +++  P+ +
Sbjct: 446 VSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQIIK-VSEYTRHAHEKDINALSVSPNDS 504

Query: 70  VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVW 129
           + A  S+D T  IW  ++    GE E  A +  H+  +  V++      LAT S DK+V 
Sbjct: 505 IFATASYDKTCKIWNLEN----GELE--ATLANHKRGLWDVSFCQYDKLLATSSGDKTVK 558

Query: 130 IWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAV 189
           IW  D     F     L+ H+  V+   +   +  L S   D  ++IW       EC   
Sbjct: 559 IWSLD----TFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIW--DCSSGECLKT 612

Query: 190 LSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWR 224
           L GH   +W         G  + S   D   + W+
Sbjct: 613 LDGHNNRLWA--LSTMNDGDMIVSADADGVFQFWK 645

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 56/121 (46%), Gaps = 11/121 (9%)

Query: 66  PHCNVLAAGSFDTTVSIWGRDDDDYSGETELLA----VIEGHENEVKSVAWSHDGAYLAT 121
           P  N LA  +   ++ I    D   SG    L     + EGHE+ + S+  + DG ++AT
Sbjct: 348 PELNKLALATNSPSLRIIPVPD--LSGPEASLPLDVEIYEGHEDLLNSLDATEDGLWIAT 405

Query: 122 CSRDKSVWIWEADELSEEFECNSVLQEHSQDV-----KHIVWHASRLLLASSSYDDTVRI 176
            S+D +  +W  +E S +F+  +    HS  V      +IV       L ++S D T++ 
Sbjct: 406 ASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKK 465

Query: 177 W 177
           W
Sbjct: 466 W 466

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 61.2 bits (147), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 74/296 (25%), Positives = 122/296 (41%), Gaps = 59/296 (19%)

Query: 8   RSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPH 67
           + +  H  R W       L+A  S+   I+L D R   L+   +D  H+  VR + + P 
Sbjct: 15  KGIAFHPSRPWV------LVALFSS--TIQLWDYRMGVLLHRFED--HEGPVRGIDFHPT 64

Query: 68  CNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKS 127
             +  +   D T+ +W  + +      + L  ++GH + V++V + H+  ++ + S D++
Sbjct: 65  QPLFVSAGDDYTIKVWSLESN------KCLFTLDGHLDYVRTVFFHHELPWIISSSDDQT 118

Query: 128 VWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW---------- 177
           + IW      +E  C   L  H+  V    +H    L+ S+S D+TVR+W          
Sbjct: 119 IRIWNWQN-RKEIAC---LTGHNHFVMCAQFHPVEDLVVSASLDETVRVWDISGLRKRHS 174

Query: 178 -----------AEQDD-------DWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTT 219
                       +Q +       D     +L GH   V  + F    T   + SGSDD  
Sbjct: 175 APGTQSFEEQMRQQQNLLDGGFGDCVVKFILEGHTRGVNWASFH--PTLPLIVSGSDDRQ 232

Query: 220 VRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSW-SADGLIASVGSDGVLAVY 274
           V++WR          K W  +T     HT  V SV +     LI SVG D  + V+
Sbjct: 233 VKLWRMSA------TKAWEVDTCRG--HTNNVDSVIFHPQQNLIISVGEDKTVRVW 280

 Score = 35.0 bits (79), Expect = 0.093,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 4/84 (4%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGR 85
           L+ +GS DR++KL  +   K  E      H   V SV + P  N++ +   D TV +W  
Sbjct: 223 LIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPQQNLIISVGEDKTVRVWDL 282

Query: 86  DD----DDYSGETELLAVIEGHEN 105
           D       +  E +   ++  H N
Sbjct: 283 DKRTPIKQFKRENDRFWLVRAHPN 306

 Score = 34.3 bits (77), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 4/82 (4%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
            H + V   ++ P   ++ +GS D  V +W R     + E +      GH N V SV + 
Sbjct: 207 GHTRGVNWASFHPTLPLIVSGSDDRQVKLW-RMSATKAWEVD---TCRGHTNNVDSVIFH 262

Query: 114 HDGAYLATCSRDKSVWIWEADE 135
                + +   DK+V +W+ D+
Sbjct: 263 PQQNLIISVGEDKTVRVWDLDK 284

 Score = 29.3 bits (64), Expect = 5.7,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 34/81 (41%), Gaps = 10/81 (12%)

Query: 146 LQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVL---SGHGGTVWCSDF 202
            +  S   K I +H SR  +  + +  T+++W     D+    +L     H G V   DF
Sbjct: 7   FESKSTRAKGIAFHPSRPWVLVALFSSTIQLW-----DYRMGVLLHRFEDHEGPVRGIDF 61

Query: 203 ERAETGIRLCSGSDDTTVRIW 223
               T     S  DD T+++W
Sbjct: 62  H--PTQPLFVSAGDDYTIKVW 80

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 61.2 bits (147), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 100/221 (45%), Gaps = 27/221 (12%)

Query: 17  CWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSF 76
           C+S D     LATG+ DR I++ D+ N K+V  L    H++ + S+ + P  + L +GS 
Sbjct: 450 CFSPD--GKFLATGAEDRLIRIWDIENRKIVMILQ--GHEQDIYSLDYFPSGDKLVSGSG 505

Query: 77  DTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSH-DGAYLATCSRDKSVWIWEADE 135
           D TV IW    D  +G+  L   I   E+ V +VA S  DG Y+A  S D++V +W+++ 
Sbjct: 506 DRTVRIW----DLRTGQCSLTLSI---EDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSET 558

Query: 136 --LSEEFEC-NSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQD----------D 182
             L E  +  N     H   V  +V+      + S S D +V++W  Q+          +
Sbjct: 559 GFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPN 618

Query: 183 DWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
              C     GH   V        +    + SGS D  V  W
Sbjct: 619 SGTCEVTYIGHKDFVLS--VATTQNDEYILSGSKDRGVLFW 657

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 86/190 (45%), Gaps = 26/190 (13%)

Query: 45  KLVEELDDTAHKKA---VRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIE 101
           K VE L+ ++   +   +RSV + P    LA G+ D  + IW  ++       +++ +++
Sbjct: 429 KDVENLNTSSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIEN------RKIVMILQ 482

Query: 102 GHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHAS 161
           GHE ++ S+ +   G  L + S D++V IW+        +C+  L          V    
Sbjct: 483 GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL----RTGQCSLTLSIEDGVTTVAVSPGD 538

Query: 162 RLLLASSSYDDTVRIWAEQ--------DDDWECAAVLSGHGGTVWCSDFERAETGIRLCS 213
              +A+ S D  VR+W  +        D + E     +GH  +V+   F R   G  + S
Sbjct: 539 GKYIAAGSLDRAVRVWDSETGFLVERLDSENESG---TGHKDSVYSVVFTR--DGQSVVS 593

Query: 214 GSDDTTVRIW 223
           GS D +V++W
Sbjct: 594 GSLDRSVKLW 603

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 84/185 (45%), Gaps = 28/185 (15%)

Query: 15  DRCWSVDISKG---LLATGSADRKIKLVDVRNFKLVEELDD-----TAHKKAVRSVAWRP 66
           D   +V +S G    +A GS DR +++ D     LVE LD      T HK +V SV +  
Sbjct: 527 DGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTR 586

Query: 67  HCNVLAAGSFDTTVSIWGRDDDDY--------SGETELLAVIEGHENEVKSVAWSHDGAY 118
               + +GS D +V +W   + +         SG  E+  +  GH++ V SVA + +  Y
Sbjct: 587 DGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYI--GHKDFVLSVATTQNDEY 644

Query: 119 LATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHI-VWHASRL-----LLASSSYDD 172
           + + S+D+ V  W+    +       +LQ H   V  + V + S L     + A+ S D 
Sbjct: 645 ILSGSKDRGVLFWDKKSGNPLL----MLQGHRNSVISVAVANGSPLGPEYNVFATGSGDC 700

Query: 173 TVRIW 177
             RIW
Sbjct: 701 KARIW 705

>Scas_721.32
          Length = 822

 Score = 61.2 bits (147), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 115/262 (43%), Gaps = 42/262 (16%)

Query: 26  LLATGSADRKIKL--VDVRNFKLVEEL-----------DDTA-----HKKAVRSVAWRPH 67
           L+A G  D  IKL  +D  + K ++E            D+T+     H  AV S ++ P 
Sbjct: 501 LVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTSTTLIGHSGAVYSTSFSPD 560

Query: 68  CNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKS 127
              L +GS D TV +W    D Y+     L   +GH + V  V +S  G Y AT S D++
Sbjct: 561 NRYLLSGSEDKTVRLWST--DTYTS----LVSYKGHNHPVWDVQFSPLGHYFATASHDQT 614

Query: 128 VWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECA 187
             +W  D +        +   H  DV  + +H +   + + S D T R+W     D    
Sbjct: 615 ARLWSCDHIYPL----RIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGD--SV 668

Query: 188 AVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVH 247
            +  GH   V C+    +  G  L +GS+D  + +W       D+   + ++  V+    
Sbjct: 669 RLFLGHTAPVLCTAV--SPDGRWLATGSEDGIINLW-------DIGTAKRLK--VMRGHG 717

Query: 248 TRAVYSVSWSADG-LIASVGSD 268
             A++S+S+  +G ++ S G+D
Sbjct: 718 KNAIHSLSYCKEGNVLVSGGAD 739

 Score = 57.0 bits (136), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 98/222 (44%), Gaps = 25/222 (11%)

Query: 102 GHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHAS 161
           GH   V S ++S D  YL + S DK+V +W  D  +         + H+  V  + +   
Sbjct: 547 GHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVS----YKGHNHPVWDVQFSPL 602

Query: 162 RLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVR 221
               A++S+D T R+W+   D      + +GH   V C  F     G  + +GS D T R
Sbjct: 603 GHYFATASHDQTARLWS--CDHIYPLRIFAGHLSDVDCVSFH--PNGCYVFTGSSDKTCR 658

Query: 222 IWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGL-IASVGSDGVLAVYKEVQAG 280
           +W   T D+            L   HT  V   + S DG  +A+   DG++ ++    A 
Sbjct: 659 MWDISTGDS----------VRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLWDIGTAK 708

Query: 281 RWEVVARVDCAHTVYEINVVKWLALDGRVLLVTGGDDGCVNV 322
           R +V+ R    + ++ ++  K    +G V LV+GG D  V V
Sbjct: 709 RLKVM-RGHGKNAIHSLSYCK----EGNV-LVSGGADHSVRV 744

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 93/231 (40%), Gaps = 38/231 (16%)

Query: 13  HGDRCWSVDISK--GLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRS--------- 61
           H    WS+D++     L T SAD+ +K  D   FK+ +EL      K V           
Sbjct: 466 HTAAIWSLDLTSDGKRLVTASADKTVKFWD---FKVEQELVAGTLDKFVPKMKLIHDTTL 522

Query: 62  --------VAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
                   V   P    LA    D TV ++  D        +    + GH+  V S+  S
Sbjct: 523 DLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDS------MKFFLSLYGHKLPVLSMDIS 576

Query: 114 HDGAYLATCSRDKSVWIWEADELSEEF-ECNSVLQEHSQDVKHIVWHASRLLLASSSYDD 172
           HD   + T S DK++ IW  D     F +C+  L  H   + ++ +        S S D 
Sbjct: 577 HDSKLIITSSADKNIKIWGLD-----FGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDG 631

Query: 173 TVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           TV+ W    + ++C   L GH G VW      +  G  + S S D ++R+W
Sbjct: 632 TVKYW--DGNSFDCIQKLYGHQGEVWA--LAVSSDGQAVVSVSHDRSIRVW 678

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 78/185 (42%), Gaps = 15/185 (8%)

Query: 1   MPNLHLVRSLKLH-GDRCWSVDISKG--LLATGSADRKIKLVDVRNFKLVEELDDTAHKK 57
           +P + L+    L  G+  W V IS     LA    D  +K+  + + K    L    HK 
Sbjct: 511 VPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSL--YGHKL 568

Query: 58  AVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGA 117
            V S+       ++   S D  + IWG D  D          +  H++ + +V +  +  
Sbjct: 569 PVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKS------LFAHQDSIMNVKFLPESH 622

Query: 118 YLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
              +CS+D +V  W+ +     F+C   L  H  +V  +   +    + S S+D ++R+W
Sbjct: 623 NFFSCSKDGTVKYWDGNS----FDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678

Query: 178 AEQDD 182
            E +D
Sbjct: 679 EETED 683

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 4/76 (5%)

Query: 148 EHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAET 207
           E   +  ++ +H    +LA    D T++IW  Q        V   H   +    F+  +T
Sbjct: 73  EKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQ--TVLIVFHSHSSAITILRFD--QT 128

Query: 208 GIRLCSGSDDTTVRIW 223
           G RL SGS D T+ +W
Sbjct: 129 GTRLISGSRDATIILW 144

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 81/186 (43%), Gaps = 24/186 (12%)

Query: 23  SKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRP----------HCNVLA 72
           S G + TG+ + ++K  +++  +L++ + D     A+ + A +P             +LA
Sbjct: 33  SPGQVITGALE-EVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILA 91

Query: 73  AGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWE 132
            G  D T+ IW     D   +T +L V   H + +  + +   G  L + SRD ++ +W 
Sbjct: 92  VGYADGTIKIW-----DMQTQT-VLIVFHSHSSAITILRFDQTGTRLISGSRDATIILW- 144

Query: 133 ADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSG 192
            D ++E   C   L+ H   +  I W  +   L S S D  +++W  +    +C      
Sbjct: 145 -DLVAETGLCK--LRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVH--QCVETHMA 198

Query: 193 HGGTVW 198
           H G  W
Sbjct: 199 HTGECW 204

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 58/147 (39%), Gaps = 16/147 (10%)

Query: 89  DYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWE--------ADELSEEF 140
           D +  T L  + E H   + S+  + DG  L T S DK+V  W+        A  L +  
Sbjct: 452 DLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFV 511

Query: 141 ECNSVLQEHSQDVKHIVW----HASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGT 196
               ++ + + D+   +W          LA S  D+TV+++    D  +    L GH   
Sbjct: 512 PKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFL--DSMKFFLSLYGHKLP 569

Query: 197 VWCSDFERAETGIRLCSGSDDTTVRIW 223
           V   D       I   + S D  ++IW
Sbjct: 570 VLSMDISHDSKLI--ITSSADKNIKIW 594

>Scas_624.11
          Length = 1205

 Score = 60.8 bits (146), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 72/296 (24%), Positives = 123/296 (41%), Gaps = 59/296 (19%)

Query: 8   RSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPH 67
           + +  H  R W       L+A  S+   I+L D R   L+   +D  H+  VRSV + P 
Sbjct: 15  KGIAFHPSRPWV------LVALFSS--TIQLWDYRMGTLLHRFED--HEGPVRSVDFHPT 64

Query: 68  CNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKS 127
             +  +G  D T+ +W  + +      + L  + GH + +++V +  +  ++ + S D++
Sbjct: 65  QPIFVSGGDDYTIKVWSLETN------KCLYTLNGHLDYIRTVFFHKELPWIISASDDQT 118

Query: 128 VWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW---------- 177
           + IW      +E  C   L  H+  V    +H +  L+ S+S D+T+R+W          
Sbjct: 119 IRIWNWQN-RKEIAC---LTGHNHFVMCAQFHPTDDLVVSASLDETIRVWDISGLRKKHS 174

Query: 178 ------------AEQD------DDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTT 219
                       A+Q+       D     +L GH   V  + F    T   + SGSDD  
Sbjct: 175 APGTSTFDDQMAAQQNLLDGGFGDCVVKFILEGHTRGVNWASFH--PTLPMIVSGSDDRQ 232

Query: 220 VRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSW-SADGLIASVGSDGVLAVY 274
           V++W+  +       K W  +T     HT  V  V +      I SVG D  L ++
Sbjct: 233 VKLWKYNS------TKAWEVDTCRG--HTNNVDCVIFHPTQKFILSVGEDKTLRIW 280

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 40/199 (20%), Positives = 87/199 (43%), Gaps = 36/199 (18%)

Query: 3   NLHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSV 62
           +L  +R++  H +  W +        + S D+ I++ + +N K +  L  T H   V   
Sbjct: 94  HLDYIRTVFFHKELPWII--------SASDDQTIRIWNWQNRKEIACL--TGHNHFVMCA 143

Query: 63  AWRPHCNVLAAGSFDTTVSIWGRD--------------DDDYSGETELLA---------- 98
            + P  +++ + S D T+ +W                 DD  + +  LL           
Sbjct: 144 QFHPTDDLVVSASLDETIRVWDISGLRKKHSAPGTSTFDDQMAAQQNLLDGGFGDCVVKF 203

Query: 99  VIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVW 158
           ++EGH   V   ++      + + S D+ V +W+ +  ++ +E ++  + H+ +V  +++
Sbjct: 204 ILEGHTRGVNWASFHPTLPMIVSGSDDRQVKLWKYNS-TKAWEVDTC-RGHTNNVDCVIF 261

Query: 159 HASRLLLASSSYDDTVRIW 177
           H ++  + S   D T+RIW
Sbjct: 262 HPTQKFILSVGEDKTLRIW 280

 Score = 34.3 bits (77), Expect = 0.14,   Method: Composition-based stats.
 Identities = 19/82 (23%), Positives = 37/82 (45%), Gaps = 4/82 (4%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
            H + V   ++ P   ++ +GS D  V +W  +    S +   +    GH N V  V + 
Sbjct: 207 GHTRGVNWASFHPTLPMIVSGSDDRQVKLWKYN----STKAWEVDTCRGHTNNVDCVIFH 262

Query: 114 HDGAYLATCSRDKSVWIWEADE 135
               ++ +   DK++ IW+ D+
Sbjct: 263 PTQKFILSVGEDKTLRIWDLDK 284

 Score = 32.7 bits (73), Expect = 0.48,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 37/86 (43%), Gaps = 10/86 (11%)

Query: 146 LQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVL---SGHGGTVWCSDF 202
            +  S   K I +H SR  +  + +  T+++W     D+    +L     H G V   DF
Sbjct: 7   FESKSTRAKGIAFHPSRPWVLVALFSSTIQLW-----DYRMGTLLHRFEDHEGPVRSVDF 61

Query: 203 ERAETGIRLCSGSDDTTVRIWRCLTD 228
               T     SG DD T+++W   T+
Sbjct: 62  H--PTQPIFVSGGDDYTIKVWSLETN 85

 Score = 28.9 bits (63), Expect = 8.0,   Method: Composition-based stats.
 Identities = 28/128 (21%), Positives = 46/128 (35%), Gaps = 18/128 (14%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGR 85
           ++ +GS DR++KL    + K  E      H   V  V + P    + +   D T+ IW  
Sbjct: 223 MIVSGSDDRQVKLWKYNSTKAWEVDTCRGHTNNVDCVIFHPTQKFILSVGEDKTLRIWDL 282

Query: 86  DD----DDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFE 141
           D       +  E +   +I  H N +     +HD   +               +L  E  
Sbjct: 283 DKRIPVKQFKRENDRFWLIASHPN-INLFGAAHDAGIMVF-------------KLDRERP 328

Query: 142 CNSVLQEH 149
           CN + Q  
Sbjct: 329 CNVIYQNQ 336

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 60.5 bits (145), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 64/277 (23%), Positives = 132/277 (47%), Gaps = 31/277 (11%)

Query: 53  TAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWG-----RDDDDYSGETELLAVIEGHENEV 107
           +A +  +++   R +  + A  +   T SI       R  + Y    +LLA        +
Sbjct: 156 SARQYILKNSIARANKRIAAQKTISQTYSIQNVLNKRRAANKYWCSFDLLATQVVSTRPI 215

Query: 108 KSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLAS 167
            +V + ++G Y+A+ S +  V I +++ L    E    LQ H   V  I W ++  +L +
Sbjct: 216 STVTFCNNGNYVASGSWNGEVSIIDSNTL----EVTQTLQNHDGKVGGIAWTSNDSVLIT 271

Query: 168 SSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLT 227
              D  + +    D ++  +  + GH G +  +D +   +G  + + S D+T R+W    
Sbjct: 272 GGEDHLITVSNRSDGEFITSNSIGGHEGRI--TDLQVHPSGKFIGTSSFDSTWRLW---- 325

Query: 228 DDADVFDKEWIQETVLPAVHTRAVYSVSWSADG-LIASVGSDGVLAVYKEVQAGRWEVVA 286
                 D E  ++ +L   H++ +Y +++ ADG L+++ G+D    ++ ++++G+   V+
Sbjct: 326 ------DIEKQKQLLLQEGHSKELYCLAFQADGALVSTAGTDKTAIIW-DLRSGK--AVS 376

Query: 287 RVDC-AHTVYEINVVKWLALDGRVLLVTGGDDGCVNV 322
           ++   A T+Y    + W ++DG   L TGG DG + +
Sbjct: 377 QLQGHAKTIY---CMDW-SIDGHT-LATGGGDGVITI 408

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 93/217 (42%), Gaps = 18/217 (8%)

Query: 4   LHLVRSLKLH----GDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAV 59
           L + ++L+ H    G   W+ + S  +L TG  D  I + +  + + +       H+  +
Sbjct: 244 LEVTQTLQNHDGKVGGIAWTSNDS--VLITGGEDHLITVSNRSDGEFITSNSIGGHEGRI 301

Query: 60  RSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYL 119
             +   P    +   SFD+T  +W     D   + +LL + EGH  E+  +A+  DGA +
Sbjct: 302 TDLQVHPSGKFIGTSSFDSTWRLW-----DIEKQKQLL-LQEGHSKELYCLAFQADGALV 355

Query: 120 ATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAE 179
           +T   DK+  IW+        +  S LQ H++ +  + W      LA+   D  + IW  
Sbjct: 356 STAGTDKTAIIWDL----RSGKAVSQLQGHAKTIYCMDWSIDGHTLATGGGDGVITIWDL 411

Query: 180 QDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSD 216
           +  D      ++ H   V    F++A     + SG D
Sbjct: 412 RKSD--KLTKITEHKSIVTSLKFDKANDHNLISSGYD 446

>Scas_713.50
          Length = 983

 Score = 60.1 bits (144), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 63/237 (26%), Positives = 93/237 (39%), Gaps = 38/237 (16%)

Query: 13  HGDRCWSVDISKG--LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVR---------- 60
           H    WS+D++     L TGSAD+ +K     NF+L +EL      K V           
Sbjct: 510 HDAAIWSLDLTSDGKRLITGSADKSVKF---WNFQLEQELVPGTSDKFVPKLGLHHDTTL 566

Query: 61  -------SVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
                  SV   P    LA    D TV ++  D        +    + GH+  V S+  S
Sbjct: 567 ELSDDILSVRVSPEDKFLAVSLLDNTVKVFFLD------SMKFFLSLYGHKLPVLSIDIS 620

Query: 114 HDGAYLATCSRDKSVWIWEADELSEEF-ECNSVLQEHSQDVKHIVWHASRLLLASSSYDD 172
            D   + T S DK++ IW  D     F +C+  L  H   + ++ +        S S D 
Sbjct: 621 FDSKMIITSSADKNIKIWGLD-----FGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDG 675

Query: 173 TVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDD 229
            ++ W    D +EC   L+ H   VW      A     + S S D ++RIW    D+
Sbjct: 676 IIKYW--DGDKFECIQKLAAHQSEVWA--LAIANDASFVVSSSHDHSIRIWEETEDE 728

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 49/182 (26%), Positives = 79/182 (43%), Gaps = 15/182 (8%)

Query: 4   LHLVRSLKLHGDRCWSVDIS--KGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRS 61
           LH   +L+L  D   SV +S     LA    D  +K+  + + K    L    HK  V S
Sbjct: 560 LHHDTTLEL-SDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSMKFFLSL--YGHKLPVLS 616

Query: 62  VAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLAT 121
           +       ++   S D  + IWG D  D      L A    H++ + +V +  +     +
Sbjct: 617 IDISFDSKMIITSSADKNIKIWGLDFGDC--HKSLFA----HQDSIMNVKFVPESHNFFS 670

Query: 122 CSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQD 181
           CS+D  +  W+ D+    FEC   L  H  +V  +        + SSS+D ++RIW E +
Sbjct: 671 CSKDGIIKYWDGDK----FECIQKLAAHQSEVWALAIANDASFVVSSSHDHSIRIWEETE 726

Query: 182 DD 183
           D+
Sbjct: 727 DE 728

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 45/176 (25%), Positives = 73/176 (41%), Gaps = 36/176 (20%)

Query: 69  NVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSV 128
           N+LA G  D  V +W    D YS    +L  + GH + + ++ +   G  L + SRD ++
Sbjct: 119 NLLAVGYNDGVVKVW----DLYS--KTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNI 172

Query: 129 WIWEADELSE--------------EFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTV 174
            +W  D +SE                 CN V   ++Q+   + W      L S+S D  +
Sbjct: 173 IVW--DLVSEVGLYKLRSHKDAITGIWCNEV-TNNNQEENELDW------LISTSKDGLI 223

Query: 175 RIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWR-CLTDD 229
           +IW  +    +C      H G  W      A     + + S D+ V+ W+  L DD
Sbjct: 224 KIWDLKIQ--QCVETHIAHTGECW----SLAVRNDLVITTSSDSQVKFWQLSLQDD 273

 Score = 32.0 bits (71), Expect = 0.82,   Method: Composition-based stats.
 Identities = 40/147 (27%), Positives = 60/147 (40%), Gaps = 16/147 (10%)

Query: 89  DYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWE---ADEL----SEEFE 141
           D +  T++  + E H+  + S+  + DG  L T S DKSV  W      EL    S++F 
Sbjct: 496 DLASSTQIANIEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFV 555

Query: 142 CNSVLQ-----EHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGT 196
               L      E S D+  +        LA S  D+TV+++    D  +    L GH   
Sbjct: 556 PKLGLHHDTTLELSDDILSVRVSPEDKFLAVSLLDNTVKVFFL--DSMKFFLSLYGHKLP 613

Query: 197 VWCSDFERAETGIRLCSGSDDTTVRIW 223
           V   D       I   + S D  ++IW
Sbjct: 614 VLSIDISFDSKMI--ITSSADKNIKIW 638

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/156 (33%), Positives = 73/156 (46%), Gaps = 15/156 (9%)

Query: 107 VKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLA 166
           ++SV +S DG +LAT + DK + IW+     E  +    L+ H QD+  + +  S   L 
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDL----ETKKIVMTLKGHEQDIYSLDYFPSGNKLV 464

Query: 167 SSSYDDTVRIWAEQDDDWECAAVLSGHGG--TVWCSDFERAETGIRLCSGSDDTTVRIWR 224
           S S D TVRIW        C+  LS   G  TV  S  E    G  + +GS D TVR+W 
Sbjct: 465 SGSGDRTVRIW--DLTTGTCSLTLSIEDGVTTVAVSPGE----GKFIAAGSLDRTVRVWD 518

Query: 225 CLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADG 260
               D     +    E  L   H  +VYSV ++ DG
Sbjct: 519 S---DTGFLVERLDSENELGTGHRDSVYSVVFTRDG 551

 Score = 57.0 bits (136), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 100/236 (42%), Gaps = 28/236 (11%)

Query: 6   LVRSLKLHGDRCWSVDI--SKGLLATGSADRKIKLVDVRNF--KLVEELDDTAHKKAVRS 61
           +V +LK H    +S+D   S   L +GS DR +++ D+      L   ++D      V +
Sbjct: 440 IVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIED-----GVTT 494

Query: 62  VAWRP-HCNVLAAGSFDTTVSIWGRDD----DDYSGETELLAVIEGHENEVKSVAWSHDG 116
           VA  P     +AAGS D TV +W  D     +    E EL     GH + V SV ++ DG
Sbjct: 495 VAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGT---GHRDSVYSVVFTRDG 551

Query: 117 AYLATCSRDKSVWIWEADELSEE---FECNSVLQEHSQDVKHIVWHASRLLLASSSYDDT 173
             + + S D+SV +W  + LS +    EC      H   V  +    +   + S S D  
Sbjct: 552 KGVVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRG 611

Query: 174 VRIWAEQDDDWECAAVLSGHGGTVWCSDFER-----AETGIRLCSGSDDTTVRIWR 224
           V  W  +  +     +L GH  +V             E G+   +GS D   RIW+
Sbjct: 612 VLFWDTKSGN--PLLMLQGHRNSVISVTVANGHPLGPEYGV-FATGSGDCKARIWK 664

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 76/319 (23%), Positives = 134/319 (42%), Gaps = 71/319 (22%)

Query: 16  RCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGS 75
           +C +      +L  G ++ + ++ ++ +F  +++L  +  + AV +VA       LA GS
Sbjct: 275 KCAAFHADSNMLIVGFSNGEFRMYELPDFTFIQQL--SMGQNAVNTVAVNRSGEWLAFGS 332

Query: 76  FDTTVSIWGRD-DDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEAD 134
                S  G+    ++  E+ +L   +GH + + ++A+S DGA + T + D  + IW   
Sbjct: 333 -----STLGQLLVYEWQSESYILKQ-QGHFDALNALAYSPDGARIVTAAEDGKIKIW--- 383

Query: 135 ELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW------------AEQDD 182
           ++   F C +  +EH+  V  + +  +  ++ SSS D TV+ W            A +  
Sbjct: 384 DIVSGF-CLATFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERI 442

Query: 183 DWECAA------------------------------VLSGHGGTVWCSDFERAETGIRLC 212
            + C A                               LSGH G V C  F R E  I L 
Sbjct: 443 QFSCLAADPTGEVVCAGSLDNYDIQVWSVQTGQLLDTLSGHEGPVSCLSFSR-ENSI-LA 500

Query: 213 SGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGS-DGVL 271
           S S D T+R+W        +F +    + V P      V  +S   DG   +V + +G L
Sbjct: 501 SASWDKTIRVW-------SIFGRS---QQVEPIEAYSDVLDISMRPDGKQVAVSTLNGQL 550

Query: 272 AVYKEVQAGRWEVVARVDC 290
           + + +V+  R   V  +DC
Sbjct: 551 SFF-DVETSRQ--VGNIDC 566

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 66/137 (48%), Gaps = 20/137 (14%)

Query: 13  HGDRCWSVDISKG--LLATGSADRKIK---LVDVRNFKLVEELDDTAHKKAVRS-VAWRP 66
           H     SV  +K   ++ + S D  +K   L+  RNF+       TA ++   S +A  P
Sbjct: 397 HTSSVTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTF-----TATERIQFSCLAADP 451

Query: 67  HCNVLAAGSFDTT-VSIWGRDDDDYSGET-ELLAVIEGHENEVKSVAWSHDGAYLATCSR 124
              V+ AGS D   + +W       S +T +LL  + GHE  V  +++S + + LA+ S 
Sbjct: 452 TGEVVCAGSLDNYDIQVW-------SVQTGQLLDTLSGHEGPVSCLSFSRENSILASASW 504

Query: 125 DKSVWIWEADELSEEFE 141
           DK++ +W     S++ E
Sbjct: 505 DKTIRVWSIFGRSQQVE 521

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 52/115 (45%), Gaps = 13/115 (11%)

Query: 104 ENEVKSVAWSHDGAYLA-TCSRDKSVWIWEADELSEEFECNSVLQE-----HSQDVKHIV 157
           +++V  V +S DG   A  C R   + IW    +S E +    ++      H  D+  + 
Sbjct: 112 KDKVNDVKFSTDGKLFALACGR--FLQIWRTPGVSAERQFAPFVRYRVHAGHFADITSLT 169

Query: 158 WHASRLLLASSSYDDTVRIWAEQDDDWECAAV-LSGH----GGTVWCSDFERAET 207
           W      + S++ D T RI++   ++ + A++  +GH     G  + +D E+  T
Sbjct: 170 WSRDSRFIISTAKDMTARIYSVNAEEKDLASMTFAGHRDYVMGAFFSADQEKIYT 224

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 79/157 (50%), Gaps = 17/157 (10%)

Query: 107 VKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLA 166
           ++SV +S DG YLAT + DK + IW   +L+ + +    LQ H QD+  + +  +   L 
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIW---DLTTK-KILMTLQGHEQDIYSLDYFPAGDKLV 410

Query: 167 SSSYDDTVRIWAEQDDDWECAAVLSGHGG--TVWCSDFERAETGIRLCSGSDDTTVRIWR 224
           S S D TVRIW  +    +C+  LS   G  TV  S  +    G  + +GS D TVR+W 
Sbjct: 411 SGSGDRTVRIWDLR--TGQCSLTLSIEDGVTTVAVSPGD----GKYIAAGSLDRTVRVW- 463

Query: 225 CLTDDADVFDKEWI-QETVLPAVHTRAVYSVSWSADG 260
              D    F  E +  E  L   H  +VYSV ++ DG
Sbjct: 464 ---DSETGFLVERLDSENELSTGHKDSVYSVVFTRDG 497

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 100/216 (46%), Gaps = 22/216 (10%)

Query: 17  CWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSF 76
           C+S D     LATG+ D+ I++ D+   K++  L    H++ + S+ + P  + L +GS 
Sbjct: 359 CFSPD--GKYLATGAEDKLIRIWDLTTKKILMTLQ--GHEQDIYSLDYFPAGDKLVSGSG 414

Query: 77  DTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSH-DGAYLATCSRDKSVWIWEADE 135
           D TV IW    D  +G+  L   I   E+ V +VA S  DG Y+A  S D++V +W+++ 
Sbjct: 415 DRTVRIW----DLRTGQCSLTLSI---EDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSET 467

Query: 136 --LSEEFEC-NSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW-----AEQDDDWECA 187
             L E  +  N +   H   V  +V+      + S S D +V++W       Q     C 
Sbjct: 468 GFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCE 527

Query: 188 AVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
              +GH   V      + +  I   SGS D  V  W
Sbjct: 528 VTYTGHKDFVLSVATTQDDEYI--LSGSKDRGVLFW 561

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 80/173 (46%), Gaps = 23/173 (13%)

Query: 59  VRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAY 118
           +RSV + P    LA G+ D  + IW     D + + ++L  ++GHE ++ S+ +   G  
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIW-----DLTTK-KILMTLQGHEQDIYSLDYFPAGDK 408

Query: 119 LATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWA 178
           L + S D++V IW+        +C+  L          V       +A+ S D TVR+W 
Sbjct: 409 LVSGSGDRTVRIWDL----RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWD 464

Query: 179 EQ--------DDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
            +        D + E +   +GH  +V+   F R   G+   SGS D +V++W
Sbjct: 465 SETGFLVERLDSENELS---TGHKDSVYSVVFTRDGQGV--ISGSLDRSVKLW 512

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 60/127 (47%), Gaps = 9/127 (7%)

Query: 15  DRCWSVDISKG---LLATGSADRKIKLVDVRNFKLVEELDD-----TAHKKAVRSVAWRP 66
           D   +V +S G    +A GS DR +++ D     LVE LD      T HK +V SV +  
Sbjct: 436 DGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTR 495

Query: 67  HCNVLAAGSFDTTVSIWG-RDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRD 125
               + +GS D +V +W  R  +             GH++ V SVA + D  Y+ + S+D
Sbjct: 496 DGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKD 555

Query: 126 KSVWIWE 132
           + V  W+
Sbjct: 556 RGVLFWD 562

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 66/150 (44%), Gaps = 21/150 (14%)

Query: 13  HGDRCWSVDISK---GLLATGSADRKIKLVDVRNFKLVE-----ELDDTAHKKAVRSVAW 64
           H D  +SV  ++   G++ +GS DR +KL D+R     +     E+  T HK  V SVA 
Sbjct: 484 HKDSVYSVVFTRDGQGVI-SGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVAT 542

Query: 65  RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVA------WSHDGAY 118
                 + +GS D  V  W    D  SG   L+  ++GH N V SVA         D   
Sbjct: 543 TQDDEYILSGSKDRGVLFW----DTASGNPLLM--LQGHRNSVISVAVVNGFPLGPDVGV 596

Query: 119 LATCSRDKSVWIWEADELSEEFECNSVLQE 148
            AT S D    IW+  + S      + LQE
Sbjct: 597 FATGSGDCKARIWKYTKKSNPTATGAKLQE 626

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 99/218 (45%), Gaps = 40/218 (18%)

Query: 29  TGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDD 88
           TG+ D+ I++ D  N K + +L  + H   V ++ +  H  +L +GS D TV +W    D
Sbjct: 397 TGADDKMIRVYDSINKKFLLQL--SGHDGGVWALKYA-HGGILVSGSTDRTVRVW----D 449

Query: 89  DYSGETELLAVIEGHENEVK--SVAWSHDGAYLATCSRDKSVWIWEADELS--------- 137
              G      V +GH + V+   +    +  Y+ T SRD ++ +W+  + S         
Sbjct: 450 IKKGCCT--HVFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVWKLPKESSVPDHGEEH 507

Query: 138 ----------EEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECA 187
                     E      VL+ H   V+ +  H +  ++ S SYD+T+ +W       +C 
Sbjct: 508 DYPLVFHTPEENPYFVGVLRGHMASVRTVSGHGN--IVVSGSYDNTLIVWDVA--QMKCL 563

Query: 188 AVLSGHGGTVWCS--DFERAETGIRLCSGSDDTTVRIW 223
            +LSGH   ++ +  D ER     R  S S DTT+RIW
Sbjct: 564 YILSGHTDRIYSTIYDHERK----RCISASMDTTIRIW 597

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 64/144 (44%), Gaps = 26/144 (18%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
            H  +VR+V+   H N++ +GS+D T+ +W         + + L ++ GH + + S  + 
Sbjct: 528 GHMASVRTVSG--HGNIVVSGSYDNTLIVWD------VAQMKCLYILSGHTDRIYSTIYD 579

Query: 114 HDGAYLATCSRDKSVWIWEADELSEEFEC----NS------------VLQEHSQDVKHIV 157
           H+     + S D ++ IW+ + +    EC    NS             LQ H+  V   +
Sbjct: 580 HERKRCISASMDTTIRIWDLENIWNNGECSYATNSASPCAKILGAMYTLQGHTALVG--L 637

Query: 158 WHASRLLLASSSYDDTVRIWAEQD 181
              S   L S++ D ++R W   D
Sbjct: 638 LRLSDKFLVSAAADGSIRGWDAND 661

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 64/139 (46%), Gaps = 15/139 (10%)

Query: 99  VIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVW 158
            + GH   V +     D  Y+ T + DK + ++  D ++++F    +LQ    D    VW
Sbjct: 376 TLRGHMTSVITCLQFEDN-YVITGADDKMIRVY--DSINKKF----LLQLSGHDGG--VW 426

Query: 159 ---HASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGS 215
              +A   +L S S D TVR+W  +     C  V  GH  TV C D    +    + +GS
Sbjct: 427 ALKYAHGGILVSGSTDRTVRVWDIKKG--CCTHVFKGHNSTVRCLDIVEYKNIKYIVTGS 484

Query: 216 DDTTVRIWRCLTDDADVFD 234
            D T+ +W+ L  ++ V D
Sbjct: 485 RDNTLHVWK-LPKESSVPD 502

>Scas_704.40
          Length = 608

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 75/154 (48%), Gaps = 19/154 (12%)

Query: 70  VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVW 129
           +L  GS+D+TV+IW           +L+  + GH + VK++ +  D A L T S DK++ 
Sbjct: 265 LLFTGSYDSTVAIWDL------CSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIR 316

Query: 130 IWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAV 189
           +W      +  EC S  + H+  V  +   A + ++ S S D TV+IW  +         
Sbjct: 317 VWNY----KTGECISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVES---RTCYT 367

Query: 190 LSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           L GH  T W +  +         SGSDDTT+R+W
Sbjct: 368 LRGH--TEWVNCVKLHPKSFTCFSGSDDTTIRMW 399

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 85/192 (44%), Gaps = 21/192 (10%)

Query: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRP 66
           V+  K H D   ++  +  LL TGS D  + + D+ + KL+  L  + H   V+++ +  
Sbjct: 246 VQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRL--SGHTDGVKTLYFDE 303

Query: 67  HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSV-AWSHDGAYLATCSRD 125
               L  GS D T+ +W           E ++   GH + V SV A+      + + S D
Sbjct: 304 A--KLVTGSLDKTIRVWNYKTG------ECISTYRGHTDSVMSVDAFK---KIIVSGSAD 352

Query: 126 KSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWE 185
           K+V IW      E   C + L+ H++ V  +  H       S S D T+R+W  + +   
Sbjct: 353 KTVKIWHV----ESRTCYT-LRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTN--S 405

Query: 186 CAAVLSGHGGTV 197
           C  V  GH G V
Sbjct: 406 CLKVFRGHVGQV 417

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 92/229 (40%), Gaps = 34/229 (14%)

Query: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKL--VDVRNFKLVEELDDTAHKKAVRSVAW 64
           + + + H D   SVD  K ++ +GSAD+ +K+  V+ R    +       H + V  V  
Sbjct: 326 ISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLR-----GHTEWVNCVKL 380

Query: 65  RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSH--DGAYLATC 122
            P      +GS DTT+ +W    +        L V  GH  +V+ V      D   L   
Sbjct: 381 HPKSFTCFSGSDDTTIRMWDIRTN------SCLKVFRGHVGQVQKVIPLTIIDAENLVV- 433

Query: 123 SRDKSVWIWEADELSEEFECNSVLQ--------EHSQDVKHIVWHASRLLLASSSYDDTV 174
             D      E D+        +           E +Q +   + + + LL  S S D+T+
Sbjct: 434 --DNISGSNEGDDEPASTTTPTAAIAAEAATNDEENQTLDKSIPYPTHLL--SCSLDNTI 489

Query: 175 RIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           ++W  Q    +C     GH   VW    + A    R+ SGS D +++IW
Sbjct: 490 KLWDVQTG--QCIRTQFGHVEGVW----DIAADNFRIISGSHDGSIKIW 532

 Score = 33.5 bits (75), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 65/154 (42%), Gaps = 19/154 (12%)

Query: 6   LVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDD-TAHKKAVRSV-A 63
           L+R L  H D   ++   +  L TGS D+ I+   V N+K  E +     H  +V SV A
Sbjct: 285 LIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIR---VWNYKTGECISTYRGHTDSVMSVDA 341

Query: 64  WRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCS 123
           ++    ++ +GS D TV IW         E+     + GH   V  V          + S
Sbjct: 342 FK---KIIVSGSADKTVKIW-------HVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGS 391

Query: 124 RDKSVWIWEADELSEEFECNSVLQEHSQDVKHIV 157
            D ++ +W+    S    C  V + H   V+ ++
Sbjct: 392 DDTTIRMWDIRTNS----CLKVFRGHVGQVQKVI 421

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 75/156 (48%), Gaps = 15/156 (9%)

Query: 107 VKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLA 166
           ++SV +S DG +LAT + DK + IW+     E+ +   VL+ H QD+  + +  S   L 
Sbjct: 558 IRSVCFSPDGKFLATGAEDKLIRIWDI----EQKKIVMVLKGHEQDIYSLDYFPSGDKLV 613

Query: 167 SSSYDDTVRIWAEQDDDWECAAVLSGHGG--TVWCSDFERAETGIRLCSGSDDTTVRIWR 224
           S S D TVRIW  +    +C   LS   G  TV  S  +    G  + +GS D  VR+W 
Sbjct: 614 SGSGDRTVRIWDLK--TGQCTLTLSIEDGVTTVAVSPGD----GKFIAAGSLDRAVRVWD 667

Query: 225 CLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADG 260
               D     +    E  L   H  +VYSV ++ DG
Sbjct: 668 S---DTGFLVERLDSENELGTGHKDSVYSVVFTRDG 700

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/165 (31%), Positives = 85/165 (51%), Gaps = 15/165 (9%)

Query: 17  CWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSF 76
           C+S D     LATG+ D+ I++ D+   K+V  L    H++ + S+ + P  + L +GS 
Sbjct: 562 CFSPD--GKFLATGAEDKLIRIWDIEQKKIVMVLK--GHEQDIYSLDYFPSGDKLVSGSG 617

Query: 77  DTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSH-DGAYLATCSRDKSVWIWEADE 135
           D TV IW    D  +G+  L   I   E+ V +VA S  DG ++A  S D++V +W++D 
Sbjct: 618 DRTVRIW----DLKTGQCTLTLSI---EDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDT 670

Query: 136 --LSEEFEC-NSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
             L E  +  N +   H   V  +V+      + S S D +V++W
Sbjct: 671 GFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLW 715

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 84/185 (45%), Gaps = 28/185 (15%)

Query: 15  DRCWSVDISKG---LLATGSADRKIKLVDVRNFKLVEELDD-----TAHKKAVRSVAWRP 66
           D   +V +S G    +A GS DR +++ D     LVE LD      T HK +V SV +  
Sbjct: 639 DGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTR 698

Query: 67  HCNVLAAGSFDTTVSIWG--------RDDDDYSGETELLAVIEGHENEVKSVAWSHDGAY 118
             N + +GS D +V +W          D    SG  E+     GH++ V SVA + D  Y
Sbjct: 699 DGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEV--TYTGHKDFVLSVATTEDDEY 756

Query: 119 LATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHI-VWHASRL-----LLASSSYDD 172
           + + S+D+ V  W  D++S       +LQ H   V  + V H   L     + A+ S D 
Sbjct: 757 ILSGSKDRGVLFW--DKVSGNPLL--MLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDC 812

Query: 173 TVRIW 177
             RIW
Sbjct: 813 KARIW 817

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 77/173 (44%), Gaps = 23/173 (13%)

Query: 59  VRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAY 118
           +RSV + P    LA G+ D  + IW  +      + +++ V++GHE ++ S+ +   G  
Sbjct: 558 IRSVCFSPDGKFLATGAEDKLIRIWDIE------QKKIVMVLKGHEQDIYSLDYFPSGDK 611

Query: 119 LATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW- 177
           L + S D++V IW+     +  +C   L          V       +A+ S D  VR+W 
Sbjct: 612 LVSGSGDRTVRIWDL----KTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWD 667

Query: 178 -------AEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
                     D + E     +GH  +V+   F R   G+   SGS D +V++W
Sbjct: 668 SDTGFLVERLDSENELG---TGHKDSVYSVVFTRDGNGV--VSGSLDRSVKLW 715

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 58/133 (43%), Gaps = 24/133 (18%)

Query: 110 VAWSHDGAYLAT-CSRDKSVWIWEADELSEEFECNSVLQEHSQD---------------- 152
           V +S+DG +LAT C++   ++     EL   F   +   + +                  
Sbjct: 497 VKFSNDGEFLATGCNKTTQIYRVSDGELVARFSDENAHTDKADGNDNAEAETSAGATTDL 556

Query: 153 -VKHIVWHASRLLLASSSYDDTVRIW-AEQDDDWECAAVLSGHGGTVWCSDFERAETGIR 210
            ++ + +      LA+ + D  +RIW  EQ    +   VL GH   ++  D+    +G +
Sbjct: 557 YIRSVCFSPDGKFLATGAEDKLIRIWDIEQK---KIVMVLKGHEQDIYSLDY--FPSGDK 611

Query: 211 LCSGSDDTTVRIW 223
           L SGS D TVRIW
Sbjct: 612 LVSGSGDRTVRIW 624

>Kwal_23.6429
          Length = 750

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 75/157 (47%), Gaps = 17/157 (10%)

Query: 107 VKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLA 166
           ++SV +S DG +LAT + DK + IW+             LQ H QD+  + +  S   L 
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDL----ATRRIVMTLQGHEQDIYSLDYFPSGDKLV 528

Query: 167 SSSYDDTVRIWAEQDDDWECAAVLSGHGG--TVWCSDFERAETGIRLCSGSDDTTVRIWR 224
           S S D TVRIW  +    +C+  LS   G  TV  S  +    G  + +GS D TVRIW 
Sbjct: 529 SGSGDRTVRIWDLR--TGQCSLTLSIEDGVTTVAVSPGD----GKLIAAGSLDRTVRIW- 581

Query: 225 CLTDDADVFDKEWI-QETVLPAVHTRAVYSVSWSADG 260
              D    F  E +  E  L   H  +VYSV ++ DG
Sbjct: 582 ---DSETGFLVERLDSENELGTGHKDSVYSVVFTRDG 615

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 84/165 (50%), Gaps = 15/165 (9%)

Query: 17  CWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSF 76
           C+S D     LATG+ D+ I++ D+   ++V  L    H++ + S+ + P  + L +GS 
Sbjct: 477 CFSPD--GKFLATGAEDKLIRIWDLATRRIVMTLQ--GHEQDIYSLDYFPSGDKLVSGSG 532

Query: 77  DTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSH-DGAYLATCSRDKSVWIWEADE 135
           D TV IW    D  +G+  L   I   E+ V +VA S  DG  +A  S D++V IW+++ 
Sbjct: 533 DRTVRIW----DLRTGQCSLTLSI---EDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSET 585

Query: 136 --LSEEFEC-NSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
             L E  +  N +   H   V  +V+      + S S D +V++W
Sbjct: 586 GFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLW 630

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 78/173 (45%), Gaps = 23/173 (13%)

Query: 59  VRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAY 118
           +RSV + P    LA G+ D  + IW     D +    ++  ++GHE ++ S+ +   G  
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIW-----DLATR-RIVMTLQGHEQDIYSLDYFPSGDK 526

Query: 119 LATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWA 178
           L + S D++V IW+        +C+  L          V      L+A+ S D TVRIW 
Sbjct: 527 LVSGSGDRTVRIWDL----RTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWD 582

Query: 179 EQ--------DDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
            +        D + E     +GH  +V+   F R   G+   SGS D +V++W
Sbjct: 583 SETGFLVERLDSENELG---TGHKDSVYSVVFTRDGHGV--VSGSLDRSVKLW 630

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 79/183 (43%), Gaps = 24/183 (13%)

Query: 15  DRCWSVDISKG---LLATGSADRKIKLVDVRNFKLVEELDD-----TAHKKAVRSVAWRP 66
           D   +V +S G   L+A GS DR +++ D     LVE LD      T HK +V SV +  
Sbjct: 554 DGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTR 613

Query: 67  HCNVLAAGSFDTTVSIWG---RDDDDYSGETELLA---VIEGHENEVKSVAWSHDGAYLA 120
             + + +GS D +V +W     +     G+    A      GH++ V SVA + +  ++ 
Sbjct: 614 DGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFIL 673

Query: 121 TCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLL------LASSSYDDTV 174
           + S+D+ V  W+    +       +LQ H   V  +       L       A+ S D   
Sbjct: 674 SGSKDRGVLFWDTPSGNPLL----MLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKA 729

Query: 175 RIW 177
           RIW
Sbjct: 730 RIW 732

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 61/145 (42%), Gaps = 28/145 (19%)

Query: 103 HENEVKSVAWSHDGAYLAT-CSRDKSVWIWEADEL--------------------SEEFE 141
           H + V  V +SHDG +LAT C++   V+     EL                    SE  +
Sbjct: 399 HSSVVCCVRFSHDGEFLATGCNKTTQVYKVSTGELIARLSEDASSAPSGADASATSENAK 458

Query: 142 CN-SVLQEHSQD--VKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVW 198
            + +V    S D  ++ + +      LA+ + D  +RIW            L GH   ++
Sbjct: 459 ASPAVATSASSDLYIRSVCFSPDGKFLATGAEDKLIRIW--DLATRRIVMTLQGHEQDIY 516

Query: 199 CSDFERAETGIRLCSGSDDTTVRIW 223
             D+    +G +L SGS D TVRIW
Sbjct: 517 SLDY--FPSGDKLVSGSGDRTVRIW 539

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 63/139 (45%), Gaps = 26/139 (18%)

Query: 13  HGDRCWSVDISK---GLLATGSADRKIKLVDVRNFK----------LVEELDDTAHKKAV 59
           H D  +SV  ++   G++ +GS DR +KL ++R+               E+  T HK  V
Sbjct: 602 HKDSVYSVVFTRDGHGVV-SGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFV 660

Query: 60  RSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAY- 118
            SVA   +   + +GS D  V  W    D  SG   L+  ++GH N V SVA ++D    
Sbjct: 661 LSVATTQNDEFILSGSKDRGVLFW----DTPSGNPLLM--LQGHRNSVISVAVANDHPLG 714

Query: 119 -----LATCSRDKSVWIWE 132
                 AT S D    IW+
Sbjct: 715 PEYGVFATGSGDCKARIWK 733

>YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation factor I
           subunit 2 required for mRNA 3'-end processing, bridges
           two mRNA 3'-end processing factors, has WD (WD-40)
           repeats [1398 bp, 465 aa]
          Length = 465

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 90/201 (44%), Gaps = 24/201 (11%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
           AH  AV ++ +    + + +G  D  + IW     ++S   E+ A    H   ++ +A+S
Sbjct: 133 AHDSAVTTMKYSHDSDWMISGDADGMIKIW---QPNFSMVKEIDA---AHTESIRDMAFS 186

Query: 114 HDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDT 173
            + +   TCS D  + IW      +E     VL  H  DVK   WH    L+AS+S D+ 
Sbjct: 187 SNDSKFVTCSDDNILKIWNFSNGKQE----RVLSGHHWDVKSCDWHPEMGLIASASKDNL 242

Query: 174 VRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW---------R 224
           V++W  +  +  C + +     TV  + F+  + G  L + S D + R++          
Sbjct: 243 VKLWDPRSGN--CISSILKFKHTVLKTRFQPTK-GNLLMAISKDKSCRVFDIRYSMKELM 299

Query: 225 CLTDDADVFDKEW--IQETVL 243
           C+ D+ D    EW  I E++ 
Sbjct: 300 CVRDETDYMTLEWHPINESMF 320

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 98/220 (44%), Gaps = 22/220 (10%)

Query: 5   HLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAW 64
           H + +L +  +  +++DI       G  DR I L           L     K  + ++ W
Sbjct: 48  HGLPNLVVEPETSYTIDIMPPNAYRGR-DRVINLPSK-----FTHLSSNKVKHVIPAIQW 101

Query: 65  RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSR 124
            P    L   ++    S+W  +   ++ ET    +++ H++ V ++ +SHD  ++ +   
Sbjct: 102 TPEGRRLVVATYSGEFSLW--NASSFTFET----LMQAHDSAVTTMKYSHDSDWMISGDA 155

Query: 125 DKSVWIWEAD-ELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDD 183
           D  + IW+ +  + +E +       H++ ++ + + ++     + S D+ ++IW   +  
Sbjct: 156 DGMIKIWQPNFSMVKEIDA-----AHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGK 210

Query: 184 WECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
            E   VLSGH   V   D+   E G+ + S S D  V++W
Sbjct: 211 QE--RVLSGHHWDVKSCDWH-PEMGL-IASASKDNLVKLW 246

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 56/107 (52%), Gaps = 8/107 (7%)

Query: 27  LATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRD 86
           + +G AD  IK+    NF +V+E+D  AH +++R +A+  + +     S D  + IW   
Sbjct: 150 MISGDADGMIKIWQP-NFSMVKEID-AAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFS 207

Query: 87  DDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEA 133
           +    G+ E   V+ GH  +VKS  W  +   +A+ S+D  V +W+ 
Sbjct: 208 N----GKQE--RVLSGHHWDVKSCDWHPEMGLIASASKDNLVKLWDP 248

 Score = 35.8 bits (81), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 54/241 (22%), Positives = 99/241 (41%), Gaps = 23/241 (9%)

Query: 2   PNLHLVRSL-KLHG----DRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHK 56
           PN  +V+ +   H     D  +S + SK    T S D  +K+ +  N K  +E   + H 
Sbjct: 164 PNFSMVKEIDAAHTESIRDMAFSSNDSK--FVTCSDDNILKIWNFSNGK--QERVLSGHH 219

Query: 57  KAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDG 116
             V+S  W P   ++A+ S D  V +W    D  SG   + ++++     +K+      G
Sbjct: 220 WDVKSCDWHPEMGLIASASKDNLVKLW----DPRSGNC-ISSILKFKHTVLKTRFQPTKG 274

Query: 117 AYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHA-SRLLLASSSYDDTVR 175
             L   S+DKS  +++     +E  C  V  E   D   + WH  +  +   + YD +++
Sbjct: 275 NLLMAISKDKSCRVFDIRYSMKELMC--VRDE--TDYMTLEWHPINESMFTLACYDGSLK 330

Query: 176 IW-AEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW-RCLTDDADVF 233
            +   Q+ +     +   H   +  +       G    + + D T+R W R    D + +
Sbjct: 331 HFDLLQNLNEPILTIPYAHDKCI--TSLSYNPVGHIFATAAKDRTIRFWTRARPIDPNAY 388

Query: 234 D 234
           D
Sbjct: 389 D 389

>Kwal_27.11585
          Length = 823

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 72/161 (44%), Gaps = 13/161 (8%)

Query: 39  VDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLA 98
           VD+ N K V +    AH+K + +++  P+ +V A  S+D T  IW  D    SGE E   
Sbjct: 488 VDMHNIK-VSDYTRRAHEKDINALSISPNDSVFATASYDKTCKIWNVD----SGELE--G 540

Query: 99  VIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVW 158
            +  H+  +  V +      LATCS DK++ +W  + +S        L+ H+  V+   +
Sbjct: 541 TLANHKRGLWDVTFCQYDKLLATCSGDKTIKVWSLESMS----VVKTLEGHTNAVQRCSF 596

Query: 159 HASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWC 199
                 + S+  D  +++W       EC   L  H   +W 
Sbjct: 597 INRNKQIVSTGADGLIKVW--DLSTGECIRTLDAHSNRIWA 635

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 47/83 (56%), Gaps = 5/83 (6%)

Query: 101 EGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDV-----KH 155
           EGH + + S+  S +G +LATCS+D +V +W+ +  SE+F+  +    H+  V      +
Sbjct: 397 EGHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAGPVTAVGLPN 456

Query: 156 IVWHASRLLLASSSYDDTVRIWA 178
           ++ +     + ++S D T++ W+
Sbjct: 457 VMRNTWPEFIITASNDLTIKKWS 479

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 73/169 (43%), Gaps = 20/169 (11%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGR 85
           LLAT S D+ IK+  + +  +V+ L+   H  AV+  ++      + +   D  + +W  
Sbjct: 560 LLATCSGDKTIKVWSLESMSVVKTLE--GHTNAVQRCSFINRNKQIVSTGADGLIKVW-- 615

Query: 86  DDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWE---ADELSEEFEC 142
             D  +GE   +  ++ H N + +++   DG    T   D     W+    +E  E  E 
Sbjct: 616 --DLSTGEC--IRTLDAHSNRIWALSVLSDGKEFVTADADGVFQFWKDCSEEEQKENLEN 671

Query: 143 NSVLQEHSQDVKHIVWHA--SRLLLASSSYDDTVRIW-------AEQDD 182
             ++ E  Q +++ +     +   L + + +  +R++       A QDD
Sbjct: 672 QKLMVEQEQSLQNYMAQGDWTNAFLLAMTLNHPMRLYRVLERSSASQDD 720

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 74/319 (23%), Positives = 131/319 (41%), Gaps = 71/319 (22%)

Query: 16  RCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGS 75
           +C +   +  LLA G    + +L D+ +F L+++L  +  +  V +V+       LA GS
Sbjct: 264 KCVTFHPATRLLAVGFTSGEFRLYDLPDFTLIQQL--SMGQNPVNTVSVNQTGEWLAFGS 321

Query: 76  FDT-TVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEAD 134
                + ++     ++  E+ +L   +GH +   S+A+S DG+ + T S D  + +W   
Sbjct: 322 SKLGQLLVY-----EWQSESYILKQ-QGHFDSTNSLAYSPDGSRVVTASEDGKIKVW--- 372

Query: 135 ELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW------------AEQDD 182
           +++  F C +  +EH+  V  + +     ++ SSS D TVR W              +  
Sbjct: 373 DITSGF-CLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERI 431

Query: 183 DWECAAV------------------------------LSGHGGTVWCSDFERAETGIRLC 212
            + C AV                              LSGH G V C  F +  +   L 
Sbjct: 432 QFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENS--VLA 489

Query: 213 SGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGS-DGVL 271
           S S D T+RIW        +F +    + V P      V ++S   DG   +V +  G +
Sbjct: 490 SASWDKTIRIW-------SIFGR---SQQVEPIEVYSDVLALSMRPDGKEVAVSTLKGQI 539

Query: 272 AVYKEVQAGRWEVVARVDC 290
           +++    A +   V  +DC
Sbjct: 540 SIFNIEDAKQ---VGNIDC 555

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAV-IEGHENEVKSVAW 112
            H + + S+ W      +   S D +  IW  D    S E  L A    GH + V    +
Sbjct: 144 GHFQDITSLTWSQDSRFILTTSKDLSAKIWSVD----SEEKNLAATTFNGHRDYVMGAFF 199

Query: 113 SHDGAYLATCSRDKSVWIWE 132
           SHD   + T S+D +V++WE
Sbjct: 200 SHDQEKIYTVSKDGAVFVWE 219

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 59/134 (44%), Gaps = 15/134 (11%)

Query: 13  HGDRCWSVDISKG--LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNV 70
           H     ++D++K   LL +   D +  LV   NFK    L     K+   +V + P   +
Sbjct: 54  HRKNIAAIDLNKQGTLLISIDEDGRAILV---NFKARNVLHHFNFKEKCSAVKFSPDGRL 110

Query: 71  --LAAGSFDTTVSIWGRDDDDYSGETELLA---VIEGHENEVKSVAWSHDGAYLATCSRD 125
             LA+G F   + IW   D +   +        V  GH  ++ S+ WS D  ++ T S+D
Sbjct: 111 FALASGRF---LQIWKTPDVNKDRQFAPFVRHRVHAGHFQDITSLTWSQDSRFILTTSKD 167

Query: 126 KSVWIWEADELSEE 139
            S  IW  D  SEE
Sbjct: 168 LSAKIWSVD--SEE 179

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 56/121 (46%), Gaps = 9/121 (7%)

Query: 109 SVAWSHDGAYLATCSRDKSVWIWEADELSEE-----FECNSVLQEHSQDVKHIVWHASRL 163
           +V +S DG   A  S  + + IW+  +++++     F  + V   H QD+  + W     
Sbjct: 101 AVKFSPDGRLFALAS-GRFLQIWKTPDVNKDRQFAPFVRHRVHAGHFQDITSLTWSQDSR 159

Query: 164 LLASSSYDDTVRIWAEQDDDWECAA-VLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRI 222
            + ++S D + +IW+   ++   AA   +GH   V  + F   +   ++ + S D  V +
Sbjct: 160 FILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYVMGAFFSHDQE--KIYTVSKDGAVFV 217

Query: 223 W 223
           W
Sbjct: 218 W 218

>CAGL0M04081g complement(450572..451939) highly similar to sp|P42841
           Saccharomyces cerevisiae YNL317w PFS2 polyadenylation
           factor I, hypothetical start
          Length = 455

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 91/201 (45%), Gaps = 24/201 (11%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
           AH  +V ++ +    + + +G  D T+ IW     +++   EL  +   H   ++ VA+S
Sbjct: 122 AHDTSVTTMKYSHAGDWMISGDADGTIKIW---QPNFNMVKELDRI---HTEGIRDVAFS 175

Query: 114 HDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDT 173
           ++ +   TCS D  + IW      +E     VL  H  DV+   WH    L+ S S D+ 
Sbjct: 176 NNDSKFVTCSDDNILKIWNFSNGQQE----RVLSGHHWDVRSCDWHPELGLIVSGSKDNL 231

Query: 174 VRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW---------R 224
           V++W  +    +C + L     TV  + F+  + G  L + S D + R++          
Sbjct: 232 VKLWDPRSG--QCVSTLLKFKHTVLKTRFQPTK-GNLLAAISKDKSCRVFDLRASMNELM 288

Query: 225 CLTDDADVFDKEW--IQETVL 243
           C+ D+ D  + EW  I E++ 
Sbjct: 289 CVRDEVDFMELEWSTINESMF 309

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/219 (21%), Positives = 99/219 (45%), Gaps = 22/219 (10%)

Query: 10  LKLHGDRCWSVD----ISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWR 65
           LK HG     ++     +  ++   +  R  ++V++        L     K  + ++ W 
Sbjct: 34  LKKHGLSLPPIEPETSFTANIMPPDAYKRNDRIVNLPT--KFTHLSSNKVKHVIPAIQWS 91

Query: 66  PHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRD 125
           P    L   +F    S+W  +   ++ ET    +++ H+  V ++ +SH G ++ +   D
Sbjct: 92  PEGRRLIVATFSGEFSLW--NGSSFTFET----IMQAHDTSVTTMKYSHAGDWMISGDAD 145

Query: 126 KSVWIWEAD-ELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDW 184
            ++ IW+ +  + +E +     + H++ ++ + +  +     + S D+ ++IW   +   
Sbjct: 146 GTIKIWQPNFNMVKELD-----RIHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQ 200

Query: 185 ECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           E   VLSGH   V   D+   E G+ + SGS D  V++W
Sbjct: 201 E--RVLSGHHWDVRSCDWH-PELGL-IVSGSKDNLVKLW 235

 Score = 32.7 bits (73), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 47/222 (21%), Positives = 84/222 (37%), Gaps = 52/222 (23%)

Query: 2   PNLHLVRSL-KLHGDRCWSVDISKG--LLATGSADRKIKLVDVRNFKLVEELDDTAHKKA 58
           PN ++V+ L ++H +    V  S       T S D  +K+ +  N +  +E   + H   
Sbjct: 153 PNFNMVKELDRIHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQ--QERVLSGHHWD 210

Query: 59  VRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAY 118
           VRS  W P   ++ +GS D  V +W    D  SG+  +  +++     +K+      G  
Sbjct: 211 VRSCDWHPELGLIVSGSKDNLVKLW----DPRSGQC-VSTLLKFKHTVLKTRFQPTKGNL 265

Query: 119 LATCSRDKSVWIWEADELSEEFECN-----------SVLQE------------------- 148
           LA  S+DKS  +++      E  C            S + E                   
Sbjct: 266 LAAISKDKSCRVFDLRASMNELMCVRDEVDFMELEWSTINESMFTVGCYDGSLKHFDLGQ 325

Query: 149 ------------HSQDVKHIVWHASRLLLASSSYDDTVRIWA 178
                       H + +  I ++    +LA+++ D T+R W 
Sbjct: 326 DTEKPIHIIPFAHEKCISAIAYNPVGHILATAAKDRTIRFWT 367

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 49/103 (47%), Gaps = 12/103 (11%)

Query: 18  WSVDISKGLLATGSADRKIKLVDV-RNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSF 76
           WS  I++ +   G  D  +K  D+ ++ +    +   AH+K + ++A+ P  ++LA  + 
Sbjct: 301 WST-INESMFTVGCYDGSLKHFDLGQDTEKPIHIIPFAHEKCISAIAYNPVGHILATAAK 359

Query: 77  DTTVSIWGR---------DDDDYSGETELLAVIEGHENEVKSV 110
           D T+  W R         DD  Y+ + ++     G  N++ +V
Sbjct: 360 DRTIRFWTRARPVDPNAFDDPTYNNK-KMTGWFFGINNDINAV 401

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 104/238 (43%), Gaps = 34/238 (14%)

Query: 1   MPNLHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKL----------VEEL 50
           +P LH+ R+  +  D+  S    +G  A  S  R  K+V    FK+          ++E 
Sbjct: 197 LPLLHMKRARYIKSDKA-SASKGEGEDAPQSRMRPWKVVYRERFKVESNWRKGIYRIQEF 255

Query: 51  DDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSV 110
               H   V S+       +L  GS+D+TV+IW    D  +G+  L+  + GH + VK++
Sbjct: 256 K--GHMDGVLSLQLTN--KLLLTGSYDSTVAIW----DLATGK--LIRRLSGHTDGVKAL 305

Query: 111 AWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSY 170
            +  D   L T S DK++ +W     +    C S  + H   V  +   + R L+ S S 
Sbjct: 306 RF--DDQKLITGSLDKTIRVWNYVTGA----CVSTYRGHQDSVLSV--DSFRKLIVSGSA 357

Query: 171 DDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTD 228
           D TV++W  +         L GH G V C             SGSDD T+R+W   T+
Sbjct: 358 DKTVKVWHVES---RTCYTLRGHTGWVNCVKLH--PKSFTCFSGSDDMTIRMWDIRTN 410

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 86/194 (44%), Gaps = 19/194 (9%)

Query: 4   LHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVA 63
           ++ ++  K H D   S+ ++  LL TGS D  + + D+   KL+  L  + H   V+  A
Sbjct: 249 IYRIQEFKGHMDGVLSLQLTNKLLLTGSYDSTVAIWDLATGKLIRRL--SGHTDGVK--A 304

Query: 64  WRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCS 123
            R     L  GS D T+ +W    +  +G    ++   GH++ V SV        + + S
Sbjct: 305 LRFDDQKLITGSLDKTIRVW----NYVTGAC--VSTYRGHQDSVLSV--DSFRKLIVSGS 356

Query: 124 RDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDD 183
            DK+V +W      E   C + L+ H+  V  +  H       S S D T+R+W  + + 
Sbjct: 357 ADKTVKVWHV----ESRTCYT-LRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN- 410

Query: 184 WECAAVLSGHGGTV 197
             C  V  GH G V
Sbjct: 411 -TCVRVFHGHVGQV 423

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 91/219 (41%), Gaps = 28/219 (12%)

Query: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKL--VDVRNFKLVEELDDTAHKKAVRSVAW 64
           V + + H D   SVD  + L+ +GSAD+ +K+  V+ R    +       H   V  V  
Sbjct: 332 VSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLR-----GHTGWVNCVKL 386

Query: 65  RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSR 124
            P      +GS D T+ +W     D    T  + V  GH  +V+ V     G+ L    +
Sbjct: 387 HPKSFTCFSGSDDMTIRMW-----DIRTNT-CVRVFHGHVGQVQKVIPLTLGSDLIEDPK 440

Query: 125 DKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDW 184
           D  V     D  +   + +      + +  H + + + LL  S S D+T+++W  +    
Sbjct: 441 DAVV---PPDATAPAHDPSV----QAANFDHSLPYPTHLL--SCSLDNTIKLWNVKTG-- 489

Query: 185 ECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
            C     GH   VW    + A    R+ SGS D + ++W
Sbjct: 490 ACIRTQFGHVEGVW----DIAADNFRIVSGSHDRSCKVW 524

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 87/180 (48%), Gaps = 23/180 (12%)

Query: 7   VRSLKLHGD--RCWSVDISKGLLATGSADRKIKLVD-VRNFKLVEELDDTAHKKAVRSVA 63
           V   + H D  R  +V  +K  + TGS D  IKL +  +N+   +    T H+  V SVA
Sbjct: 90  VTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWEKNWGCQQTF--TGHEHFVMSVA 147

Query: 64  WRPH-CNVLAAGSFDTTVSIW--GRDDDDYSGETELLAVIEGHENE-VKSVAWS--HDGA 117
           + P   N  A+G  D T+ +W  G+D  +++        ++ HE + V  V +    D  
Sbjct: 148 FNPKDPNQFASGCLDHTIKVWSIGQDVPNFT--------LKAHETKGVNYVDYYPLQDKP 199

Query: 118 YLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
           YL T S D ++ +W+    S      + L+ H  +V + V+H +  ++ S S D T++IW
Sbjct: 200 YLITTSDDGTIKVWDYQTKSNV----ATLEGHMANVSYAVFHPTLPIIISGSEDGTLKIW 255

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 96/208 (46%), Gaps = 19/208 (9%)

Query: 24  KGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIW 83
           K  +  GS D K+++ +    + V E +  AH   +RS+A  P    +  GS D T+ +W
Sbjct: 67  KNWVVVGSDDFKLRVYNYNTGEKVTEFE--AHPDYIRSIAVHPTKPFVLTGSDDLTIKLW 124

Query: 84  GRDDDDYSGETELLAVIEGHENEVKSVAWS-HDGAYLATCSRDKSVWIWEADELSEEFEC 142
             + +    +T       GHE+ V SVA++  D    A+   D ++ +W   +    F  
Sbjct: 125 NWEKNWGCQQT-----FTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSIGQDVPNF-- 177

Query: 143 NSVLQEH-SQDVKHIVWHA--SRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWC 199
              L+ H ++ V ++ ++    +  L ++S D T+++W  Q       A L GH   V  
Sbjct: 178 --TLKAHETKGVNYVDYYPLQDKPYLITTSDDGTIKVWDYQTK--SNVATLEGHMANVSY 233

Query: 200 SDFERAETGIRLCSGSDDTTVRIWRCLT 227
           + F    T   + SGS+D T++IW   T
Sbjct: 234 AVFH--PTLPIIISGSEDGTLKIWNANT 259

 Score = 35.0 bits (79), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 38/195 (19%), Positives = 63/195 (32%), Gaps = 63/195 (32%)

Query: 128 VWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECA 187
           V+ +   E   EFE       H   ++ I  H ++  + + S D T+++W   + +W C 
Sbjct: 81  VYNYNTGEKVTEFEA------HPDYIRSIAVHPTKPFVLTGSDDLTIKLW-NWEKNWGCQ 133

Query: 188 AVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVH 247
              +GH   V    F   +   +  SG  D T+++W                        
Sbjct: 134 QTFTGHEHFVMSVAFNPKDPN-QFASGCLDHTIKVW------------------------ 168

Query: 248 TRAVYSVSWSADGLIASVGSDGVLAVYKEVQAGRWEVVARVDCAHTVYEINVVKWLALDG 307
                           S+G D      K               AH    +N V +  L  
Sbjct: 169 ----------------SIGQDVPNFTLK---------------AHETKGVNYVDYYPLQD 197

Query: 308 RVLLVTGGDDGCVNV 322
           +  L+T  DDG + V
Sbjct: 198 KPYLITTSDDGTIKV 212

>Scas_592.4*
          Length = 318

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 89/217 (41%), Gaps = 30/217 (13%)

Query: 67  HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDK 126
             N+L +GS D T+  W    DD      + +  +GH + V+    + DGAY  + S DK
Sbjct: 29  QPNLLLSGSRDKTLISWKLTGDDQKFGVPVRS-FKGHSHIVQDCTLTQDGAYALSASWDK 87

Query: 127 SVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWEC 186
           ++ +W+        E       H  DV  +       ++ S S D T+++W  +    +C
Sbjct: 88  TLRLWDV----ATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKG---QC 140

Query: 187 AAVLSGHGGTVWCSDFERAET-----GIRLCSGSDDTTVRIWRC--LTDDADVFDKEWIQ 239
            A L GH    W S    A T      + + S  +D  V+ W       +AD        
Sbjct: 141 LATLLGHND--WVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVG----- 193

Query: 240 ETVLPAVHTRAVYSVSWSADG-LIASVGSDGVLAVYK 275
                  H   V +V+ S DG LIAS G DG + ++ 
Sbjct: 194 -------HNGNVNAVTASPDGTLIASAGKDGEIMLWN 223

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 55/272 (20%), Positives = 104/272 (38%), Gaps = 70/272 (25%)

Query: 5   HLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAW 64
           H+V+   L  D  +++        + S D+ ++L DV   +  +      HK  V SVA 
Sbjct: 66  HIVQDCTLTQDGAYAL--------SASWDKTLRLWDVATGETYQRF--VGHKSDVMSVAI 115

Query: 65  RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSH-----DGAYL 119
               +++ +GS D T+ +W       + + + LA + GH + V  V  +      D   +
Sbjct: 116 DRKASMIISGSRDKTIKVW-------TIKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTV 168

Query: 120 ATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW-- 177
            +   DK V  W  +    +F+  +    H+ +V  +       L+AS+  D  + +W  
Sbjct: 169 ISAGNDKMVKAWNLN----QFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNL 224

Query: 178 ---------AEQDDDWECA--------AVLSGHGGTVWCSDFE------RAET------- 207
                    + QD+ +  A        A  +  G  ++C D +      R E        
Sbjct: 225 AEKKAMYTLSAQDEVFSLAFSPNRYWLAAATASGIKIFCLDPQSLIDDLRPEFAGYNKSA 284

Query: 208 ------------GIRLCSGSDDTTVRIWRCLT 227
                       G  L +G  D+ +R+W+ +T
Sbjct: 285 EPHAVSLAWSADGQTLFAGYTDSVIRVWQVMT 316

>Kwal_56.24526
          Length = 1210

 Score = 57.4 bits (137), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 77/296 (26%), Positives = 122/296 (41%), Gaps = 61/296 (20%)

Query: 8   RSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPH 67
           + L  H  R W       L+A  S+   I+L D R   L+ + +D  H+  VR + + P 
Sbjct: 15  KGLAFHPSRPWV------LVALFSSS--IQLWDYRMGTLLHKFED--HEGPVRGIDFHPT 64

Query: 68  CNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKS 127
             +  +   D T+ +W  D        + L  + GH + V++V +  +  ++ + S D++
Sbjct: 65  QPLFVSAGDDYTIKVWSLDTK------KCLFTLNGHLDYVRTVFFHRELPWIISASDDQT 118

Query: 128 VWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW---------- 177
           + IW      +E  C   L  H+  V    +H +  L+ S+S D+TVR+W          
Sbjct: 119 IRIWNWQN-RKEIAC---LTGHNHFVMCADFHPTEDLVVSASLDETVRVWDISGLRKRHS 174

Query: 178 ------------AEQD------DDWECAAVLSGHG-GTVWCSDFERAETGIRLCSGSDDT 218
                       A+Q+       D     +L GH  G  W S F    T   + SG DD 
Sbjct: 175 APSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHSRGVNWAS-FH--PTLPLIVSGGDDR 231

Query: 219 TVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSA-DGLIASVGSDGVLAV 273
            V++WR  +       K W  +T     HT  V SV +     LI SVG D  + V
Sbjct: 232 QVKLWRMSS------TKAWEVDTC--RGHTNNVDSVIFHPHQNLIISVGEDKTVRV 279

 Score = 36.2 bits (82), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 48/247 (19%), Positives = 97/247 (39%), Gaps = 41/247 (16%)

Query: 3   NLHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSV 62
           +L  VR++  H +  W        + + S D+ I++ + +N K +  L  T H   V   
Sbjct: 94  HLDYVRTVFFHRELPW--------IISASDDQTIRIWNWQNRKEIACL--TGHNHFVMCA 143

Query: 63  AWRPHCNVLAAGSFDTTVSIWGRD--------------DDDYSGETELL----------A 98
            + P  +++ + S D TV +W                 +D  + +  LL           
Sbjct: 144 DFHPTEDLVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKF 203

Query: 99  VIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVW 158
           ++EGH   V   ++      + +   D+ V +W     ++ +E ++  + H+ +V  +++
Sbjct: 204 ILEGHSRGVNWASFHPTLPLIVSGGDDRQVKLWRMSS-TKAWEVDTC-RGHTNNVDSVIF 261

Query: 159 HASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDT 218
           H  + L+ S   D TVR+W    D               W     RA   I L   + D+
Sbjct: 262 HPHQNLIISVGEDKTVRVW--DLDKRTPVKQFKRENDRFWLV---RAHPNINLFGAAHDS 316

Query: 219 TVRIWRC 225
            + +++ 
Sbjct: 317 GIMVFKL 323

 Score = 33.1 bits (74), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 51/116 (43%), Gaps = 6/116 (5%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGR 85
           L+ +G  DR++KL  + + K  E      H   V SV + PH N++ +   D TV +W  
Sbjct: 223 LIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTVRVWDL 282

Query: 86  DD----DDYSGETELLAVIEGHENEVKSVAWSHD-GAYLATCSRDKSVWIWEADEL 136
           D       +  E +   ++  H N +     +HD G  +    R++   +   ++L
Sbjct: 283 DKRTPVKQFKRENDRFWLVRAHPN-INLFGAAHDSGIMVFKLDRERPCSVINQNQL 337

>Scas_721.115*
          Length = 318

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 89/217 (41%), Gaps = 30/217 (13%)

Query: 67  HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDK 126
             N+L +GS D T+  W    DD      + +  +GH + V+    + DGAY  + S DK
Sbjct: 29  QPNLLLSGSRDKTLISWKLTGDDQKFGVPVRS-FKGHSHIVQDCTLTQDGAYALSASWDK 87

Query: 127 SVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWEC 186
           ++ +W+        E       H  DV  +       ++ S S D T+++W  +    +C
Sbjct: 88  TLRLWDV----ATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKG---QC 140

Query: 187 AAVLSGHGGTVWCSDFERAET-----GIRLCSGSDDTTVRIWRC--LTDDADVFDKEWIQ 239
            A L GH    W S    A T      + + S  +D  V+ W       +AD        
Sbjct: 141 LATLLGHND--WVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVG----- 193

Query: 240 ETVLPAVHTRAVYSVSWSADG-LIASVGSDGVLAVYK 275
                  H   V +V+ S DG LIAS G DG + ++ 
Sbjct: 194 -------HNGNVNTVTASPDGTLIASAGKDGEIMLWN 223

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 55/272 (20%), Positives = 104/272 (38%), Gaps = 70/272 (25%)

Query: 5   HLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAW 64
           H+V+   L  D  +++        + S D+ ++L DV   +  +      HK  V SVA 
Sbjct: 66  HIVQDCTLTQDGAYAL--------SASWDKTLRLWDVATGETYQRF--VGHKSDVMSVAI 115

Query: 65  RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSH-----DGAYL 119
               +++ +GS D T+ +W       + + + LA + GH + V  V  +      D   +
Sbjct: 116 DRKASMIISGSRDKTIKVW-------TIKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTV 168

Query: 120 ATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW-- 177
            +   DK V  W  +    +F+  +    H+ +V  +       L+AS+  D  + +W  
Sbjct: 169 ISAGNDKMVKAWNLN----QFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNL 224

Query: 178 ---------AEQDDDWECA--------AVLSGHGGTVWCSDFE------RAET------- 207
                    + QD+ +  A        A  +  G  ++C D +      R E        
Sbjct: 225 AEKKAMYTLSAQDEVFALAFSPNRYWLAAATASGIKIFCLDPQSLVDDLRPEFAGYNKSA 284

Query: 208 ------------GIRLCSGSDDTTVRIWRCLT 227
                       G  L +G  D+ +R+W+ +T
Sbjct: 285 EPHAVSLAWSADGQTLFAGYTDSVIRVWQVMT 316

>Kwal_56.23920
          Length = 937

 Score = 57.0 bits (136), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 78/184 (42%), Gaps = 15/184 (8%)

Query: 2   PNLHLVRSLKLH-GDRCWSVDISKG--LLATGSADRKIKLVDVRNFKLVEELDDTAHKKA 58
           P L +     L   D   +V IS    LLA    D  +K+  + + K    L    HK  
Sbjct: 512 PKLKMFHDTTLELNDDVLAVKISPDNRLLAVSLLDNTVKVFFMDSMKFFLSL--YGHKLP 569

Query: 59  VRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAY 118
           V S+       +L   S D  + IWG D  D      L A    H + +  V +  +   
Sbjct: 570 VLSIDISFDSKLLITSSADKNIKIWGLDFGDC--HRSLFA----HNDSIMKVVFVPESHN 623

Query: 119 LATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWA 178
             +CS+D  V  W+ D+    FEC   L  H ++V  +   +    + S+S+D ++R+W+
Sbjct: 624 FFSCSKDALVKYWDGDK----FECIQKLAAHQKEVWTLAISSDGRFVVSASHDQSIRVWS 679

Query: 179 EQDD 182
           E DD
Sbjct: 680 ETDD 683

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 96/244 (39%), Gaps = 40/244 (16%)

Query: 1   MPNLHLVRSLKLHGDR--CWSVDIS--KGLLATGSADRKIKLVDVRNFKLVEELDDTAHK 56
           MP+   + S+ + G R    ++DIS    LLAT S +  +K+ +++    +   +     
Sbjct: 370 MPSPPKLHSIDIRGHRSDVRAIDISGDNKLLATAS-NGTLKIWNIKTNSCIRTFE----- 423

Query: 57  KAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYS----GETELLAVIEG-HENEVKSVA 111
                  +   C  L  G+    + + G    D        + LL  IEG H   + S+ 
Sbjct: 424 -----CGYALACKFLPGGA----LVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLD 474

Query: 112 WSHDGAYLATCSRDKSVWIWE-----------ADELSEEFEC-NSVLQEHSQDVKHIVWH 159
            + DG  L T S DK+V  W+            D+ + + +  +    E + DV  +   
Sbjct: 475 MTTDGKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKIS 534

Query: 160 ASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTT 219
               LLA S  D+TV+++    D  +    L GH   V   D         L + S D  
Sbjct: 535 PDNRLLAVSLLDNTVKVFFM--DSMKFFLSLYGHKLPVLSIDISFDSK--LLITSSADKN 590

Query: 220 VRIW 223
           ++IW
Sbjct: 591 IKIW 594

 Score = 33.1 bits (74), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 50/121 (41%), Gaps = 17/121 (14%)

Query: 12  LHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVL 71
           L    CWS+  S  L+ T +       VD ++ K  E             + + P   +L
Sbjct: 42  LENVNCWSMK-SGELIGTLTDGLPPGAVDAKSTKPAE----------TSYLQYHPETRLL 90

Query: 72  AAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIW 131
           A G  D  + IW     D   ++ L++   GH++ +  + +   G  L + SRD  + +W
Sbjct: 91  AVGYNDGAIKIW-----DLLSKSVLIS-FNGHKSAITILTFDQTGTRLISGSRDSDIIVW 144

Query: 132 E 132
           +
Sbjct: 145 D 145

>YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the
           COPII coat of vesicles involved in endoplasmic reticulum
           to Golgi transport, contains six WD (WD-40) repeats [894
           bp, 297 aa]
          Length = 297

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 80/287 (27%), Positives = 120/287 (41%), Gaps = 40/287 (13%)

Query: 27  LATGSADRKIKLVDVR--NFKLVEELDDTAHKKAVRSVAW-RPHC-NVLAAGSFDTTVSI 82
           LAT S+D+ IK+ +V     KL++ L  T H+  V  V W  P    +LA+ S+D  V I
Sbjct: 24  LATCSSDKTIKIFEVEGETHKLIDTL--TGHEGPVWRVDWAHPKFGTILASCSYDGKVLI 81

Query: 83  WGRDDDDYSGETELLAVIEGHENEVKSVAWS-HD-GAYLATCSRDKSVWIWEADELSEEF 140
           W  ++  +S     +AV   H   V SV W+ H+ G  L   S D  V + E  E     
Sbjct: 82  WKEENGRWS----QIAVHAVHSASVNSVQWAPHEYGPLLLVASSDGKVSVVEFKENGTTS 137

Query: 141 ECNSVLQEHSQDVKHIVWHASRL-------------LLASSSYDDTVRIWAEQDD--DWE 185
               ++  H+  V    W  + +                +   D+ V+IW    D   + 
Sbjct: 138 PI--IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYV 195

Query: 186 CAAVLSGHGGTVWCSDFERAETGI---RLCSGSDDTTVRIWRCLTDDADVFDKEWIQETV 242
             + L GH    W  D   + T +    L S S D T  IW    ++   + K  ++E  
Sbjct: 196 LESTLEGHSD--WVRDVAWSPTVLLRSYLASVSQDRTCIIW-TQDNEQGPWKKTLLKEEK 252

Query: 243 LPAVHTRAVYSVSWSADG-LIASVGSDGVLAVYKEVQAGRWEVVARV 288
            P V  RA    SWS  G ++A  G D  + ++KE   G+WE    V
Sbjct: 253 FPDVLWRA----SWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEV 295

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 71/176 (40%), Gaps = 16/176 (9%)

Query: 96  LLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKH 155
           ++ +   H   +      + G  LATCS DK++ I+E +   E  +    L  H   V  
Sbjct: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVE--GETHKLIDTLTGHEGPVWR 58

Query: 156 IVWHASRL--LLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCS 213
           + W   +   +LAS SYD  V IW E++  W   AV + H  +V    +   E G  L  
Sbjct: 59  VDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLV 118

Query: 214 GSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDG 269
            S D  V +          F +      ++   H   V S SW+     A++  DG
Sbjct: 119 ASSDGKVSVVE--------FKENGTTSPIIIDAHAIGVNSASWAP----ATIEEDG 162

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 86/200 (43%), Gaps = 26/200 (13%)

Query: 6   LVRSLKLHGDRCWSVDISKG----LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRS 61
           L+ +L  H    W VD +      +LA+ S D K+ +    N +  +      H  +V S
Sbjct: 45  LIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNS 104

Query: 62  VAWRPH--CNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS------ 113
           V W PH    +L   S D  VS+    ++   G T  + +I+ H   V S +W+      
Sbjct: 105 VQWAPHEYGPLLLVASSDGKVSVVEFKEN---GTTSPI-IIDAHAIGVNSASWAPATIEE 160

Query: 114 ---HDGAY----LATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLL-- 164
              H+G        T   D  V IW+ +  ++ +   S L+ HS  V+ + W  + LL  
Sbjct: 161 DGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRS 220

Query: 165 -LASSSYDDTVRIWAEQDDD 183
            LAS S D T  IW + ++ 
Sbjct: 221 YLASVSQDRTCIIWTQDNEQ 240

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 48/164 (29%), Positives = 72/164 (43%), Gaps = 14/164 (8%)

Query: 60  RSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYL 119
           +++A+ P    +    F +T+ +W     DY     LL   E HE  V+ V +       
Sbjct: 15  KAIAFHPSRPWVLVALFSSTIQLW-----DYRMGV-LLHRFEEHEGPVRGVDFHPTQPLF 68

Query: 120 ATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAE 179
            +   D S+ +W    LS   +C   L  H   V+ + +H     + S+S D T+RIW  
Sbjct: 69  VSAGDDYSIKVWS---LSTH-KCLFTLNGHLDYVRTVFFHTELPWIISASDDQTIRIWNW 124

Query: 180 QDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           Q+      A L+GH   V C+ F   E  +   S S D TVRIW
Sbjct: 125 QNR--REIACLTGHNHFVMCAQFHPTEDLV--VSASLDETVRIW 164

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 73/296 (24%), Positives = 120/296 (40%), Gaps = 59/296 (19%)

Query: 8   RSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPH 67
           +++  H  R W       L+A  S+   I+L D R   L+   ++  H+  VR V + P 
Sbjct: 15  KAIAFHPSRPWV------LVALFSS--TIQLWDYRMGVLLHRFEE--HEGPVRGVDFHPT 64

Query: 68  CNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKS 127
             +  +   D ++ +W           + L  + GH + V++V +  +  ++ + S D++
Sbjct: 65  QPLFVSAGDDYSIKVWSLSTH------KCLFTLNGHLDYVRTVFFHTELPWIISASDDQT 118

Query: 128 VWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW---------- 177
           + IW       E  C   L  H+  V    +H +  L+ S+S D+TVRIW          
Sbjct: 119 IRIWNWQN-RREIAC---LTGHNHFVMCAQFHPTEDLVVSASLDETVRIWDISGLRKRHS 174

Query: 178 ------------AEQD------DDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTT 219
                        +Q+       D     +L GH   V  + F    T   + SGSDD  
Sbjct: 175 APGSQSFEEQMITQQNLFDGGFGDCVVKFILEGHTRGVNWASFH--PTLPLIVSGSDDRQ 232

Query: 220 VRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSA-DGLIASVGSDGVLAVY 274
           V++WR  +       K W  +T     HT  V SV +     LI SVG D  + V+
Sbjct: 233 VKLWRMSS------TKAWEVDTCRG--HTNNVDSVIFHPFQNLIISVGEDSTIRVW 280

 Score = 35.0 bits (79), Expect = 0.078,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 43/98 (43%), Gaps = 5/98 (5%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGR 85
           L+ +GS DR++KL  + + K  E      H   V SV + P  N++ +   D+T+ +W  
Sbjct: 223 LIVSGSDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPFQNLIISVGEDSTIRVWDL 282

Query: 86  DD----DDYSGETELLAVIEGHENEVKSVAWSHDGAYL 119
           D       +  E +    I  H N V     +HD   +
Sbjct: 283 DKRTPVKQFKREQDRFWSIRAHPN-VNLFGAAHDSGIM 319

 Score = 31.2 bits (69), Expect = 1.6,   Method: Composition-based stats.
 Identities = 19/82 (23%), Positives = 36/82 (43%), Gaps = 4/82 (4%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
            H + V   ++ P   ++ +GS D  V +W R     + E +      GH N V SV + 
Sbjct: 207 GHTRGVNWASFHPTLPLIVSGSDDRQVKLW-RMSSTKAWEVD---TCRGHTNNVDSVIFH 262

Query: 114 HDGAYLATCSRDKSVWIWEADE 135
                + +   D ++ +W+ D+
Sbjct: 263 PFQNLIISVGEDSTIRVWDLDK 284

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/217 (26%), Positives = 93/217 (42%), Gaps = 36/217 (16%)

Query: 27  LATGSADRKIKLVDVRNFKLVEEL-DDTAHKKA-----------VRSVAWRPHCNVLAAG 74
           LATG  ++  K+ +V    LV EL DDT                +RSV + P    LA G
Sbjct: 333 LATG-CNKTTKIFEVATGNLVTELVDDTKTGTEDANSASSADLYIRSVCFSPDGKFLATG 391

Query: 75  SFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEAD 134
           + D  + IW         + +++ V+ GHE ++ S+ +   G  L + S D+++ IW+  
Sbjct: 392 AEDKLIRIWD------IAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDL- 444

Query: 135 ELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQ--------DDDWEC 186
                 +C+  L          V   +   +A+ S D TVR+W           D + E 
Sbjct: 445 ---HTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGET 501

Query: 187 AAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
                GH  +V+   F R   G  + SGS D +V++W
Sbjct: 502 GV---GHKDSVYSVVFTR--DGKNIVSGSLDRSVKLW 533

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 75/157 (47%), Gaps = 17/157 (10%)

Query: 107 VKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLA 166
           ++SV +S DG +LAT + DK + IW+      + +   VL+ H QD+  + +  S   L 
Sbjct: 376 IRSVCFSPDGKFLATGAEDKLIRIWDI----AQRKIVMVLRGHEQDIYSLDYFQSGNKLV 431

Query: 167 SSSYDDTVRIWAEQDDDWECAAVLSGHGG--TVWCSDFERAETGIRLCSGSDDTTVRIWR 224
           S S D T+RIW       +C+  LS   G  TV  S       G  + +GS D TVR+W 
Sbjct: 432 SGSGDRTIRIWDLH--TGQCSLTLSIEDGVTTVAVS----PGNGNYVAAGSLDRTVRVW- 484

Query: 225 CLTDDADVFDKEWIQETVLPAV-HTRAVYSVSWSADG 260
              D    F  E +       V H  +VYSV ++ DG
Sbjct: 485 ---DSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDG 518

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 69/137 (50%), Gaps = 21/137 (15%)

Query: 6   LVRSLKLHGDRCWSVDI--SKGLLATGSADRKIKLVDVRNFK--LVEELDDTAHKKAVRS 61
           +V  L+ H    +S+D   S   L +GS DR I++ D+   +  L   ++D      V +
Sbjct: 407 IVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTGQCSLTLSIED-----GVTT 461

Query: 62  VAWRP-HCNVLAAGSFDTTVSIWGRDDD------DYSGETELLAVIEGHENEVKSVAWSH 114
           VA  P + N +AAGS D TV +W  +        D  GET +     GH++ V SV ++ 
Sbjct: 462 VAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGV-----GHKDSVYSVVFTR 516

Query: 115 DGAYLATCSRDKSVWIW 131
           DG  + + S D+SV +W
Sbjct: 517 DGKNIVSGSLDRSVKLW 533

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 65/135 (48%), Gaps = 23/135 (17%)

Query: 103 HENEVKSVAWSHDGAYLAT-CSRDKSVWIWEADELSEEF---------ECNSVLQEHSQD 152
           H++ V  V +S++G YLAT C++   ++      L  E          + NS     S D
Sbjct: 317 HDSVVCCVKFSNNGEYLATGCNKTTKIFEVATGNLVTELVDDTKTGTEDANSA---SSAD 373

Query: 153 --VKHIVWHASRLLLASSSYDDTVRIW--AEQDDDWECAAVLSGHGGTVWCSDFERAETG 208
             ++ + +      LA+ + D  +RIW  A++    +   VL GH   ++  D+   ++G
Sbjct: 374 LYIRSVCFSPDGKFLATGAEDKLIRIWDIAQR----KIVMVLRGHEQDIYSLDY--FQSG 427

Query: 209 IRLCSGSDDTTVRIW 223
            +L SGS D T+RIW
Sbjct: 428 NKLVSGSGDRTIRIW 442

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 76/154 (49%), Gaps = 19/154 (12%)

Query: 70  VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVW 129
           +L  GS+DTTV+IW    D ++G+  L+  + GH + VK++ +  D   L T S DK++ 
Sbjct: 346 LLFTGSYDTTVAIW----DLFTGK--LIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIR 397

Query: 130 IWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAV 189
           +W         EC S  + H+  V  +  H  + ++ S S D TV++W  +         
Sbjct: 398 VWNY----ITGECISTYRGHTDSVMSVDSH--KKIIVSGSADKTVKVWHVES---RTCYT 448

Query: 190 LSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           L GH  T W +  +         S SDDTT+R+W
Sbjct: 449 LKGH--TEWVNCVKLHPKSFSCYSCSDDTTIRMW 480

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 87/194 (44%), Gaps = 19/194 (9%)

Query: 4   LHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVA 63
           L  ++  K H D   ++  +  LL TGS D  + + D+   KL+  L  T H   V+++ 
Sbjct: 324 LCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRL--TGHSDGVKTLY 381

Query: 64  WRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCS 123
           +      L  GS D T+ +W       +G  E ++   GH + V SV  SH    + + S
Sbjct: 382 FDDQ--KLITGSLDKTIRVWNY----ITG--ECISTYRGHTDSVMSVD-SHK-KIIVSGS 431

Query: 124 RDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDD 183
            DK+V +W      E   C + L+ H++ V  +  H       S S D T+R+W  + + 
Sbjct: 432 ADKTVKVWHV----ESRTCYT-LKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTN- 485

Query: 184 WECAAVLSGHGGTV 197
             C  V  GH G V
Sbjct: 486 -TCLRVFRGHVGQV 498

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 97/226 (42%), Gaps = 34/226 (15%)

Query: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKL--VDVRNFKLVEELDDTAHKKAVRSVAW 64
           + + + H D   SVD  K ++ +GSAD+ +K+  V+ R    ++      H + V  V  
Sbjct: 407 ISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLK-----GHTEWVNCVKL 461

Query: 65  RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSH--DGAYLATC 122
            P      + S DTT+ +W     D    T  L V  GH  +V+ V      D   L T 
Sbjct: 462 HPKSFSCYSCSDDTTIRMW-----DIRTNT-CLRVFRGHVGQVQKVIPLTIIDAQNLVTH 515

Query: 123 SRDKSVWIWEADELS-----EEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
            R       E D+++     E+   N V  +   D K  + + + LL  S + D+T+++W
Sbjct: 516 ERKPG----EEDDIASNGTGEDDPENGVNGQRELDKK--MPYPTHLL--SCALDNTIKLW 567

Query: 178 AEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
             +     C     GH   VW    + A    R+ SGS D +++IW
Sbjct: 568 EVRSG--RCIRTQFGHVEGVW----DIAADNFRIISGSHDGSIKIW 607

 Score = 28.9 bits (63), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 10/66 (15%)

Query: 164 LLASSSYDDTVRIWAEQDDDWECAAV--LSGHGGTVWCSDFERAETGIRLCSGSDDTTVR 221
           LL + SYD TV IW    D +    +  L+GH   V    F+      +L +GS D T+R
Sbjct: 346 LLFTGSYDTTVAIW----DLFTGKLIRRLTGHSDGVKTLYFDDQ----KLITGSLDKTIR 397

Query: 222 IWRCLT 227
           +W  +T
Sbjct: 398 VWNYIT 403

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 93/244 (38%), Gaps = 30/244 (12%)

Query: 66  PHCNVLAAGSFDTTVSIWGRDD-------DDYSGETELL----AVIEGHENEVKSVAWSH 114
           P    LA G  D  + IW   D        + S + ++L    + +  H   V +V +S 
Sbjct: 27  PDSQRLATGGLDGKIRIWSIPDILKFASNPNASTDKDILMKPLSTMSRHAGSVTTVKFSP 86

Query: 115 DGAYLATCSRDKSVWIWEAD--ELSEEFECNSV----------LQEHSQDVKHIVWHASR 162
           DG YLA+ S D+ + IWE +       F   S           L  H  D++ I W    
Sbjct: 87  DGKYLASGSDDRILLIWELEGGTTQPMFGAESTDIEHWNVRRRLVAHDNDIQDICWAPDS 146

Query: 163 LLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRI 222
            ++ S   D  + IW      +E       H   V    F+ A       + SDD T+++
Sbjct: 147 SIMVSVGLDRAIIIW--NGSTFEKVKRFDVHQSHVKGVVFDPANK--YFATASDDRTIKM 202

Query: 223 WRCLTDDADVFDKEW-IQETVLPAVHTRAVYSVSWSADG--LIASVGSDGVLAVYKEVQA 279
           +R        F  E  I E    +  T     +SWS DG  + A    +G ++    ++ 
Sbjct: 203 FRYHKTGETSFSVEHVITEPFKGSPLTTYFRRLSWSPDGQHIAAPNAMNGPVSTVAIIER 262

Query: 280 GRWE 283
           G WE
Sbjct: 263 GTWE 266

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 78/360 (21%), Positives = 138/360 (38%), Gaps = 89/360 (24%)

Query: 27  LATGSADRKIKL---VDVRNFK-----------LVEELDDTA-HKKAVRSVAWRPHCNVL 71
           LATG  D KI++    D+  F            L++ L   + H  +V +V + P    L
Sbjct: 32  LATGGLDGKIRIWSIPDILKFASNPNASTDKDILMKPLSTMSRHAGSVTTVKFSPDGKYL 91

Query: 72  AAGSFDTTVSIW----GRDDDDYSGET------ELLAVIEGHENEVKSVAWSHDGAYLAT 121
           A+GS D  + IW    G     +  E+       +   +  H+N+++ + W+ D + + +
Sbjct: 92  ASGSDDRILLIWELEGGTTQPMFGAESTDIEHWNVRRRLVAHDNDIQDICWAPDSSIMVS 151

Query: 122 CSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQ- 180
              D+++ IW        FE       H   VK +V+  +    A++S D T++++    
Sbjct: 152 VGLDRAIIIWNG----STFEKVKRFDVHQSHVKGVVFDPANKYFATASDDRTIKMFRYHK 207

Query: 181 -------------------------------DDDWECAAVLSGHGGTVWCSDFERA--ET 207
                                           D    AA  + +G     +  ER   E+
Sbjct: 208 TGETSFSVEHVITEPFKGSPLTTYFRRLSWSPDGQHIAAPNAMNGPVSTVAIIERGTWES 267

Query: 208 GIRLCSGSDDTTV-----RIWRCLTDDA--DVFDKEWIQETVLPAVHTRAVYSVSWSADG 260
            + L      T V     RI++   DD+  D  D +                 +S   D 
Sbjct: 268 PVSLVGHDQPTEVASFNPRIFKRQKDDSTTDTIDGKKT--------------GISDEVDC 313

Query: 261 LIASVGSDGVLAVYKEVQAGRWEVVARVDCAHTVYEINVVKWLALDGRVLLVTGGDDGCV 320
           ++AS G D  LAV+   +A R  +VA+  C  ++ +++   W   DG++L +T  D   V
Sbjct: 314 IVASSGQDKTLAVWSTSKA-RPLIVAQDICGKSITDMS---WTP-DGKILFITSLDSSIV 368

>CAGL0A00605g complement(67281..69203) similar to sp|P53197
           Saccharomyces cerevisiae YGL003c CDH1 substrate-specific
           activator of APC-dependent proteolysis, hypothetical
           start
          Length = 640

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/225 (27%), Positives = 107/225 (47%), Gaps = 21/225 (9%)

Query: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRP 66
           +R+L  H DR   +  +  +L++GS DR I   DVR      E  +T H++ +  + W  
Sbjct: 411 IRTLSGHLDRVACLSWNNHILSSGSRDRTILHRDVRMADPFFEKIET-HEQEICGLKWNT 469

Query: 67  HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS-HDGAYLAT--CS 123
           + N LA+G  D  V ++     D +  T  L++ E H+  VK++AWS H    LAT   +
Sbjct: 470 NDNKLASGGNDNMVFVY-----DGTSRTPFLSINE-HKAAVKAMAWSPHKQGILATGGGT 523

Query: 124 RDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASR-LLLASSSYDD-TVRIWAEQD 181
            D+++ +W    ++   + N V  +    V ++VW  +   ++ S  Y    + IW  + 
Sbjct: 524 ADRTLKMW---NVNTSVKLNDV--DTGSQVCNMVWSTNTDEIVTSHGYSKYNLTIW--EA 576

Query: 182 DDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCL 226
            + E  A+L GH   V       +  G  + SG+ D T+R W+  
Sbjct: 577 SNLEPLAILKGHSFRVL--HLTLSADGTTIVSGAGDETLRYWKLF 619

 Score = 32.0 bits (71), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 57/116 (49%), Gaps = 13/116 (11%)

Query: 24  KGLLATG--SADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCN--VLAAGSFDTT 79
           +G+LATG  +ADR +K+ +V       +L+D      V ++ W  + +  V + G     
Sbjct: 514 QGILATGGGTADRTLKMWNV---NTSVKLNDVDTGSQVCNMVWSTNTDEIVTSHGYSKYN 570

Query: 80  VSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADE 135
           ++IW       +   E LA+++GH   V  +  S DG  + + + D+++  W+  E
Sbjct: 571 LTIW------EASNLEPLAILKGHSFRVLHLTLSADGTTIVSGAGDETLRYWKLFE 620

>KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomyces
           cerevisiae YLR222c, start by similarity
          Length = 814

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 63/146 (43%), Gaps = 12/146 (8%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
           AH+K + +++  P+ ++ A  S+D T  IW  DD ++       A +  H+  +  VA+ 
Sbjct: 493 AHEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQ------ATLANHKRGLWDVAFC 546

Query: 114 HDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDT 173
                LATCS DK++ IW      E +     L+ H+  V+   +      L S+  D  
Sbjct: 547 QYDKLLATCSGDKTIKIWSL----ESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGL 602

Query: 174 VRIWAEQDDDWECAAVLSGHGGTVWC 199
           V IW       E    L  H   +W 
Sbjct: 603 VIIW--DLSTGESVKTLDAHNNRIWA 626

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 55/118 (46%), Gaps = 9/118 (7%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGR 85
           LLAT S D+ IK+  + ++ +V+ L+   H  AV+  ++      L +   D  V IW  
Sbjct: 551 LLATCSGDKTIKIWSLESYAVVKTLE--GHTNAVQRCSFINKNKQLISTGADGLVIIW-- 606

Query: 86  DDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECN 143
             D  +GE+  +  ++ H N + ++A  +DG    T   D     W  D   EE E N
Sbjct: 607 --DLSTGES--VKTLDAHNNRIWALAVMNDGESFVTADADGFFEFWR-DNSEEEHERN 659

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 56/250 (22%), Positives = 92/250 (36%), Gaps = 77/250 (30%)

Query: 84  GRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECN 143
           G + + +  E ++    EGH + + S+  + DG ++AT S+D SV +W      E+F   
Sbjct: 373 GENKETFPIEVKMY---EGHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPY 429

Query: 144 SVLQEH------------------------SQDVKHIVWHASR---------LLLASSSY 170
           +    H                        S D+    W   +         +L+ +S Y
Sbjct: 430 TKFVGHVGSVNAVGLPNVMPRSWPEFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEY 489

Query: 171 --------------------------DDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFER 204
                                     D T +IW    DD E  A L+ H   +W   F +
Sbjct: 490 TRRAHEKDINAISISPNDSLFATASYDKTCKIW--NLDDGEFQATLANHKRGLWDVAFCQ 547

Query: 205 AETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSW-SADGLIA 263
            +  +  CSG  D T++IW  L   A V   E          HT AV   S+ + +  + 
Sbjct: 548 YDKLLATCSG--DKTIKIW-SLESYAVVKTLEG---------HTNAVQRCSFINKNKQLI 595

Query: 264 SVGSDGVLAV 273
           S G+DG++ +
Sbjct: 596 STGADGLVII 605

 Score = 28.9 bits (63), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 37/83 (44%), Gaps = 7/83 (8%)

Query: 6   LVRSLKLHGD-RCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAW 64
           ++RS+K+       + D +  LLA G  D  + ++D+ N  +   L    H   + SV +
Sbjct: 94  IIRSMKISSPVYVMNCDQTSTLLAIGGTDGSVSVIDIENGYVTHSLK--GHGATISSVKF 151

Query: 65  RPHCNV----LAAGSFDTTVSIW 83
               N     LA+G  +  + +W
Sbjct: 152 HGELNSEIWKLASGDTNGMIKVW 174

>Kwal_47.17465
          Length = 800

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 63/132 (47%), Gaps = 13/132 (9%)

Query: 55  HKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDD----YSGETE-----LLAVIEGHEN 105
           H  +V  V + P  N LA+GS D  + IW +D+D     +  E +     +   +  H+N
Sbjct: 21  HTGSVTVVRFSPDGNFLASGSDDRILLIWEKDEDQKQPIFGAENDKEHWNVRRRLVAHDN 80

Query: 106 EVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLL 165
           +++ + W+ D + L T   D+SV +W        FE       H   VK +++  +    
Sbjct: 81  DIQDICWAPDSSILVTVGLDRSVIVWNGS----TFEKIKRFDVHQSLVKGVIFDPANKYF 136

Query: 166 ASSSYDDTVRIW 177
           A++S D TVRI+
Sbjct: 137 ATASDDRTVRIF 148

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 80/201 (39%), Gaps = 18/201 (8%)

Query: 97  LAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELS-----------EEFECNSV 145
           LA +  H   V  V +S DG +LA+ S D+ + IWE DE             E +     
Sbjct: 15  LASMSRHTGSVTVVRFSPDGNFLASGSDDRILLIWEKDEDQKQPIFGAENDKEHWNVRRR 74

Query: 146 LQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERA 205
           L  H  D++ I W     +L +   D +V +W      +E       H   V    F+ A
Sbjct: 75  LVAHDNDIQDICWAPDSSILVTVGLDRSVIVW--NGSTFEKIKRFDVHQSLVKGVIFDPA 132

Query: 206 ETGIRLCSGSDDTTVRIWRCLTDDADVFDKEW-IQETVLPAVHTRAVYSVSWSADG--LI 262
                  + SDD TVRI+R        F  E  + E    +  T     +SWS DG  + 
Sbjct: 133 NK--YFATASDDRTVRIFRYHKAGDMSFSIEHVVSEPFKGSPITTYFRRLSWSPDGQHIA 190

Query: 263 ASVGSDGVLAVYKEVQAGRWE 283
           A   ++G ++    +  G W+
Sbjct: 191 APNATNGPVSSVSIIARGSWD 211

 Score = 36.2 bits (82), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 8/79 (10%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGET-ELLAVIEGHENEVKSVAW 112
           AH   ++ + W P  ++L     D +V +W       +G T E +   + H++ VK V +
Sbjct: 77  AHDNDIQDICWAPDSSILVTVGLDRSVIVW-------NGSTFEKIKRFDVHQSLVKGVIF 129

Query: 113 SHDGAYLATCSRDKSVWIW 131
                Y AT S D++V I+
Sbjct: 130 DPANKYFATASDDRTVRIF 148

>Scas_629.12
          Length = 671

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 85/165 (51%), Gaps = 15/165 (9%)

Query: 17  CWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSF 76
           C+S D     LATG+ D+ I++ D++  K+V  L    H++ V S+ + P+   L +GS 
Sbjct: 394 CFSPD--GEFLATGAEDKLIRIWDIQERKIVMVLK--GHEQDVYSLDYFPNGEKLVSGSG 449

Query: 77  DTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS-HDGAYLATCSRDKSVWIWEADE 135
           D TV IW    D  +G+  L   IE     V +VA S +DG ++A  S D++V +W++  
Sbjct: 450 DRTVRIW----DLRTGQCSLTLSIEYG---VTTVAVSPNDGKFIAAGSLDRAVRVWDSTT 502

Query: 136 --LSEEFEC-NSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
             L E  +  N +   H   V  +V+      + S S D TV++W
Sbjct: 503 GFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLW 547

 Score = 53.9 bits (128), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 80/172 (46%), Gaps = 24/172 (13%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDD-----TAHKKAVRSVAWRPHCNVLAAGSFDTTV 80
            +A GS DR +++ D     LVE LD      T H+ +V SV +    N + +GS D TV
Sbjct: 485 FIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTV 544

Query: 81  SIW-----GRDDDDYSGETELLAVIE----GHENEVKSVAWSHDGAYLATCSRDKSVWIW 131
            +W     G  +++ + +    A  E    GH++ V SV  S D  Y+ + S+D+ +  W
Sbjct: 545 KLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFW 604

Query: 132 EADELSEEFECNSVLQEHSQDVKHI-VWHASRL-----LLASSSYDDTVRIW 177
           + +  +       +LQ H   V  + V + S L     + A+ S D   RIW
Sbjct: 605 DKESGNPLL----MLQGHRNSVISVAVANGSALGPKYNVFATGSGDCKARIW 652

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 77/173 (44%), Gaps = 23/173 (13%)

Query: 59  VRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAY 118
           +RSV + P    LA G+ D  + IW         E +++ V++GHE +V S+ +  +G  
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIWDIQ------ERKIVMVLKGHEQDVYSLDYFPNGEK 443

Query: 119 LATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW- 177
           L + S D++V IW+        +C+  L          V       +A+ S D  VR+W 
Sbjct: 444 LVSGSGDRTVRIWDL----RTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWD 499

Query: 178 -------AEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
                     D + E     +GH  +V+   F R   G  + SGS D TV++W
Sbjct: 500 STTGFLVERLDSENELG---TGHRDSVYSVVFTR--DGNEVVSGSLDKTVKLW 547

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 61/134 (45%), Gaps = 17/134 (12%)

Query: 103 HENEVKSVAWSHDGAYLAT-CSRDKSVWIWEADELSEEFECNSVLQEHSQD--------- 152
           H + V  V +S+DG +LAT C++   ++     EL  +   +SV    +           
Sbjct: 327 HSSVVCCVKFSNDGQFLATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPST 386

Query: 153 ---VKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGI 209
              ++ + +      LA+ + D  +RIW  Q  + +   VL GH   V+  D+     G 
Sbjct: 387 DLYIRSVCFSPDGEFLATGAEDKLIRIWDIQ--ERKIVMVLKGHEQDVYSLDY--FPNGE 442

Query: 210 RLCSGSDDTTVRIW 223
           +L SGS D TVRIW
Sbjct: 443 KLVSGSGDRTVRIW 456

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/220 (27%), Positives = 94/220 (42%), Gaps = 29/220 (13%)

Query: 67  HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDK 126
             N+L +GS D T+  W   +++      + +  +GH + V+ V  S DG Y  + S DK
Sbjct: 30  QPNLLVSGSRDKTLISWRLTENEQQFGVPVRS-YKGHSHIVQDVVVSADGNYAVSASWDK 88

Query: 127 SVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWEC 186
           ++ +W     + E    +    H+ DV  +   A+   + S+S D T+R+W    D   C
Sbjct: 89  TLRLWNLATGNSE----ARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGD---C 141

Query: 187 AAVLSGHGGTVWCSDFERAETG----------IRLCSGSDDTTVRIWRCLTDDADVFDKE 236
           A VL GH  T W +    A             I   S   D  VR W  L +D+   + +
Sbjct: 142 AYVLLGH--TDWVTKVRVAPKNLEDGEVDDGRITFVSAGMDKIVRSW-SLNEDSYRIEAD 198

Query: 237 WIQETVLPAVHTRAVYSVSWSADG-LIASVGSDGVLAVYK 275
           +I        H   +  V  S DG L AS G DG + V+ 
Sbjct: 199 FIG-------HNNYINVVQPSPDGSLAASAGKDGQIYVWN 231

>KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces
           cerevisiae YGL003c CDH1 substrate-specific activator of
           APC-dependent proteolysis, start by similarity
          Length = 582

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 109/235 (46%), Gaps = 28/235 (11%)

Query: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRP 66
           +R+L  H DR   +  +  +L++GS DRKI   DVR  +   E  DT H + V  + W  
Sbjct: 353 IRTLSGHVDRVACLSWNNHVLSSGSRDRKILHRDVRAPEPFFEQIDT-HSQEVCGLKWNV 411

Query: 67  HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS-HDGAYLAT--CS 123
           + N LA+G  D  V ++     D +    +L+ +E H   VK++AWS H    LAT   +
Sbjct: 412 NENKLASGGNDNMVYVY-----DGTLRQPMLS-MEEHTAAVKAMAWSPHTRGVLATGGGT 465

Query: 124 RDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASR-LLLASSSYDD-TVRIWAEQD 181
            DK + IW    +S+  + N V  +    + +++W  +   ++ S  Y    + +W    
Sbjct: 466 ADKKLKIW---NISKAVKLNEV--DTGSQLCNMLWSKNTDEIITSHGYSKYNLTLWNYP- 519

Query: 182 DDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKE 236
              E  AVL GH   V       +  G  + SG+ D T+R W+       +FDK 
Sbjct: 520 -TLEPMAVLKGHSFRVL--HLTLSADGTTVVSGAGDETLRYWK-------LFDKP 564

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 95/225 (42%), Gaps = 15/225 (6%)

Query: 3   NLHLVRSLKLHGDRCWSVDISKGL--LATGSADRKIKLVDVRNFKLVEELDDTAHKKAVR 60
           N + V S + H     SV   +    + T S D  IK+ DVR+  +        H   V 
Sbjct: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY---KHNAPVN 120

Query: 61  SVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLA 120
            V   P+   L +   D  + IW   ++  + +     +    +  ++S++ + DG+ LA
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQ-----LTPEDDTSLQSLSMASDGSMLA 175

Query: 121 TCSRDKSVWIWEADELSEEFECNSV--LQEHSQDVKHIVWHASRLLLASSSYDDTVRIWA 178
             +   + ++WE    ++      V   + HS  +  I+  +    LA+ S D T R+W+
Sbjct: 176 AANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWS 235

Query: 179 EQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
             DDD++    L GH   VW   F  +     L + S D  VR+W
Sbjct: 236 -IDDDFKLETTLDGHQRWVWDCAF--SADSAYLVTASSDHYVRLW 277

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 41/94 (43%), Gaps = 7/94 (7%)

Query: 39  VDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLA 98
            D  + K V +    AH   +  +        LA  S D T  +W  DDD      +L  
Sbjct: 192 TDASHLKPVTKF--RAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD-----FKLET 244

Query: 99  VIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWE 132
            ++GH+  V   A+S D AYL T S D  V +W+
Sbjct: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 77/185 (41%), Gaps = 15/185 (8%)

Query: 1   MPNLHLVRSLKLH-GDRCWSVDISKG--LLATGSADRKIKLVDVRNFKLVEELDDTAHKK 57
           +P L LV    L   D   +V IS     LA    D  +K+    + K    L    HK 
Sbjct: 508 IPQLKLVHDTTLELTDDILAVKISSEDRYLAVSLLDNTVKVFFFDSLKFYLSL--YGHKL 565

Query: 58  AVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGA 117
            V S+ +     +L   S D  + IWG D  D          I  H++ + SV +  D  
Sbjct: 566 PVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKS------IFAHQDSIMSVRFEADTH 619

Query: 118 YLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
              +C +D +V  W+ D+    F+C   L  H  +V  I        + S+S+D ++R+W
Sbjct: 620 NFFSCGKDGAVKRWDGDK----FDCIQKLNGHQSEVWCIAVSPDGRTVVSTSHDHSIRVW 675

Query: 178 AEQDD 182
            E DD
Sbjct: 676 QETDD 680

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 88/222 (39%), Gaps = 34/222 (15%)

Query: 100 IEGHENEVKSVAWSHDGAYLATCSRDK-SVWIWEADELSEEFECNSVLQEHSQDVKHIVW 158
           ++GH  +++S+  S DG  L+T S  +  VW     +    F C   L            
Sbjct: 379 LQGHRTDIRSMDISDDGKLLSTASNGELKVWNLTTKKCIRTFSCGYALCSQ--------M 430

Query: 159 HASRLLLASSSYDDTVRIWAEQDDDWECAAVLS---GHGGTVWCSDFERAETGIRLCSGS 215
               LL+   +    ++++     D   + +LS    H   +W  D      G RL +GS
Sbjct: 431 LPGGLLVVVGTRQGELQLF-----DLASSTLLSTTEAHTAAIWSLDL--TSNGKRLVTGS 483

Query: 216 DDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYK 275
            D + + W     D +V       E ++P    + +  +    D  +    +D +LAV K
Sbjct: 484 ADKSCKFW-----DFEVV------EQLVPGTKDKYIPQLKLVHDTTLEL--TDDILAV-K 529

Query: 276 EVQAGRWEVVARVDCAHTVYEINVVK-WLALDGRVLLVTGGD 316
                R+  V+ +D    V+  + +K +L+L G  L V   D
Sbjct: 530 ISSEDRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSID 571

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 58/140 (41%), Gaps = 16/140 (11%)

Query: 96  LLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWE---ADELSEEFECNSVLQ----- 147
           LL+  E H   + S+  + +G  L T S DKS   W+    ++L    +   + Q     
Sbjct: 456 LLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVH 515

Query: 148 ----EHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFE 203
               E + D+  +   +    LA S  D+TV+++    D  +    L GH   V   DF 
Sbjct: 516 DTTLELTDDILAVKISSEDRYLAVSLLDNTVKVFFF--DSLKFYLSLYGHKLPVLSIDF- 572

Query: 204 RAETGIRLCSGSDDTTVRIW 223
            +     L + S D  ++IW
Sbjct: 573 -SVDSKMLITSSADKNIKIW 591

>CAGL0J08778g 866175..867071 highly similar to sp|Q04491
           Saccharomyces cerevisiae YLR208w SEC13, start by
           similarity
          Length = 298

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 74/289 (25%), Positives = 118/289 (40%), Gaps = 41/289 (14%)

Query: 27  LATGSADRKIKLVDVR--NFKLVEELDDTAHKKAVRSVAW--RPHCNVLAAGSFDTTVSI 82
           LAT S+D+ IK+ +V   + KLV+ L    H+  V  V W       +LA+ S+D  V I
Sbjct: 24  LATCSSDKTIKIFEVEGESHKLVDTL--VGHEGPVWRVDWAHPKFGTILASCSYDGKVII 81

Query: 83  WGRDDDDYSGETELLAVIEGHENEVKSVAWS-HD-GAYLATCSRDKSVWIWEADELSEEF 140
           W  ++D +S     +AV   H   V SV W+ H+ GA L   S D  V + E  E     
Sbjct: 82  WKEENDRWS----QIAVHAVHTASVNSVQWAPHEYGALLLAASSDGKVSVVEFKENGTAT 137

Query: 141 ECNSVLQEHSQDVKHIVWHASRL--------------LLASSSYDDTVRIW--AEQDDDW 184
               +   H+  V    W  + +                 +   D+ V+IW    +   +
Sbjct: 138 PL--IFDAHAIGVNAASWAPATVEGGNNPGEAPKEVRRFVTGGADNLVKIWRYNPETQSY 195

Query: 185 ECAAVLSGHGGTVWCSDFERAETGI---RLCSGSDDTTVRIWRCLTDDADVFDKEWIQET 241
                L GH  + W  D   + + +    + S S D T  IW    +        W++  
Sbjct: 196 LVEDTLEGH--SDWVRDVAWSPSVLLRSYIASVSQDRTCNIWTQEDNTG-----PWVKTQ 248

Query: 242 VLPAVHTRAVYSVSWSADGLIASV-GSDGVLAVYKEVQAGRWEVVARVD 289
           + P      ++  SWS  G I ++ G D  + ++KE   G+WE    V+
Sbjct: 249 LTPEEFPDVLWRASWSLSGNILAISGGDNKVTLWKENLNGKWESAGEVN 297

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 59/129 (45%), Gaps = 4/129 (3%)

Query: 96  LLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKH 155
           ++ +   H + +      + G  LATCS DK++ I+E +   E  +    L  H   V  
Sbjct: 1   MVEIANAHNDLIHDAVLDYYGKKLATCSSDKTIKIFEVE--GESHKLVDTLVGHEGPVWR 58

Query: 156 IVWHASRL--LLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCS 213
           + W   +   +LAS SYD  V IW E++D W   AV + H  +V    +   E G  L +
Sbjct: 59  VDWAHPKFGTILASCSYDGKVIIWKEENDRWSQIAVHAVHTASVNSVQWAPHEYGALLLA 118

Query: 214 GSDDTTVRI 222
            S D  V +
Sbjct: 119 ASSDGKVSV 127

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 56/118 (47%), Gaps = 14/118 (11%)

Query: 208 GIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADG---LIAS 264
           G +L + S D T++I+    +   + D      T++   H   V+ V W+      ++AS
Sbjct: 21  GKKLATCSSDKTIKIFEVEGESHKLVD------TLVG--HEGPVWRVDWAHPKFGTILAS 72

Query: 265 VGSDGVLAVYKEVQAGRWEVVARVDCAHTVYEINVVKWLALDGRVLLVTGGDDGCVNV 322
              DG + ++KE +  RW  +A V   HT   +N V+W   +   LL+    DG V+V
Sbjct: 73  CSYDGKVIIWKE-ENDRWSQIA-VHAVHTA-SVNSVQWAPHEYGALLLAASSDGKVSV 127

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 98/241 (40%), Gaps = 27/241 (11%)

Query: 66  PHCNVLAAGSFDTTVSIWGRDD--DDYSGETEL-------LAVIEGHENEVKSVAWSHDG 116
           P    +A G  D  + IW  D      +GE+ +       LA +  H   V  V +S DG
Sbjct: 27  PDGKRVATGGLDGKIRIWSVDALVSAAAGESGVDRDTHRPLASMSRHTGSVTCVKFSPDG 86

Query: 117 AYLATCSRDKSVWIWEADELS-----------EEFECNSVLQEHSQDVKHIVWHASRLLL 165
            YLA+ S D+ + IW  DE +           E +     L  H  D++ I W     +L
Sbjct: 87  NYLASGSDDRILLIWAMDEENHGGSFGSEGEKEHWTVRKRLVAHDNDIQDICWAPDSSIL 146

Query: 166 ASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRC 225
            +   D +V +W     ++E       H   V    F+ A       + SDD T+R++R 
Sbjct: 147 VTVGLDRSVIVW--NGLNFERLKRFDVHQSLVKGVIFDPANK--YFATASDDRTMRVFRY 202

Query: 226 -LTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASV--GSDGVLAVYKEVQAGRW 282
             T +     ++ I E  + +  T     +SWS DG   +V   ++G ++    +  G W
Sbjct: 203 HKTGEVSFTIEQVIVEPFIASPLTTYFRRLSWSPDGQHIAVPNATNGPVSSVAIINRGTW 262

Query: 283 E 283
           +
Sbjct: 263 D 263

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 64/132 (48%), Gaps = 13/132 (9%)

Query: 55  HKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYS------GETE---LLAVIEGHEN 105
           H  +V  V + P  N LA+GS D  + IW  D++++       GE E   +   +  H+N
Sbjct: 73  HTGSVTCVKFSPDGNYLASGSDDRILLIWAMDEENHGGSFGSEGEKEHWTVRKRLVAHDN 132

Query: 106 EVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLL 165
           +++ + W+ D + L T   D+SV +W        FE       H   VK +++  +    
Sbjct: 133 DIQDICWAPDSSILVTVGLDRSVIVWNG----LNFERLKRFDVHQSLVKGVIFDPANKYF 188

Query: 166 ASSSYDDTVRIW 177
           A++S D T+R++
Sbjct: 189 ATASDDRTMRVF 200

 Score = 29.6 bits (65), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 43/123 (34%), Gaps = 35/123 (28%)

Query: 101 EGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHA 160
           E  + E+ +V  S DG  +AT   D  + IW  D L      ++   E   D        
Sbjct: 14  ESRDYEIYTVDVSPDGKRVATGGLDGKIRIWSVDAL-----VSAAAGESGVD-------- 60

Query: 161 SRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTV 220
                                D     A +S H G+V C  F  +  G  L SGSDD  +
Sbjct: 61  --------------------RDTHRPLASMSRHTGSVTCVKF--SPDGNYLASGSDDRIL 98

Query: 221 RIW 223
            IW
Sbjct: 99  LIW 101

>Scas_707.22
          Length = 730

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 101/212 (47%), Gaps = 33/212 (15%)

Query: 29  TGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDD 88
           TG+ DR++++ D R+ K ++EL  + H+  V ++ +     ++ +GS D +V IW    D
Sbjct: 371 TGADDRQLRIYDARSKKFLKEL--SGHEGGVWALKYDAD-GIIVSGSTDRSVRIW----D 423

Query: 89  DYSGETELLAVIEGHENEVK--SVAWSHDGAYLATCSRDKSVWIWEADELSEEFECN--- 143
              G      V +GH + V+   +    +  Y+ T SRD ++ +W+  +  E+F+     
Sbjct: 424 IKRGCCT--HVFKGHTSTVRCLEIVTYKNMKYIVTGSRDNTLHVWKLIK-EEKFDGELPM 480

Query: 144 ------------SVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLS 191
                        VL+ H   V+ I  H +  ++ S SYD+ + +W       +C  VL 
Sbjct: 481 VYNTPEENPYFVGVLRGHMASVRTISGHGN--IVISGSYDNNLMVWDIA--QMKCLYVLI 536

Query: 192 GHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           GH   ++ + ++      R  S S D+T+++W
Sbjct: 537 GHTDRIYSTIYDHKRQ--RCISASMDSTIKVW 566

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 43/201 (21%), Positives = 90/201 (44%), Gaps = 36/201 (17%)

Query: 6   LVRSLKLHGDRCWSVDI-SKGLLATGSADRKIKLVDVRN------FKLVEELDDTAHKKA 58
            ++ L  H    W++   + G++ +GS DR +++ D++       FK         H   
Sbjct: 388 FLKELSGHEGGVWALKYDADGIIVSGSTDRSVRIWDIKRGCCTHVFK--------GHTST 439

Query: 59  VRSVAWRPHCNV--LAAGSFDTTVSIWGR-DDDDYSGETEL-----------LAVIEGHE 104
           VR +    + N+  +  GS D T+ +W    ++ + GE  +           + V+ GH 
Sbjct: 440 VRCLEIVTYKNMKYIVTGSRDNTLHVWKLIKEEKFDGELPMVYNTPEENPYFVGVLRGHM 499

Query: 105 NEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLL 164
             V+++  S  G  + + S D ++ +W+  ++    +C  VL  H+  +   ++   R  
Sbjct: 500 ASVRTI--SGHGNIVISGSYDNNLMVWDIAQM----KCLYVLIGHTDRIYSTIYDHKRQR 553

Query: 165 LASSSYDDTVRIWAEQDDDWE 185
             S+S D T+++W + D+ W 
Sbjct: 554 CISASMDSTIKVW-DLDNIWN 573

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 70/153 (45%), Gaps = 22/153 (14%)

Query: 98  AVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIV 157
             + GH   V +     D  Y+ T + D+ + I++A   S++F     L  H   V  + 
Sbjct: 349 TTLTGHATSVVTCLQFEDD-YVITGADDRQLRIYDAR--SKKFL--KELSGHEGGVWALK 403

Query: 158 WHASRLLLASSSYDDTVRIWAEQDDDWE---CAAVLSGHGGTVWCSDFERAETGIRLCSG 214
           + A  ++++ S+ D +VRIW     D +   C  V  GH  TV C +    +    + +G
Sbjct: 404 YDADGIIVSGST-DRSVRIW-----DIKRGCCTHVFKGHTSTVRCLEIVTYKNMKYIVTG 457

Query: 215 SDDTTVRIWRCLTDDADVFDKEWIQETVLPAVH 247
           S D T+ +W+ + ++   FD E      LP V+
Sbjct: 458 SRDNTLHVWKLIKEEK--FDGE------LPMVY 482

>Kwal_56.24596
          Length = 294

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 79/193 (40%), Gaps = 23/193 (11%)

Query: 96  LLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKH 155
           ++ +   H   +      + G  LATCS DK++ I+E +   E  +    L  H   V  
Sbjct: 1   MVTITNAHTELIHDAVLDYYGKRLATCSSDKTIKIFEVE--GETHKLVETLHGHEGPVWQ 58

Query: 156 IVWHASRL--LLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCS 213
           + W   +   +LAS SYD  V IW E++  W   AV + H  +V    +   E G  L +
Sbjct: 59  VDWAHPKFGVILASCSYDGKVLIWKEENGRWTQIAVHAVHSASVNSVQWAPHEYGPLLLA 118

Query: 214 GSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGL-----------I 262
            S D  V +          F +      +L   H+  V + SW++  L            
Sbjct: 119 ASSDGKVSVVE--------FKENGTTSPILVDAHSIGVNTASWASAALQGGAVSQQMRRF 170

Query: 263 ASVGSDGVLAVYK 275
            + G+D ++ V+K
Sbjct: 171 VTGGADNLVKVWK 183

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 83/286 (29%), Positives = 120/286 (41%), Gaps = 39/286 (13%)

Query: 27  LATGSADRKIKLVDVR--NFKLVEELDDTAHKKAVRSVAW-RPHCNV-LAAGSFDTTVSI 82
           LAT S+D+ IK+ +V     KLVE L    H+  V  V W  P   V LA+ S+D  V I
Sbjct: 24  LATCSSDKTIKIFEVEGETHKLVETLH--GHEGPVWQVDWAHPKFGVILASCSYDGKVLI 81

Query: 83  WGRDDDDYSGETELLAVIEGHENEVKSVAWS-HD-GAYLATCSRDKSVWIWEADELSEEF 140
           W  ++    G    +AV   H   V SV W+ H+ G  L   S D  V      E  E  
Sbjct: 82  WKEEN----GRWTQIAVHAVHSASVNSVQWAPHEYGPLLLAASSDGKV---SVVEFKENG 134

Query: 141 ECNSVLQE-HSQDVKHIVWHASRLL----------LASSSYDDTVRIWAEQDD--DWECA 187
             + +L + HS  V    W ++ L             +   D+ V++W    D   +   
Sbjct: 135 TTSPILVDAHSIGVNTASWASAALQGGAVSQQMRRFVTGGADNLVKVWKFNPDANTYLLE 194

Query: 188 AVLSGHGGTVWCSDFERAETGI---RLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLP 244
             L GH  T W  D   + + +    L S S D T  IW    ++   + K  ++E    
Sbjct: 195 DTLEGH--TDWVRDVAWSPSVLLRSYLASVSQDRTCIIW-TQENNQGPWKKTLLKEDKFS 251

Query: 245 AVHTRAVYSVSWSADG-LIASVGSDGVLAVYKEVQAGRWEVVARVD 289
            V  RA    SWS  G ++A  G D  + ++KE   G+WE    V+
Sbjct: 252 DVLWRA----SWSLSGNILALSGGDNKVTLWKENLEGKWEPAGEVE 293

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 79/169 (46%), Gaps = 22/169 (13%)

Query: 165 LASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWR 224
           LA+ S D T++I+  + +  +    L GH G VW  D+   + G+ L S S D  V IW+
Sbjct: 24  LATCSSDKTIKIFEVEGETHKLVETLHGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWK 83

Query: 225 CLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSA---DGLIASVGSDGVLAVYKEVQAGR 281
                    +  W Q  V  AVH+ +V SV W+      L+ +  SDG ++V +  + G 
Sbjct: 84  -------EENGRWTQIAV-HAVHSASVNSVQWAPHEYGPLLLAASSDGKVSVVEFKENGT 135

Query: 282 WEVVARVDCAHTVYEINVVKW--LALDGRVL------LVTGGDDGCVNV 322
              +  VD AH++  +N   W   AL G  +       VTGG D  V V
Sbjct: 136 TSPIL-VD-AHSI-GVNTASWASAALQGGAVSQQMRRFVTGGADNLVKV 181

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 83/197 (42%), Gaps = 23/197 (11%)

Query: 6   LVRSLKLHGDRCWSVDISKG----LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRS 61
           LV +L  H    W VD +      +LA+ S D K+ +    N +  +      H  +V S
Sbjct: 45  LVETLHGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWKEENGRWTQIAVHAVHSASVNS 104

Query: 62  VAWRPH--CNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAW------- 112
           V W PH    +L A S D  VS+    ++   G T  + +++ H   V + +W       
Sbjct: 105 VQWAPHEYGPLLLAASSDGKVSVVEFKEN---GTTSPI-LVDAHSIGVNTASWASAALQG 160

Query: 113 ---SHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLL---LA 166
              S       T   D  V +W+ +  +  +     L+ H+  V+ + W  S LL   LA
Sbjct: 161 GAVSQQMRRFVTGGADNLVKVWKFNPDANTYLLEDTLEGHTDWVRDVAWSPSVLLRSYLA 220

Query: 167 SSSYDDTVRIWAEQDDD 183
           S S D T  IW ++++ 
Sbjct: 221 SVSQDRTCIIWTQENNQ 237

>Kwal_55.22067
          Length = 451

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 93/207 (44%), Gaps = 19/207 (9%)

Query: 18  WSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFD 77
           W+ +  + ++AT S +  +      NF+ + +    AH  AV  + +    + L +G  D
Sbjct: 91  WTPEGRRLVVATYSGEFSLWNGSTFNFESIMQ----AHDSAVAVMKYSHAGDWLISGDSD 146

Query: 78  TTVSIWGRDDDDYSGETELLAVI-EGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADEL 136
            T+ IW            ++ V+ E H   ++ +++S   +   TCS D  + IW     
Sbjct: 147 GTIKIW-------QPNFNMVKVLDEAHTQCIRGISFSGTDSKFVTCSDDNILKIWNFSNG 199

Query: 137 SEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGT 196
            +E    S L  H  DV+   WH +  L+AS S D+ V++W  +    +C + + G   T
Sbjct: 200 QQE----STLSGHHWDVRSCDWHPTMGLIASGSKDNLVKLWDPRAG--QCISTILGCKHT 253

Query: 197 VWCSDFERAETGIRLCSGSDDTTVRIW 223
           +  + F+  + G  L   S D + RI+
Sbjct: 254 IISTKFQPTK-GNMLAVISKDKSCRIF 279

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 57/129 (44%), Gaps = 26/129 (20%)

Query: 22  ISKGLLATGSADRKIKLVDVRNFKLVEELDDT----------AHKKAVRSVAWRPHCNVL 71
           I++ +   G  D  +K     +F L++E  D+          AH K + S+A+ P  ++L
Sbjct: 305 INESMFTVGCYDGSMK-----HFDLLQEPQDSSSGCFHNIPYAHDKCITSLAYNPVGHIL 359

Query: 72  AAGSFDTTVSIWGR---------DDDDYSGETELLAVIEGHENEVKSV-AWSHDGAYLAT 121
           A+ S D T+  W R         DD  Y+ + ++ A   G  N + ++   + DG  L  
Sbjct: 360 ASASKDRTIRFWTRARPYDPNSFDDPTYNNK-KVNAWYFGINNNINAIRPKTEDGIALPP 418

Query: 122 CSRDKSVWI 130
            S D +  I
Sbjct: 419 ASNDSTASI 427

 Score = 35.4 bits (80), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 65/285 (22%), Positives = 110/285 (38%), Gaps = 75/285 (26%)

Query: 2   PNLHLVRSLKLHGDRCW---SVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKA 58
           PN ++V+ L     +C    S   +     T S D  +K+ +  N +  +E   + H   
Sbjct: 154 PNFNMVKVLDEAHTQCIRGISFSGTDSKFVTCSDDNILKIWNFSNGQ--QESTLSGHHWD 211

Query: 59  VRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSH-DGA 117
           VRS  W P   ++A+GS D  V +W    D  +G+   ++ I G ++ + S  +    G 
Sbjct: 212 VRSCDWHPTMGLIASGSKDNLVKLW----DPRAGQ--CISTILGCKHTIISTKFQPTKGN 265

Query: 118 YLATCSRDKSVWIW--------------EADELS--------------------EEFECN 143
            LA  S+DKS  I+              E+D +S                    + F+  
Sbjct: 266 MLAVISKDKSCRIFDIRQNMKELAVYRDESDYMSLTWHPINESMFTVGCYDGSMKHFD-- 323

Query: 144 SVLQE---------------HSQDVKHIVWHASRLLLASSSYDDTVRIWAE--------- 179
            +LQE               H + +  + ++    +LAS+S D T+R W           
Sbjct: 324 -LLQEPQDSSSGCFHNIPYAHDKCITSLAYNPVGHILASASKDRTIRFWTRARPYDPNSF 382

Query: 180 QDDDWECAAVLSGHGGTVWCSDFERAET--GIRLCSGSDDTTVRI 222
            D  +    V + + G     +  R +T  GI L   S+D+T  I
Sbjct: 383 DDPTYNNKKVNAWYFGINNNINAIRPKTEDGIALPPASNDSTASI 427

>Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement
          Length = 555

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 101/225 (44%), Gaps = 21/225 (9%)

Query: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRP 66
           +R+L  H DR   +  +  +L +GS DRKI   DVR  +   E  +T H + V  + W  
Sbjct: 326 IRTLSGHMDRVACLSWNNHILTSGSRDRKILHRDVRMPEPYFEQVET-HTQEVCGLKWNT 384

Query: 67  HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS-HDGAYLAT--CS 123
             N LA+G  D  V ++     D +     L + E H   VK++AWS H    LAT   +
Sbjct: 385 DENRLASGGNDNVVYVY-----DGTSRKPTLKLAE-HTAAVKAIAWSPHKRGILATGGGT 438

Query: 124 RDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHA-SRLLLASSSYDD-TVRIWAEQD 181
            DK + IW  +  ++  + ++  Q     V +++W   +  L+ S  Y    + +W    
Sbjct: 439 ADKKMKIWNVNTSTKLRDIDTGSQ-----VCNMIWSKNTNELVTSHGYSRYNLTLWDYP- 492

Query: 182 DDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCL 226
              E  A+L GH   V       +  G  + SG+ D T+R W+  
Sbjct: 493 -SMEPVAILKGHSFRVL--HLTLSADGTTVVSGAGDETLRYWKLF 534

>Scas_720.83d
          Length = 915

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 103/254 (40%), Gaps = 57/254 (22%)

Query: 16  RCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGS 75
           +C +      +L  G  + + +L ++ +F L+++L  +  +  + +VA       LA GS
Sbjct: 262 KCVTFHAPSNMLVVGFTNGEFRLYELPHFTLLQQL--SMGQNPINTVAVNSSGEWLAFGS 319

Query: 76  FDT-TVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEAD 134
                + ++     ++  E+ +L   +GH +   S+ +S DG+ + T + D  + +W+  
Sbjct: 320 SKLGQLLVY-----EWQSESYILKQ-QGHFDATNSLTYSPDGSRVVTAAEDGKIKVWD-- 371

Query: 135 ELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW------------AEQDD 182
            +   F C +  QEH+  V  + +     +L SSS D TVR W            A +  
Sbjct: 372 -VVSGF-CLATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERI 429

Query: 183 DWECAAV------------------------------LSGHGGTVWCSDFERAETGIRLC 212
            + C AV                              LSGH G V C  F +  +   L 
Sbjct: 430 QFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQENS--VLA 487

Query: 213 SGSDDTTVRIWRCL 226
           S S D TVR+W   
Sbjct: 488 SASWDKTVRVWSIF 501

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 51/106 (48%), Gaps = 13/106 (12%)

Query: 38  LVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTT-VSIWGRDDDDYSGET-E 95
           L+  RNF+        A +     +A  P   V+ AGS D   + +W       S +T +
Sbjct: 414 LIRYRNFRTFT----AAERIQFNCLAVDPSGEVVCAGSLDNFDIHVW-------SVQTGQ 462

Query: 96  LLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFE 141
           LL  + GHE  V  +A+S + + LA+ S DK+V +W     S++ E
Sbjct: 463 LLDTLSGHEGPVSCLAFSQENSVLASASWDKTVRVWSIFGRSQQVE 508

 Score = 35.8 bits (81), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 45/217 (20%), Positives = 92/217 (42%), Gaps = 31/217 (14%)

Query: 5   HLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAW 64
           +L+ ++   G+  +S D ++ L   G+      L++ ++F    E     H+K + ++  
Sbjct: 9   NLLGTVYRQGNIIFSNDGTQLLSPVGNRVSVFDLINNKSFTFEYE-----HRKNIATIDL 63

Query: 65  RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVK----SVAWSHDGAYLA 120
                +L        +S+   D+D  +  T   A    H    K     V +S DG   A
Sbjct: 64  NKQGTLL--------ISV---DEDGRAILTNFKAKTVLHHFNFKEKCYQVKFSPDGKLFA 112

Query: 121 TCSRDKSVWIWEADELSEEFECNSVLQE-----HSQDVKHIVWHASRLLLASSSYDDTVR 175
             +  + + IW+  + +E+ +    ++      H QD+  + W      + S+S D T R
Sbjct: 113 LAT-GRFLQIWKTPDATEDRQFAPFVRYRVHAGHFQDILSLTWSLDSRFIISTSKDLTAR 171

Query: 176 IWAEQDDDWECAAV-LSGH----GGTVWCSDFERAET 207
           IW+   ++ + A++  +GH     G  + +D E+  T
Sbjct: 172 IWSIDSEEKDLASMTFAGHRDYVMGAFFSADQEKIYT 208

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 69/171 (40%), Gaps = 12/171 (7%)

Query: 13  HGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNV-- 70
           H     ++D++K      S D   + + + NFK    L     K+    V + P   +  
Sbjct: 54  HRKNIATIDLNKQGTLLISVDEDGRAI-LTNFKAKTVLHHFNFKEKCYQVKFSPDGKLFA 112

Query: 71  LAAGSFDTTVSIWGRDD---DDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKS 127
           LA G F   + IW   D   D          V  GH  ++ S+ WS D  ++ + S+D +
Sbjct: 113 LATGRF---LQIWKTPDATEDRQFAPFVRYRVHAGHFQDILSLTWSLDSRFIISTSKDLT 169

Query: 128 VWIWEADELSEEFECNSV-LQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
             IW  D  SEE +  S+    H   V    + A +  + + S D  + +W
Sbjct: 170 ARIWSID--SEEKDLASMTFAGHRDYVMGAFFSADQEKIYTVSKDGALFVW 218

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 97/224 (43%), Gaps = 37/224 (16%)

Query: 20  VDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTT 79
           +      + TG+ D+KI + D  N   + EL+   H+  V ++ +     +L +GS D +
Sbjct: 266 LQFENNYIITGADDKKINVYDAENDLFLLELN--GHEGGVWALKFV-DGKILVSGSTDRS 322

Query: 80  VSIWGRDDDDYSGETELLAVIEGHENEVK--SVAWSHDGAYLATCSRDKSVWIWEADELS 137
           V IW  +        +   V +GH + V+   V    D  Y+ T SRD ++ +W+   + 
Sbjct: 323 VRIWNIETG------KCTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVWKLPPMK 376

Query: 138 E------------EFECNS----VLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQD 181
           E              E N     VL+ H   V+ +  H    ++ S SYD  + +W    
Sbjct: 377 ELDKGSQEPIFYRTPEENPYFVGVLRGHMSSVRTVSGHGR--IVISGSYDHNLMVW--DI 432

Query: 182 DDWECAAVLSGHGGTVWCS--DFERAETGIRLCSGSDDTTVRIW 223
              +   +L+GH   V+ +  D++R     R  S S DTTV IW
Sbjct: 433 ISMKLLYILTGHTDRVYSTIYDYKRN----RCISASMDTTVMIW 472

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 58/125 (46%), Gaps = 8/125 (6%)

Query: 100 IEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWH 159
           ++GH   V +     +  Y+ T + DK + +++A+      E N     H   V  + + 
Sbjct: 255 LDGHSTNVVT-CLQFENNYIITGADDKKINVYDAENDLFLLELNG----HEGGVWALKFV 309

Query: 160 ASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTT 219
             ++L++ S+ D +VRIW    +  +C  V  GH  TV C +         + +GS D T
Sbjct: 310 DGKILVSGST-DRSVRIW--NIETGKCTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNT 366

Query: 220 VRIWR 224
           + +W+
Sbjct: 367 LHVWK 371

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 65/150 (43%), Gaps = 16/150 (10%)

Query: 3   NLHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSV 62
           N + V  L+ H     +V     ++ +GS D  + + D+ + KL+  L  T H   V S 
Sbjct: 394 NPYFVGVLRGHMSSVRTVSGHGRIVISGSYDHNLMVWDIISMKLLYIL--TGHTDRVYST 451

Query: 63  AWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETEL------------LAVIEGHENEVKSV 110
            +    N   + S DTTV IW  ++ + +G T              +  + GH   V  +
Sbjct: 452 IYDYKRNRCISASMDTTVMIWDLENIENNGTTTTINDGASIKVVGSMKCLYGHTALVGLL 511

Query: 111 AWSHDGAYLATCSRDKSVWIWEADELSEEF 140
             S+   +L + + D S+  W+ ++ S +F
Sbjct: 512 CLSN--KFLVSAAADGSIRGWDPNDYSRKF 539

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 5/57 (8%)

Query: 171 DDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLT 227
           D  + ++  ++D +     L+GH G VW   F     G  L SGS D +VRIW   T
Sbjct: 279 DKKINVYDAENDLFLLE--LNGHEGGVWALKFV---DGKILVSGSTDRSVRIWNIET 330

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 58/128 (45%), Gaps = 14/128 (10%)

Query: 54  AHKKAVRSVAWRPH-CNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENE-VKSVA 111
            H+  V  VA+ P   N  A+   D TV IW        G+      +  HE   V  V 
Sbjct: 20  GHEHFVMCVAFNPKDPNTFASACLDHTVKIWSL------GQQSPNFTMTAHETRGVNFVD 73

Query: 112 WS--HDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSS 169
           +    D  YL T S D+SV IW+    S    C + L+ H  +V + ++H S  ++ S S
Sbjct: 74  YYPLQDKPYLITSSDDRSVKIWDYQTKS----CVATLEGHMANVSYAIFHPSLPIIISGS 129

Query: 170 YDDTVRIW 177
            D TV+IW
Sbjct: 130 EDGTVKIW 137

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 63/135 (46%), Gaps = 10/135 (7%)

Query: 96  LLAVIEGHENEVKSVAWS-HDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVK 154
           L    EGHE+ V  VA++  D    A+   D +V IW   + S  F   ++    ++ V 
Sbjct: 14  LEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNF---TMTAHETRGVN 70

Query: 155 HIVWHA--SRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLC 212
            + ++    +  L +SS D +V+IW  Q     C A L GH   V  + F  +   I   
Sbjct: 71  FVDYYPLQDKPYLITSSDDRSVKIWDYQTKS--CVATLEGHMANVSYAIFHPSLPII--I 126

Query: 213 SGSDDTTVRIWRCLT 227
           SGS+D TV+IW   T
Sbjct: 127 SGSEDGTVKIWNANT 141

>ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH]
           (698881..699768) [888 bp, 295 aa]
          Length = 295

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 115/295 (38%), Gaps = 64/295 (21%)

Query: 53  TAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAW 112
            AH + +       +   LA  S D T+ I+  D D +    +L+  + GHE  V  V W
Sbjct: 6   NAHTELIHDAVLDYYGKRLATCSSDKTIQIFEVDGDSH----KLVDSLHGHEGPVWQVDW 61

Query: 113 SHD--GAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVW--HASRLLLASS 168
           +H   G  LA+CS D  V IW+  E +  +   +  + HS  V  + W  H    LL  S
Sbjct: 62  AHPKFGVILASCSYDGKVLIWK--EENGRWSQIAAYEVHSASVNSVKWAPHEYGPLLLCS 119

Query: 169 SYDDTVRIWAEQDDDWECAAVLSGHGGTV----WCS-----DFERAETGIRLCSGSDDTT 219
           S D    +   +++      ++  H   V    W       D ++++   R+ +G  D  
Sbjct: 120 SSDGKFSVVEFKENGTTSPIIIDAHAIGVNAACWAPATIEDDGQQSQHLRRIATGGADNL 179

Query: 220 VRIWRC-------LTDDADVFDKEWIQE-----TVLPAVHTRAV---------------- 251
           V+IW+        L +D      +W+++     +VLP  +   V                
Sbjct: 180 VKIWKYNPEANTYLLEDTLAAHADWVRDVAWSPSVLPRAYLATVSQDRTCIIWTQENNQG 239

Query: 252 ----------------YSVSWSADG-LIASVGSDGVLAVYKEVQAGRWEVVARVD 289
                           +  SWS  G ++A  G D  + ++KE   G+WE  A ++
Sbjct: 240 PWTKTLLKEDKFPDVLWRASWSLSGNILALSGGDNKVTLWKENLEGKWESAAEIE 294

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 55/124 (44%), Gaps = 5/124 (4%)

Query: 96  LLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKH 155
           ++ +   H   +      + G  LATCS DK++ I+E D   +  +    L  H   V  
Sbjct: 1   MVTITNAHTELIHDAVLDYYGKRLATCSSDKTIQIFEVD--GDSHKLVDSLHGHEGPVWQ 58

Query: 156 IVWHASRL--LLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETG-IRLC 212
           + W   +   +LAS SYD  V IW E++  W   A    H  +V    +   E G + LC
Sbjct: 59  VDWAHPKFGVILASCSYDGKVLIWKEENGRWSQIAAYEVHSASVNSVKWAPHEYGPLLLC 118

Query: 213 SGSD 216
           S SD
Sbjct: 119 SSSD 122

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 62/120 (51%), Gaps = 22/120 (18%)

Query: 27  LATGSADRKIKLVDV-RNFKLVEELDD-------------TAHKKAVRSVAWRPHC-NVL 71
           +A+GS D KI + D+  N+K  + +D+             T H + V  V + P   NVL
Sbjct: 97  IASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDIKPVKFLTGHARKVGHVLYHPVAENVL 156

Query: 72  AAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIW 131
           A+ S D TV +W       + ET    +   H + V S+++S+DG YLAT +RDK + +W
Sbjct: 157 ASSSGDYTVKLW-------NVETGKDMITLKHPDMVTSMSFSYDGNYLATVARDKKLRVW 209

>Kwal_23.5769
          Length = 627

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 74/154 (48%), Gaps = 19/154 (12%)

Query: 70  VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVW 129
           +L  GS+D+TV+IW    D  +G+  L+  + GH + VK++ +  DG  L T S D+ + 
Sbjct: 329 LLFTGSYDSTVAIW----DLATGK--LVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIR 380

Query: 130 IWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAV 189
           +W     +    C +    HS  V  +   + + ++ S S D TV++W  +         
Sbjct: 381 VWNYVTGA----CVAAYPGHSDSVLSV--DSYKKIIVSGSADKTVKVWHVES---RTCYT 431

Query: 190 LSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           L GH  T W    +         SGSDDTT+R+W
Sbjct: 432 LRGH--TEWVGTVKLHPKSFTCFSGSDDTTIRMW 463

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 84/191 (43%), Gaps = 19/191 (9%)

Query: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRP 66
           ++  K H D   S+  +  LL TGS D  + + D+   KLV  L  T H+  V+++ +  
Sbjct: 310 IQEFKGHMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRL--TGHRDGVKAIYF-- 365

Query: 67  HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDK 126
               L  GS D  + +W    +  +G    +A   GH + V SV        + + S DK
Sbjct: 366 DGQKLITGSLDRMIRVW----NYVTG--ACVAAYPGHSDSVLSV--DSYKKIIVSGSADK 417

Query: 127 SVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWEC 186
           +V +W      E   C + L+ H++ V  +  H       S S D T+R+W  + +   C
Sbjct: 418 TVKVWHV----ESRTCYT-LRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSN--TC 470

Query: 187 AAVLSGHGGTV 197
             V  GH G V
Sbjct: 471 VKVFRGHVGQV 481

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 88/216 (40%), Gaps = 32/216 (14%)

Query: 13  HGDRCWSVDISKGLLATGSADRKIKL--VDVRNFKLVEELDDTAHKKAVRSVAWRPHCNV 70
           H D   SVD  K ++ +GSAD+ +K+  V+ R    +       H + V +V   P    
Sbjct: 396 HSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLR-----GHTEWVGTVKLHPKSFT 450

Query: 71  LAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWI 130
             +GS DTT+ +W     D    T  + V  GH  +V+ V        L     D    +
Sbjct: 451 CFSGSDDTTIRMW-----DIRSNT-CVKVFRGHVGQVQKV--------LPLTILDTENLV 496

Query: 131 WEADELSEEFECNSVLQEHSQDVKHI---VWHASRLLLASSSYDDTVRIWAEQDDDWECA 187
            +        E  +        +  +   + + S LL  S S D+T+++W  +    +C 
Sbjct: 497 TDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLL--SCSLDNTIKLWEVRTG--KCV 552

Query: 188 AVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
               GH   +W    + A    R+ SG+ D TV++W
Sbjct: 553 RTHFGHVEGIW----DIAADNFRIVSGAHDKTVKVW 584

 Score = 29.3 bits (64), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 6/64 (9%)

Query: 164 LLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           LL + SYD TV IW       +    L+GH   V    F+    G +L +GS D  +R+W
Sbjct: 329 LLFTGSYDSTVAIWDLATG--KLVRRLTGHRDGVKAIYFD----GQKLITGSLDRMIRVW 382

Query: 224 RCLT 227
             +T
Sbjct: 383 NYVT 386

>Scas_571.4
          Length = 601

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 72/150 (48%), Gaps = 20/150 (13%)

Query: 33  DRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHC-NVLAAGSFDTTVSIWGRDDDDYS 91
           D + K +D+R  K++     + H + V  V + P   NVLA+ S D TV IW        
Sbjct: 130 DSENKPMDIRPSKIL-----SGHTRKVGHVLFHPRIRNVLASSSLDFTVKIWNIKKGKVI 184

Query: 92  GETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQ 151
           G  +       H + V ++A+  DGAYLAT +R+K + IW  D  S++    +   +  +
Sbjct: 185 GTLQ-------HSDMVTAMAFDPDGAYLATITRNKKLTIW--DIASKQIVSQTKSHQGPK 235

Query: 152 DVKHIVWHASRLLLA----SSSYDDTVRIW 177
           + + +VW     ++A    S S D  + IW
Sbjct: 236 N-QRVVWLGYSRIIATTGFSKSMDREIGIW 264

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/319 (22%), Positives = 135/319 (42%), Gaps = 71/319 (22%)

Query: 16  RCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGS 75
           +C +  I+  LL  G ++ + +L ++  F +V++L  +  +  V +V+       LA GS
Sbjct: 260 KCCTFHINSNLLIVGFSNGEFRLYEMPEFVMVQQL--SMGQNPVNTVSVNNSGEWLAFGS 317

Query: 76  FDT-TVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEAD 134
                + ++     ++  E+ +L   +GH +   S+ +S DG+ + T + D  + +W   
Sbjct: 318 SKLGQLLVY-----EWQSESYILKQ-QGHFDATNSLTYSPDGSRVVTAAEDGKIKVW--- 368

Query: 135 ELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW------------AEQDD 182
           +++  F C +  +EH+  V  + +     +L S+S D TVR W            A +  
Sbjct: 369 DVASGF-CLATFEEHTSAVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATERV 427

Query: 183 DWECAAV------------------------------LSGHGGTVWCSDFERAETGIRLC 212
            + C AV                              LSGH G V C  F   E  + L 
Sbjct: 428 QFTCLAVEPSGEVVSAGSTDSFDVFVWSVQTGQLLDTLSGHEGPVSCLAFS-MENAV-LA 485

Query: 213 SGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGS-DGVL 271
           S S D T+RIW        +F +    + V P      + +++ + DG   +V +  G L
Sbjct: 486 SASWDKTIRIW-------SIFGRS---QQVEPLEVFADILAITITPDGKHVAVSTLKGQL 535

Query: 272 AVYKEVQAGRWEVVARVDC 290
            ++ ++ +G+   +  +DC
Sbjct: 536 TIF-DIASGKQ--IGNIDC 551

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 109 SVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQE-----HSQDVKHIVW-HASR 162
           SV +S DG Y A  +  + + IW+  ++S++ +    ++      H QD+    W H SR
Sbjct: 101 SVKFSPDGRYFA-LAVGRFLQIWKTPDVSQDRQFAPFVRYRVHAGHFQDITSFTWSHDSR 159

Query: 163 LLLASSSYDDTVRIWAEQDDDWE-CAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVR 221
            LL +S  D T R+W+   +D E  A  L+GH   V  + F   +   ++ + S D  V 
Sbjct: 160 FLLTTSK-DLTSRVWSINSEDKELVATTLAGHRDYVLGAYFNSTQE--KIYTISKDGAVF 216

Query: 222 IWRCLT 227
            W  ++
Sbjct: 217 TWEYIS 222

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 70/174 (40%), Gaps = 18/174 (10%)

Query: 13  HGDRCWSVDISKG--LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRP--HC 68
           H     + D++K   LL +   D +  LV   NFK    L     K    SV + P    
Sbjct: 54  HRKNIATFDVNKQGTLLLSVDTDGRAILV---NFKTRNVLHHFNFKDKCYSVKFSPDGRY 110

Query: 69  NVLAAGSFDTTVSIWGRDDDDYSGETELLAVIE-----GHENEVKSVAWSHDGAYLATCS 123
             LA G F   + IW     D S + +    +      GH  ++ S  WSHD  +L T S
Sbjct: 111 FALAVGRF---LQIW--KTPDVSQDRQFAPFVRYRVHAGHFQDITSFTWSHDSRFLLTTS 165

Query: 124 RDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
           +D +  +W  +   +E    + L  H   V    +++++  + + S D  V  W
Sbjct: 166 KDLTSRVWSINSEDKEL-VATTLAGHRDYVLGAYFNSTQEKIYTISKDGAVFTW 218

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 52/127 (40%), Gaps = 13/127 (10%)

Query: 15  DRCWSVDISKG----LLATGSADRKIKLVDV---RNF-KLVEELDDTAHKKAVRSVAWRP 66
           D+C+SV  S       LA G   +  K  DV   R F   V       H + + S  W  
Sbjct: 97  DKCYSVKFSPDGRYFALAVGRFLQIWKTPDVSQDRQFAPFVRYRVHAGHFQDITSFTWSH 156

Query: 67  HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAV-IEGHENEVKSVAWSHDGAYLATCSRD 125
               L   S D T  +W  + +D     EL+A  + GH + V    ++     + T S+D
Sbjct: 157 DSRFLLTTSKDLTSRVWSINSED----KELVATTLAGHRDYVLGAYFNSTQEKIYTISKD 212

Query: 126 KSVWIWE 132
            +V+ WE
Sbjct: 213 GAVFTWE 219

>Scas_603.5
          Length = 589

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 123/307 (40%), Gaps = 41/307 (13%)

Query: 17  CWSVDISKGLLAT-GSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGS 75
           C   D+S  +L T G  +  IK+ D+     V +LDD  H  +V  +   P    L  GS
Sbjct: 299 CLDFDLSTKMLYTAGKYNTSIKVWDLETNDQVMDLDD--HIASVTCMQLHPDSKTLITGS 356

Query: 76  FDTTVSIWGRDDDDYSGETEL---------LAVIEGHENEVKSVAWSHDGAYLATCSRDK 126
            D T+ +W   D   + +T L         +   E H  E+ SV++  D  YL + SRDK
Sbjct: 357 KDATLKLW---DLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVSY--DNEYLLSASRDK 411

Query: 127 SVWIWEADELSEEFECNSVLQEHS-QDVKHIVWHASRLL---LASSSYDDTVRIWAEQDD 182
           S+  W+    +      + L  +S  ++K     A + +   LA+ S D  +R+W  +  
Sbjct: 412 SIRQWDLTTGNCVQTLEATLSHNSGTNIKDSTVEALQSVGAALATGSKDGIIRLWDLR-- 469

Query: 183 DWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETV 242
             +    L  H G +    F+      ++ +GS D  + +    T +            +
Sbjct: 470 SGKVVRTLLKHQGPITSLQFD----STKIITGSTDANISVSDLRTGN------------I 513

Query: 243 LPAVHTRA-VYSVSWSADGLIASVGSDGVLAVYKEVQAGRWEVVARVDCAHTVYEINVVK 301
           L   H  A + +  +  D L+ +  +  V  + +      W    +V    T   + + K
Sbjct: 514 LETYHCDAPINTFDFENDKLVVAADTKDVRVINRN-NGSHWNCDIKVPDESTTVSVKLKK 572

Query: 302 WLALDGR 308
            L ++GR
Sbjct: 573 KLMIEGR 579

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 75/154 (48%), Gaps = 19/154 (12%)

Query: 70  VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVW 129
           +L  GS+D+T+ IW    D ++G+  L+  + GH + VK++ +  D   L T S DK++ 
Sbjct: 314 LLFTGSYDSTIGIW----DLFTGK--LIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIR 365

Query: 130 IWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAV 189
           +W         EC S  + HS  V  +   + + ++ S S D TV++W  +         
Sbjct: 366 VWNY----ITGECISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVES---RTCYT 416

Query: 190 LSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           L GH  T W +  +         S SDDTT+R+W
Sbjct: 417 LRGH--TEWVNCVKLHPKSFSCFSCSDDTTIRMW 448

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 84/191 (43%), Gaps = 19/191 (9%)

Query: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRP 66
           ++  K H D   ++  +  LL TGS D  I + D+   KL+  L  + H   V+++ +  
Sbjct: 295 IQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRL--SGHSDGVKTLYFDD 352

Query: 67  HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDK 126
               L  GS D T+ +W       +G  E ++   GH + V SV        + + S DK
Sbjct: 353 R--KLITGSLDKTIRVWNY----ITG--ECISTYRGHSDSVLSVDSYQ--KVIVSGSADK 402

Query: 127 SVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWEC 186
           +V +W      E   C + L+ H++ V  +  H       S S D T+R+W  + +   C
Sbjct: 403 TVKVWHV----ESRTCYT-LRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTN--SC 455

Query: 187 AAVLSGHGGTV 197
             V  GH G V
Sbjct: 456 LKVFRGHVGQV 466

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 91/229 (39%), Gaps = 38/229 (16%)

Query: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKL--VDVRNFKLVEELDDTAHKKAVRSVAW 64
           + + + H D   SVD  + ++ +GSAD+ +K+  V+ R    +       H + V  V  
Sbjct: 375 ISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLR-----GHTEWVNCVKL 429

Query: 65  RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSV---------AWSHD 115
            P      + S DTT+ +W    +        L V  GH  +V+ +           + D
Sbjct: 430 HPKSFSCFSCSDDTTIRMWDIRTN------SCLKVFRGHVGQVQKIIPLTIKDVENLATD 483

Query: 116 GAYLATCSRDKSVWIWEADEL-SEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTV 174
                +  +D       ADE  +   E  +VL E+     H         L S   D+T+
Sbjct: 484 NTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTH---------LLSCGLDNTI 534

Query: 175 RIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           ++W  +    +C     GH   VW    + A    R+ SGS D ++++W
Sbjct: 535 KLWDVKTG--KCIRTQFGHVEGVW----DIAADNFRIISGSHDGSIKVW 577

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 61/152 (40%), Gaps = 15/152 (9%)

Query: 6   LVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWR 65
           L+R L  H D   ++      L TGS D+ I++ +    + +       H  +V SV   
Sbjct: 334 LIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTY--RGHSDSVLSVD-- 389

Query: 66  PHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRD 125
            +  V+ +GS D TV +W         E+     + GH   V  V          +CS D
Sbjct: 390 SYQKVIVSGSADKTVKVW-------HVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDD 442

Query: 126 KSVWIWEADELSEEFECNSVLQEHSQDVKHIV 157
            ++ +W+    S    C  V + H   V+ I+
Sbjct: 443 TTIRMWDIRTNS----CLKVFRGHVGQVQKII 470

>Scas_702.16
          Length = 816

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 81/172 (47%), Gaps = 17/172 (9%)

Query: 16  RCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGS 75
           R WSVD  K ++   S   ++  +D    K +  +  + H  +V  + + P+   LA+GS
Sbjct: 42  RIWSVDSIKQIVKILSLKDEVP-IDKELKKPLASM--SRHTGSVTCLKFSPNGKYLASGS 98

Query: 76  FDTTVSIWGRDDDD-----YSGETE-----LLAVIEGHENEVKSVAWSHDGAYLATCSRD 125
            D  + IW  D++      + GE+E     +   +  H+N+++ + W+ D + L +   D
Sbjct: 99  DDRILLIWTLDEERPIQPIFGGESEKERWAVRKRLVAHDNDIQDICWAPDSSLLVSVGLD 158

Query: 126 KSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
           ++V IW        FE       H   VK +++  +    A++S D T++I+
Sbjct: 159 RAVIIWNGI----TFEKLKRFDVHQSHVKGVIFDPANKYFATASDDRTMKIF 206

 Score = 36.6 bits (83), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 78/201 (38%), Gaps = 42/201 (20%)

Query: 101 EGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHA 160
           E    E+ +V  S DG  +AT   D  + IW  D                  +K IV   
Sbjct: 14  ESRSYEIYTVDVSPDGKRVATGGLDGKIRIWSVDS-----------------IKQIV--- 53

Query: 161 SRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTV 220
            ++L    S  D V I  E     +  A +S H G+V C  F  +  G  L SGSDD  +
Sbjct: 54  -KIL----SLKDEVPIDKELK---KPLASMSRHTGSVTCLKF--SPNGKYLASGSDDRIL 103

Query: 221 RIWRCLTDDA--DVFDKE-----WIQETVLPAVHTRAVYSVSWSAD-GLIASVGSDGVLA 272
            IW    +     +F  E     W     L A H   +  + W+ D  L+ SVG D  + 
Sbjct: 104 LIWTLDEERPIQPIFGGESEKERWAVRKRLVA-HDNDIQDICWAPDSSLLVSVGLDRAVI 162

Query: 273 VYKEVQAGRWEVVARVDCAHT 293
           ++  +    +E + R D   +
Sbjct: 163 IWNGIT---FEKLKRFDVHQS 180

>KLLA0C16643g complement(1457590..1458498) highly similar to
           sp|Q04491 Saccharomyces cerevisiae YLR208w SEC13 protein
           transport protein, start by similarity
          Length = 302

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 80/198 (40%), Gaps = 27/198 (13%)

Query: 18  WSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRP----------- 66
           W+      LL   S+D K+ +V+ +       +   AH     +  W P           
Sbjct: 107 WAPHEYGPLLLAASSDGKVSVVEFKENGTTSPIIIDAHSIGANTACWAPATLQQQSNQGT 166

Query: 67  -------HCNVLAAGSFDTTVSIWGRDDDDYSGETELLA-VIEGHENEVKSVAWSH---D 115
                         G  D  V IW  + D     T LL   +EGH + V+ VAWS     
Sbjct: 167 SGSASPQQVRRFVTGGADNLVKIWKYNSD---AATYLLEHTLEGHSDWVRDVAWSPTVLS 223

Query: 116 GAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVK-HIVWHASRLLLASSSYDDTV 174
            +YLA+ S+D++  IW  D   + ++   + ++   DV     W  S  +LA S  D+TV
Sbjct: 224 RSYLASVSQDRTCIIWTQDSKEDTWKKTLLKEDKFPDVLWRASWSLSGNILALSCGDNTV 283

Query: 175 RIWAEQ-DDDWECAAVLS 191
            +W E  +  WE A  ++
Sbjct: 284 TLWKENLEGKWEPAGQVT 301

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 84/295 (28%), Positives = 119/295 (40%), Gaps = 51/295 (17%)

Query: 27  LATGSADRKIKLVDVR--NFKLVEELDDTAHKKAVRSVAW-RPHCNV-LAAGSFDTTVSI 82
           LAT S+D  +K+ +V     KLV+ L    H+  V  V W  P   V LA+ S+D  V I
Sbjct: 24  LATCSSDHTVKIFEVEGETHKLVDTLQ--GHEGPVWQVDWAHPKFGVILASCSYDGKVLI 81

Query: 83  WGRDDDDYSGETELLAVIEGHENEVKSVAWS-HD-GAYLATCSRDKSVWIWEADELSEEF 140
           W     + +G    +A  E H   V S+ W+ H+ G  L   S D  V + E  E     
Sbjct: 82  W----KEVNGRWSQIAAHEVHSASVNSIQWAPHEYGPLLLAASSDGKVSVVEFKENGTTS 137

Query: 141 ECNSVLQEHSQDVKHIVWHASRLLLASSS------------------YDDTVRIWAEQDD 182
               ++  HS       W  + L   S+                    D+ V+IW    D
Sbjct: 138 PI--IIDAHSIGANTACWAPATLQQQSNQGTSGSASPQQVRRFVTGGADNLVKIWKYNSD 195

Query: 183 DWECAAVLSGH---GGTVWCSDFERAETGIR---LCSGSDDTTVRIWRCLTDDA--DVFD 234
               A  L  H   G + W  D   + T +    L S S D T  IW   T D+  D + 
Sbjct: 196 ---AATYLLEHTLEGHSDWVRDVAWSPTVLSRSYLASVSQDRTCIIW---TQDSKEDTWK 249

Query: 235 KEWIQETVLPAVHTRAVYSVSWSADGLIASVG-SDGVLAVYKEVQAGRWEVVARV 288
           K  ++E   P V  RA    SWS  G I ++   D  + ++KE   G+WE   +V
Sbjct: 250 KTLLKEDKFPDVLWRA----SWSLSGNILALSCGDNTVTLWKENLEGKWEPAGQV 300

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 104/250 (41%), Gaps = 38/250 (15%)

Query: 52  DTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGET-ELLAVIEGHENEVKSV 110
           + AH + +       +   LA  S D TV I+     +  GET +L+  ++GHE  V  V
Sbjct: 5   NNAHSELIHDAVLDYYGKRLATCSSDHTVKIF-----EVEGETHKLVDTLQGHEGPVWQV 59

Query: 111 AWSHD--GAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVW--HASRLLLA 166
            W+H   G  LA+CS D  V IW+  E++  +   +  + HS  V  I W  H    LL 
Sbjct: 60  DWAHPKFGVILASCSYDGKVLIWK--EVNGRWSQIAAHEVHSASVNSIQWAPHEYGPLLL 117

Query: 167 SSSYDDTVRIWAEQDDDWECAAVLSGH--GGTVWC--------------SDFERAETGIR 210
           ++S D  V +   +++      ++  H  G    C              S     +   R
Sbjct: 118 AASSDGKVSVVEFKENGTTSPIIIDAHSIGANTACWAPATLQQQSNQGTSGSASPQQVRR 177

Query: 211 LCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGL----IASVG 266
             +G  D  V+IW+  +D A      ++ E  L   H+  V  V+WS   L    +ASV 
Sbjct: 178 FVTGGADNLVKIWKYNSDAA-----TYLLEHTLEG-HSDWVRDVAWSPTVLSRSYLASVS 231

Query: 267 SDGVLAVYKE 276
            D    ++ +
Sbjct: 232 QDRTCIIWTQ 241

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 54/129 (41%), Gaps = 4/129 (3%)

Query: 96  LLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKH 155
           ++ +   H   +      + G  LATCS D +V I+E +   E  +    LQ H   V  
Sbjct: 1   MVTINNAHSELIHDAVLDYYGKRLATCSSDHTVKIFEVE--GETHKLVDTLQGHEGPVWQ 58

Query: 156 IVWHASRL--LLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCS 213
           + W   +   +LAS SYD  V IW E +  W   A    H  +V    +   E G  L +
Sbjct: 59  VDWAHPKFGVILASCSYDGKVLIWKEVNGRWSQIAAHEVHSASVNSIQWAPHEYGPLLLA 118

Query: 214 GSDDTTVRI 222
            S D  V +
Sbjct: 119 ASSDGKVSV 127

>Kwal_27.12239
          Length = 316

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 80/199 (40%), Gaps = 31/199 (15%)

Query: 39  VDVRNFKLVEELD---DTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETE 95
           VD+  F L ++      T H + +  + W P    +A  S D T+ I         GE  
Sbjct: 38  VDIVVFNLEDQSSTTFSTLHSRPLSDLCWSPDSQCIATASDDFTIII----THIVFGELH 93

Query: 96  LLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKH 155
            L    GH   V SV ++  G  L +CS D+S+ IW  D LS        L  HS+ V  
Sbjct: 94  RLV---GHTAPVTSVKYTMKGNLLCSCSMDESIKIW--DILSGTLL--RTLSAHSEPVVS 146

Query: 156 I-VWHASRLLLASSSYDDTVRIW----------AEQDDDWECAAVLSGHGGTVWCSDFER 204
           I +      +L+S SYD  +RI+             D DW+         G V  S  + 
Sbjct: 147 IDLPPFDPSILSSGSYDGLIRIFDTATGHCLKTLTYDKDWQ------SENGVVPISQVKF 200

Query: 205 AETGIRLCSGSDDTTVRIW 223
           +  G  L   S D  ++IW
Sbjct: 201 SRNGKYLLVKSLDGILKIW 219

 Score = 35.0 bits (79), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 55/119 (46%), Gaps = 21/119 (17%)

Query: 25  GLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPH-CNVLAAGSFDTTVSIW 83
            LL + S D  IK+ D+ +  L+  L  +AH + V S+   P   ++L++GS+D  + I+
Sbjct: 112 NLLCSCSMDESIKIWDILSGTLLRTL--SAHSEPVVSIDLPPFDPSILSSGSYDGLIRIF 169

Query: 84  GRD----------DDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWE 132
                        D D+  E  ++ + +        V +S +G YL   S D  + IW+
Sbjct: 170 DTATGHCLKTLTYDKDWQSENGVVPISQ--------VKFSRNGKYLLVKSLDGILKIWD 220

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 77/188 (40%), Gaps = 25/188 (13%)

Query: 92  GETELLAVI---EGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQE 148
           G+ EL++ +   +G +    +   S +G Y+A C     V     D+ S  F        
Sbjct: 2   GQFELISTLRSAQGSDILYTACKISPNGKYVAICVDVDIVVFNLEDQSSTTFS-----TL 56

Query: 149 HSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETG 208
           HS+ +  + W      +A++S D T+ I      +      L GH   V  +  +    G
Sbjct: 57  HSRPLSDLCWSPDSQCIATASDDFTIIITHIVFGELH---RLVGHTAPV--TSVKYTMKG 111

Query: 209 IRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSA-DGLIASVGS 267
             LCS S D +++IW       D+     ++     + H+  V S+     D  I S GS
Sbjct: 112 NLLCSCSMDESIKIW-------DILSGTLLRTL---SAHSEPVVSIDLPPFDPSILSSGS 161

Query: 268 -DGVLAVY 274
            DG++ ++
Sbjct: 162 YDGLIRIF 169

>Scas_718.6*
          Length = 546

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 54/269 (20%), Positives = 112/269 (41%), Gaps = 38/269 (14%)

Query: 26  LLATGSADRKIKLVDVR--NFKLVEELDDTAHKKAVRSV-----------AWRPHCNVLA 72
           LLA G  D   K+++    + K++  L+   H  A+ S+           +W P   ++ 
Sbjct: 196 LLAYGQEDSMAKMIEYNKEDKKIISSLE-LRHPFALSSITGRKTNQITALSWSPDGELII 254

Query: 73  AGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWE 132
               +  + +W +D         L  V   H + + S+ W+ D  +  +   D    +W 
Sbjct: 255 TSVENGELRLWNKDG-------RLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWN 307

Query: 133 ADE--LSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVL 190
           A    + + FE    L+ +++ +   +    +  L     + ++ +++   DD +    L
Sbjct: 308 AINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYS--IDDNKPIGKL 365

Query: 191 SGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDA-DVFDKEWIQETVLPAVHTR 249
            GH GT+ C +F    + + L S   D ++RIW    ++  + F             H++
Sbjct: 366 LGHQGTISCIEF-NVNSRLLLTSSDSDYSIRIWHGQKENCCNCF-----------YGHSQ 413

Query: 250 AVYSVSWSADGLIASVGSDGVLAVYKEVQ 278
           ++ S+SW  D L+ S   DG + ++  V+
Sbjct: 414 SIISLSWINDDLVISASMDGSVRIWSVVE 442

>Scas_674.20
          Length = 297

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 84/199 (42%), Gaps = 26/199 (13%)

Query: 7   VRSLKLHGDRCWSVDISKG----LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSV 62
           V +L+ H    W VD +      +LA+ S D K+ +    N +  +      H  +V SV
Sbjct: 46  VATLEGHDGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIACHAVHSASVNSV 105

Query: 63  AWRPH--CNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS------- 113
            W PH    +L A S D  VS+    ++     T    +I+ H   V S +W+       
Sbjct: 106 QWAPHEYGALLLAASSDGKVSVVEFKENG----TLTPIIIDAHNIGVNSASWAPATLQEN 161

Query: 114 ------HDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLL--- 164
                  +     T   D  V IW+ +  S+ +     LQ HS  V+ + W  S LL   
Sbjct: 162 KPTKSPEESRRFVTGGADNLVKIWKYNNESQTYLLEDTLQGHSDWVRDVAWSPSVLLRSY 221

Query: 165 LASSSYDDTVRIWAEQDDD 183
           +AS S D T  IW ++++D
Sbjct: 222 IASVSQDKTCIIWTQENND 240

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 71/168 (42%), Gaps = 12/168 (7%)

Query: 96  LLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKH 155
           ++A+   H + +      + G  LATCS DK++ I+E +   E  +  + L+ H   V  
Sbjct: 1   MVAIANAHNDLIHDAVLDYYGKRLATCSSDKTIKIFEVE--GETHKEVATLEGHDGPVWR 58

Query: 156 IVWHASRL--LLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCS 213
           + W   +   +LAS SYD  V IW E++  W   A  + H  +V    +   E G  L +
Sbjct: 59  VDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIACHAVHSASVNSVQWAPHEYGALLLA 118

Query: 214 GSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGL 261
            S D  V +          F +      ++   H   V S SW+   L
Sbjct: 119 ASSDGKVSVVE--------FKENGTLTPIIIDAHNIGVNSASWAPATL 158

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 114/283 (40%), Gaps = 30/283 (10%)

Query: 27  LATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAW-RPHC-NVLAAGSFDTTVSIWG 84
           LAT S+D+ IK+ +V      E      H   V  V W  P    +LA+ S+D  V IW 
Sbjct: 24  LATCSSDKTIKIFEVEGETHKEVATLEGHDGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83

Query: 85  RDDDDYSGETELLAVIEGHENEVKSVAWS-HD-GAYLATCSRDKSVWIWEADELSEEFEC 142
            ++  +S     +A    H   V SV W+ H+ GA L   S D  V + E  E       
Sbjct: 84  EENGRWSQ----IACHAVHSASVNSVQWAPHEYGALLLAASSDGKVSVVEFKENGTLTPI 139

Query: 143 NSVLQEHSQDVKHIVWHASRLL-------------LASSSYDDTVRIWAEQDDDWECAAV 189
             ++  H+  V    W  + L                +   D+ V+IW   ++       
Sbjct: 140 --IIDAHNIGVNSASWAPATLQENKPTKSPEESRRFVTGGADNLVKIWKYNNESQTYLLE 197

Query: 190 LSGHGGTVWCSDFERAETGI---RLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAV 246
            +  G + W  D   + + +    + S S D T  IW    +D+  + K  +Q+   P V
Sbjct: 198 DTLQGHSDWVRDVAWSPSVLLRSYIASVSQDKTCIIWTQENNDSS-WKKTELQKERFPDV 256

Query: 247 HTRAVYSVSWSADGLIASVGSDGVLAVYKEVQAGRWEVVARVD 289
             RA +S+S     ++A  G D  + ++KE   G WE    V+
Sbjct: 257 LWRASWSLS---GNILALSGGDNKVTLWKENLEGNWEPAGEVE 296

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 55/120 (45%), Gaps = 18/120 (15%)

Query: 208 GIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADG---LIAS 264
           G RL + S D T++I+          + E  +E      H   V+ V W+      ++AS
Sbjct: 21  GKRLATCSSDKTIKIFEV--------EGETHKEVATLEGHDGPVWRVDWAHPKFGTILAS 72

Query: 265 VGSDGVLAVYKEVQAGRWEVVARVDCAHTVYE--INVVKWLALDGRVLLVTGGDDGCVNV 322
              DG + ++KE + GRW  +A     H V+   +N V+W   +   LL+    DG V+V
Sbjct: 73  CSYDGKVLIWKE-ENGRWSQIA----CHAVHSASVNSVQWAPHEYGALLLAASSDGKVSV 127

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 73/182 (40%), Gaps = 21/182 (11%)

Query: 10  LKLHGDR---------CWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVR 60
           LKLH D          C  V      LA    D  +K+  + + K    L    HK  V 
Sbjct: 520 LKLHHDTTLELTDDILCVRVSPDDRYLAISLLDNTVKVFFLDSMKFYLSL--YGHKLPVL 577

Query: 61  SVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLA 120
           S+       ++   S D  + IWG D  D      L A    H++ + +V +        
Sbjct: 578 SIDISFDSKMIITSSADKNIKIWGLDFGD--CHKSLFA----HQDSIMNVKFLPQSHNFF 631

Query: 121 TCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQ 180
           +CS+D  V  W+     E+FEC   L  H  +V  +        + SSS+D ++RIW E 
Sbjct: 632 SCSKDAVVKYWDG----EKFECIQKLYAHQSEVWALAVATDGGFVVSSSHDHSIRIWEET 687

Query: 181 DD 182
           +D
Sbjct: 688 ED 689

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 112/264 (42%), Gaps = 30/264 (11%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGR 85
           L+  G+ + +++L D+ +  L++ ++D AH  A+ S+        L  GS D TV  W  
Sbjct: 444 LVILGTRNGELQLFDLASSSLLDTIED-AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502

Query: 86  DDDD---YSGETELLAVIEGHE-------NEVKSVAWSHDGAYLATCSRDKSVWIWEADE 135
             ++      + + L V++ H        +++  V  S D  YLA    D +V ++  D 
Sbjct: 503 KVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVSPDDRYLAISLLDNTVKVFFLD- 561

Query: 136 LSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGG 195
            S +F  +  L  H   V  I       ++ +SS D  ++IW    D  +C   L  H  
Sbjct: 562 -SMKFYLS--LYGHKLPVLSIDISFDSKMIITSSADKNIKIWGL--DFGDCHKSLFAHQD 616

Query: 196 TVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVS 255
           ++    F         C  S D  V+ W     D + F  E IQ+      H   V++++
Sbjct: 617 SIMNVKFLPQSHNFFSC--SKDAVVKYW-----DGEKF--ECIQKLY---AHQSEVWALA 664

Query: 256 WSAD-GLIASVGSDGVLAVYKEVQ 278
            + D G + S   D  + +++E +
Sbjct: 665 VATDGGFVVSSSHDHSIRIWEETE 688

 Score = 36.2 bits (82), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 84/225 (37%), Gaps = 39/225 (17%)

Query: 100 IEGHENEVKSVAWSHDGAYLATCSRDK-SVWIWEADELSEEFECNSVLQEHSQDVKHIVW 158
           ++G   +V+S+  S D   LAT S     +W  +  +    FEC   L         +V 
Sbjct: 387 LQGQRTDVRSIDISDDNKLLATASNGSLKIWNIKTHKCIRTFECGYALTCKFLPGGLLVI 446

Query: 159 HASR------LLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLC 212
             +R        LASSS  DT+                  H   +W  D      G RL 
Sbjct: 447 LGTRNGELQLFDLASSSLLDTIE---------------DAHDAAIWSLDL--TSDGKRLV 489

Query: 213 SGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLA 272
           +GS D TV+ W    +++ V      +   LP +      ++  + D L   V  D    
Sbjct: 490 TGSADKTVKFWDFKVENSLV---PGTKNKFLPVLKLHHDTTLELTDDILCVRVSPD---- 542

Query: 273 VYKEVQAGRWEVVARVDCAHTVYEINVVK-WLALDGRVLLVTGGD 316
                   R+  ++ +D    V+ ++ +K +L+L G  L V   D
Sbjct: 543 -------DRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSID 580

 Score = 29.3 bits (64), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 10/68 (14%)

Query: 159 HASRLLLASSSYDDTVRIWAEQDDDWECAAVL---SGHGGTVWCSDFERAETGIRLCSGS 215
           H    LLA    D  +++W     D     VL   +GH   +    F+   TG RL SGS
Sbjct: 88  HKDTDLLAVGYADGVIKVW-----DLMSKTVLLNFNGHKAAITLLQFDG--TGTRLISGS 140

Query: 216 DDTTVRIW 223
            D+ + +W
Sbjct: 141 KDSNIIVW 148

 Score = 29.3 bits (64), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 79/204 (38%), Gaps = 27/204 (13%)

Query: 31  SADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRP----------HCNVLAAGSFDTTV 80
           SA   + + D++   LV +L D     A  +   +P            ++LA G  D  +
Sbjct: 44  SALEDVNIWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVI 103

Query: 81  SIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEF 140
            +W     D   +T LL    GH+  +  + +   G  L + S+D ++ +W   +L  E 
Sbjct: 104 KVW-----DLMSKTVLLN-FNGHKAAITLLQFDGTGTRLISGSKDSNIIVW---DLVGEV 154

Query: 141 ECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCS 200
                L+ H   +    W      L S+S D  +++W  +    +C      H G  W  
Sbjct: 155 GLYK-LRSHKDSITGF-WCQGEDWLISTSKDGMIKLWDLKTH--QCIETHIAHTGECWG- 209

Query: 201 DFERAETGIRLCSGSDDTTVRIWR 224
               A     L +   D+ V+IW+
Sbjct: 210 ---LAVKDDLLITTGTDSQVKIWK 230

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 96/227 (42%), Gaps = 24/227 (10%)

Query: 56  KKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHD 115
           K  + ++ W P    L   ++    S+W     ++       ++++ H++ V  + +SH 
Sbjct: 79  KHVIPAITWTPEGRRLVVATYSGEFSLWNGSSFNFE------SIMQAHDSAVTVMQYSHA 132

Query: 116 GAYLATCSRDKSVWIWEADELSEEFECNSVL-QEHSQDVKHIVWHASRLLLASSSYDDTV 174
           G +L +   D ++ IW+ +     F    VL + H++ ++ I +  S     + S D+ +
Sbjct: 133 GDWLISGDADGTIKIWQPN-----FNMVKVLDRAHTECMRDISFSYSDQKFVTCSDDNVL 187

Query: 175 RIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFD 234
           +IW   +   E   VLSGH   V   D+   + G+ + SGS D  +++W   T       
Sbjct: 188 KIWNFSNGQQE--RVLSGHHWDVKSCDWH-PKMGL-IVSGSKDNLIKLWDPRTGRN---- 239

Query: 235 KEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQAGR 281
                 T+L   HT        +   L+A V  D  + +Y   Q  R
Sbjct: 240 ----VSTILGLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYDMRQHMR 282

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/239 (23%), Positives = 100/239 (41%), Gaps = 30/239 (12%)

Query: 17  CWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSF 76
            W+ +  + ++AT S +  +      NF+ + +    AH  AV  + +    + L +G  
Sbjct: 86  TWTPEGRRLVVATYSGEFSLWNGSSFNFESIMQ----AHDSAVTVMQYSHAGDWLISGDA 141

Query: 77  DTTVSIWGRDDDDYSGETELLAVIE-GHENEVKSVAWSHDGAYLATCSRDKSVWIWEADE 135
           D T+ IW            ++ V++  H   ++ +++S+      TCS D  + IW    
Sbjct: 142 DGTIKIW-------QPNFNMVKVLDRAHTECMRDISFSYSDQKFVTCSDDNVLKIWNFSN 194

Query: 136 LSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGG 195
             +E     VL  H  DVK   WH    L+ S S D+ +++W  +       + + G   
Sbjct: 195 GQQE----RVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKLWDPRTG--RNVSTILGLKH 248

Query: 196 TVWCSDFERAETGIRLCSGSDDTTVRIW---------RCLTDDADVFDKEW--IQETVL 243
           TV  + F+  + G  L   S D +++I+         + + DD D     W  I ET+ 
Sbjct: 249 TVIKTKFQPTQ-GNLLAVVSKDKSIKIYDMRQHMRELQTIRDDMDYMSLSWHPINETIF 306

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/227 (21%), Positives = 85/227 (37%), Gaps = 57/227 (25%)

Query: 2   PNLHLVRSLKLHGDRCW---SVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKA 58
           PN ++V+ L      C    S   S     T S D  +K+ +  N +  +E   + H   
Sbjct: 150 PNFNMVKVLDRAHTECMRDISFSYSDQKFVTCSDDNVLKIWNFSNGQ--QERVLSGHHWD 207

Query: 59  VRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEV-KSVAWSHDGA 117
           V+S  W P   ++ +GS D  + +W    D  +G    ++ I G ++ V K+      G 
Sbjct: 208 VKSCDWHPKMGLIVSGSKDNLIKLW----DPRTGRN--VSTILGLKHTVIKTKFQPTQGN 261

Query: 118 YLATCSRDKSVWIWEADELSEEFE------------------------------------ 141
            LA  S+DKS+ I++  +   E +                                    
Sbjct: 262 LLAVVSKDKSIKIYDMRQHMRELQTIRDDMDYMSLSWHPINETIFSVGCYNGAIKHFDLL 321

Query: 142 ---------CNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAE 179
                    C+++   H + V  + +     +LAS++ D T+R WA 
Sbjct: 322 HDNSNSTPACHTIPYAHEKSVTSLAYSPVGHILASAAKDRTIRFWAR 368

>Scas_695.15
          Length = 327

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 88/221 (39%), Gaps = 21/221 (9%)

Query: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRP 66
           V S+    D  W        + T S D  IK+ DVR+  +        H   V  V   P
Sbjct: 98  VTSVSFQQDNKW--------MVTSSEDGTIKVWDVRSPSVPRNY---KHNAPVNEVVIHP 146

Query: 67  HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDK 126
           +   L +   D T+ IW   ++  + +     + +     ++S++ + DG+ L   +   
Sbjct: 147 NQGELISCDRDGTIKIWDLGENQCTHQ----LIPDDDNTSLQSLSVASDGSMLVAANNKG 202

Query: 127 SVWIWEADELSEEFECNSV--LQEHSQDVKHIVWHASRLLLASSSYDDTVRIWA--EQDD 182
             ++WE    ++      +     H   +  +V  +    +A+ S D T +IW+  E +D
Sbjct: 203 DCYVWEMPNHTDASNLKPINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGETED 262

Query: 183 DWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           D+     L GH   VW   F  +     L + S D  VR+W
Sbjct: 263 DFNLETTLDGHQRWVWDCAF--SADSAYLVTASSDHYVRLW 301

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 75/173 (43%), Gaps = 5/173 (2%)

Query: 23  SKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSI 82
           ++G L +   D  IK+ D+   +   +L       +++S++     ++L A +      +
Sbjct: 147 NQGELISCDRDGTIKIWDLGENQCTHQLIPDDDNTSLQSLSVASDGSMLVAANNKGDCYV 206

Query: 83  WGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFEC 142
           W   +   +   + +     H++ +  V  S D  ++ATCS D++  IW   E  ++F  
Sbjct: 207 WEMPNHTDASNLKPINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGETEDDFNL 266

Query: 143 NSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGG 195
            + L  H + V    + A    L ++S D  VR+W     D     ++  +GG
Sbjct: 267 ETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW-----DLSTREIVRQYGG 314

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query: 97  LAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHI 156
           +A  EGH+  V SV++  D  ++ T S D ++ +W+    S          +H+  V  +
Sbjct: 88  VATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRN-----YKHNAPVNEV 142

Query: 157 VWHASRLLLASSSYDDTVRIW 177
           V H ++  L S   D T++IW
Sbjct: 143 VIHPNQGELISCDRDGTIKIW 163

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 84/191 (43%), Gaps = 19/191 (9%)

Query: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRP 66
           ++  K H D   S+  +  LL TGS D  + + D ++  L+  L  T H   V+ + +  
Sbjct: 305 IQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRL--TGHTDGVKGIYFDD 362

Query: 67  HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDK 126
              + A  S D T+ +W       +G    ++   GH++ V SV        + + S DK
Sbjct: 363 QKMITA--SLDKTIRVWNY----ITGSC--ISTYRGHQDSVLSV--DSYKKIIVSASADK 412

Query: 127 SVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWEC 186
           +V +W      E   C + L+ H++ V  +  H       SSS D T+R+W  + +   C
Sbjct: 413 TVKVWHV----ESRTCYT-LRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTN--SC 465

Query: 187 AAVLSGHGGTV 197
             V  GH G V
Sbjct: 466 IKVFRGHVGQV 476

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 74/159 (46%), Gaps = 19/159 (11%)

Query: 70  VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVW 129
           +L  GS+D+TV+IW    D  SG   L+  + GH + VK + +  D   + T S DK++ 
Sbjct: 324 LLFTGSYDSTVAIW----DTKSGN--LIRRLTGHTDGVKGIYF--DDQKMITASLDKTIR 375

Query: 130 IWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAV 189
           +W     S    C S  + H   V  +   + + ++ S+S D TV++W  +         
Sbjct: 376 VWNYITGS----CISTYRGHQDSVLSV--DSYKKIIVSASADKTVKVWHVES---RTCYT 426

Query: 190 LSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTD 228
           L GH  T W +  +         S SDD T+R+W   T+
Sbjct: 427 LRGH--TEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTN 463

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 88/223 (39%), Gaps = 35/223 (15%)

Query: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKL--VDVRNFKLVEELDDTAHKKAVRSVAW 64
           + + + H D   SVD  K ++ + SAD+ +K+  V+ R    +       H + V  V  
Sbjct: 385 ISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLR-----GHTEWVNCVKL 439

Query: 65  RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAW--SHDGAYLATC 122
            P      + S D T+ +W             + V  GH  +V+ V      D   L   
Sbjct: 440 HPKSFTCYSSSDDKTLRMWD------IRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVV- 492

Query: 123 SRDKSVWIWEADELSEEF--ECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQ 180
             D+ +      EL E+F  +C  +   + +   H         L S S D+T+++W  +
Sbjct: 493 --DEKIEKVPNPELEEDFADDCTGIFDPNLKYPTH---------LLSCSLDNTIKLW--E 539

Query: 181 DDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
                C     GH   VW    + A    R+ SGS D ++++W
Sbjct: 540 VSSGRCIRTQFGHVEGVW----DIAADNFRIVSGSHDKSIKVW 578

>ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH]
           complement(140589..143003) [2415 bp, 804 aa]
          Length = 804

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 65/271 (23%), Positives = 107/271 (39%), Gaps = 39/271 (14%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGR 85
           +LA+G+ DR I+L  ++    +EE D T  K     +             F  T      
Sbjct: 232 MLASGAQDRYIRLWRIKANNNIEEEDPTKLKLLSNKIY-----------KFQVTA----- 275

Query: 86  DDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSV 145
              D        A+I GH++ + S+ W      L   + D SV +WE DE+S  + C S 
Sbjct: 276 ---DLHLSINFEALIMGHDDWISSLQWHESKCQLLAATADTSVMLWEPDEISGIWVCASR 332

Query: 146 LQEHSQDVKHI-----------VWHAS---RLLLASSSYDDTVRIWAEQDD--DWECAAV 189
           L E S                 +W A+     +LA+     + R+W  + D   WE    
Sbjct: 333 LGEFSSKGASTATGSAGGFWSCLWFATGDAEYILANGK-TGSWRMWENRGDGGSWEQLPA 391

Query: 190 LSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW-RCLTDDADVFDKEWIQETVLPAVHT 248
           ++G   +V  +D   + +G  L + S D T R++ R + +      K    E   P +H 
Sbjct: 392 ITGPTRSV--TDVAWSPSGSYLLASSLDQTTRLYTRWMYEGDGSRRKHTWHEFARPQIHG 449

Query: 249 RAVYSVSWSADGLIASVGSDGVLAVYKEVQA 279
             +  +   +D    S G + VL  + E +A
Sbjct: 450 YDMICLEPISDTQFISAGDEKVLRSFNEPRA 480

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 92/222 (41%), Gaps = 61/222 (27%)

Query: 93  ETELLAVIEGHENEVKSVAWSHDGA---YLATCSRDKSVWIW---------EADE----- 135
           + EL A +EGHE+ +K +A+  +G     LA+ ++D+ + +W         E D      
Sbjct: 204 DVELSATVEGHEDWIKDLAFRSNGPGDWMLASGAQDRYIRLWRIKANNNIEEEDPTKLKL 263

Query: 136 ---------------LSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWA-- 178
                          LS  FE  +++  H   +  + WH S+  L +++ D +V +W   
Sbjct: 264 LSNKIYKFQVTADLHLSINFE--ALIMGHDDWISSLQWHESKCQLLAATADTSVMLWEPD 321

Query: 179 EQDDDWECAAVL-----------SGHGGTVW-CSDFERAETGIRLCSGSDDTTVRIWRCL 226
           E    W CA+ L           +G  G  W C  F   +    L +G   +    WR  
Sbjct: 322 EISGIWVCASRLGEFSSKGASTATGSAGGFWSCLWFATGDAEYILANGKTGS----WRMW 377

Query: 227 TDDADVFDKEWIQETVLPAV--HTRAVYSVSWSADG--LIAS 264
            +  D     W Q   LPA+   TR+V  V+WS  G  L+AS
Sbjct: 378 ENRGD--GGSWEQ---LPAITGPTRSVTDVAWSPSGSYLLAS 414

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 51/138 (36%), Gaps = 22/138 (15%)

Query: 100 IEGHENEVKSVAWSHDGAYLATCSRDK----------SVWIWEADELSEEFECNSVLQ-E 148
           + GH  E+  V  S DG  LA+  +            S   W       EF   ++ +  
Sbjct: 567 LYGHGYEISCVDVSPDGKLLASACKSNNTSHAVVRIFSTHTWLQLPPCPEFHNLTITRLR 626

Query: 149 HSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAV--LSGHGGTVWCSDFERAE 206
            S+D +H++         S S D    +W   DDD           H   +W  D+  A 
Sbjct: 627 FSKDNRHLL---------SVSRDRMWAVWYRNDDDTFTLKYSDQKPHSRIIWDGDWLPAS 677

Query: 207 TGIRLCSGSDDTTVRIWR 224
            G    + S D TV+IWR
Sbjct: 678 CGTAFVTASRDKTVKIWR 695

 Score = 33.5 bits (75), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 46/103 (44%), Gaps = 8/103 (7%)

Query: 80  VSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEE 139
           +++W   D+  +G   +   ++ H  EV SV +      L + S D ++ +W  D   E 
Sbjct: 58  IALWNPLDEHNAG---VYCTLKAHNAEVTSVKFIGAEKLLVSASADATINVWRGD---ER 111

Query: 140 FECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDD 182
           +E    L+     V  +   A   L+ +   D T+ +W+E DD
Sbjct: 112 WELAQTLEGPKSSVTSLAVAAG--LIVAGFADGTLSVWSEHDD 152

 Score = 33.1 bits (74), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 78/184 (42%), Gaps = 17/184 (9%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
           AH   V SV +     +L + S D T+++W R D+ +    EL   +EG ++ V S+A +
Sbjct: 77  AHNAEVTSVKFIGAEKLLVSASADATINVW-RGDERW----ELAQTLEGPKSSVTSLAVA 131

Query: 114 HDGAYLATCSRDKSVWIW----EADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSS 169
                +     D ++ +W    +A  LS +F         +  ++ +      L ++ +S
Sbjct: 132 --AGLIVAGFADGTLSVWSEHDDAFVLSSQFLIRKGFLPLALALQKLSDGCYMLAVSGTS 189

Query: 170 YDDTV-RIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGI---RLCSGSDDTTVRIWRC 225
            D  V  +      D E +A + GH    W  D      G     L SG+ D  +R+WR 
Sbjct: 190 TDLMVYSVCVAATVDVELSATVEGHED--WIKDLAFRSNGPGDWMLASGAQDRYIRLWRI 247

Query: 226 LTDD 229
             ++
Sbjct: 248 KANN 251

 Score = 29.6 bits (65), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 29/73 (39%), Gaps = 12/73 (16%)

Query: 81  SIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHD------GAYLATCSRDKSVWIWEAD 134
           ++W R+DDD         +    +     + W  D      G    T SRDK+V IW  D
Sbjct: 644 AVWYRNDDD------TFTLKYSDQKPHSRIIWDGDWLPASCGTAFVTASRDKTVKIWRLD 697

Query: 135 ELSEEFECNSVLQ 147
                FE  S L+
Sbjct: 698 GQEGRFEVESNLK 710

>Kwal_47.17567
          Length = 590

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 61/227 (26%), Positives = 101/227 (44%), Gaps = 25/227 (11%)

Query: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFK-LVEELDDTAHKKAVRSVAWR 65
           +R++  H DR   +  +  +L +GS DR+I   DVR  +   EE+    H + V  + W 
Sbjct: 361 IRTIPGHIDRVACLSWNNHILTSGSRDRRILHRDVRTPQSSFEEI--RTHNQEVCGLKWN 418

Query: 66  PHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAV-IEGHENEVKSVAWS-HDGAYLAT-- 121
              N LA+G  D  V +       Y G + L  + +E H   VK++AWS H    LAT  
Sbjct: 419 VEDNKLASGGNDNAVFV-------YDGTSRLPFLKLEEHTAAVKAMAWSPHRRGILATGG 471

Query: 122 CSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHA-SRLLLASSSYDD-TVRIWAE 179
            + DK + IW      +  + ++  Q     V +++W   +  ++ S  Y    + +W  
Sbjct: 472 GTADKRLKIWNVKTSVKLHDVDTASQ-----VCNMIWSKNTNEIITSHGYSKYNLTLW-- 524

Query: 180 QDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCL 226
             +  E  A+L GH   V       +  G  + SG+ D T+R W+  
Sbjct: 525 DGNTLEPMAILKGHSFRVL--HMTLSTDGTTVVSGAGDETLRYWKLF 569

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 63/120 (52%), Gaps = 15/120 (12%)

Query: 24  KGLLATG--SADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCN--VLAAGSFDTT 79
           +G+LATG  +AD+++K+ +V+    + ++D  +    V ++ W  + N  + + G     
Sbjct: 464 RGILATGGGTADKRLKIWNVKTSVKLHDVDTASQ---VCNMIWSKNTNEIITSHGYSKYN 520

Query: 80  VSIWGRDDDDYSGET-ELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSE 138
           +++W        G T E +A+++GH   V  +  S DG  + + + D+++  W+  E S+
Sbjct: 521 LTLW-------DGNTLEPMAILKGHSFRVLHMTLSTDGTTVVSGAGDETLRYWKLFEKSK 573

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 82/190 (43%), Gaps = 34/190 (17%)

Query: 18  WSVDISK--GLLATGSADRKIKLVDVRNFKLVEELDD------------------TAHKK 57
           ++VD+S     LATG  D KI++  + +     EL+                   + H  
Sbjct: 21  YTVDVSHDGKRLATGGLDGKIRIWSIDSILRCMELESLTPEIPLPQDLQMPLCSMSRHTG 80

Query: 58  AVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDD-----YSGETE-----LLAVIEGHENEV 107
           ++  V + P    LA+GS D  + IW  D++      +  E E     +   +  H+N++
Sbjct: 81  SITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSEHEREHWTVRKRLVAHDNDI 140

Query: 108 KSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLAS 167
           + + W+ D + L T   D+SV +W        FE       H   VK +V+  +    A+
Sbjct: 141 QDICWAPDSSILVTVGLDRSVIVWNG----STFEKLKRFDVHQSLVKGVVFDPANKYFAT 196

Query: 168 SSYDDTVRIW 177
           +S D T++I+
Sbjct: 197 TSDDRTMKIF 206

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 46/123 (37%), Gaps = 30/123 (24%)

Query: 101 EGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHA 160
           E  + E+ +V  SHDG  LAT   D  + IW  D +    E  S+  E            
Sbjct: 14  ESRKYEIYTVDVSHDGKRLATGGLDGKIRIWSIDSILRCMELESLTPE------------ 61

Query: 161 SRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTV 220
                          I   QD      + +S H G++ C  F  +  G  L SGSDD  +
Sbjct: 62  ---------------IPLPQDLQMPLCS-MSRHTGSITCVKF--SPDGKYLASGSDDRIL 103

Query: 221 RIW 223
            IW
Sbjct: 104 LIW 106

 Score = 32.0 bits (71), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 10/71 (14%)

Query: 208 GIRLCSGSDDTTVRIW------RCLTDDADVFDKEWIQETVLP----AVHTRAVYSVSWS 257
           G RL +G  D  +RIW      RC+  ++   +    Q+  +P    + HT ++  V +S
Sbjct: 29  GKRLATGGLDGKIRIWSIDSILRCMELESLTPEIPLPQDLQMPLCSMSRHTGSITCVKFS 88

Query: 258 ADGLIASVGSD 268
            DG   + GSD
Sbjct: 89  PDGKYLASGSD 99

>Scas_558.3
          Length = 725

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 110/228 (48%), Gaps = 31/228 (13%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEV-KSVAW 112
            H   V +++++ H + + +GS+DTT  +W      +S        +EGH+  V  +   
Sbjct: 100 GHHSNVCALSYK-HMSAIISGSWDTTAKVWINGALQWS--------LEGHQASVWDAKII 150

Query: 113 SHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDD 172
           S +     T S D++V +W+ ++L + F        HS  +++I   +S   +A+ S D 
Sbjct: 151 SVEENTFITASADRTVKLWKENKLLKTFSG-----IHSDVIRNIEVLSSGKEIATCSNDG 205

Query: 173 TVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADV 232
           T++I    D D     VLSGH   V+  + + ++ G +L S  +D ++RIW       D+
Sbjct: 206 TIKI---SDLDGNIKQVLSGHESFVY--NVKLSKQGDKLVSCGEDRSLRIW-------DI 253

Query: 233 FDKEWIQETV-LPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQA 279
            +   I++ + LPAV   +++ V    +G I    SD  + ++ E Q 
Sbjct: 254 NNNFNIKQVIKLPAV---SIWCVDTLPNGDIVVGCSDNTVRIFTEDQT 298

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 76/177 (42%), Gaps = 23/177 (12%)

Query: 9   SLKLHGDRCWS---VDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWR 65
           SL+ H    W    + + +    T SADR +KL   +  KL++      H   +R++   
Sbjct: 136 SLEGHQASVWDAKIISVEENTFITASADRTVKLW--KENKLLKTFSGI-HSDVIRNIEVL 192

Query: 66  PHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRD 125
                +A  S D T+ I   D +       +  V+ GHE+ V +V  S  G  L +C  D
Sbjct: 193 SSGKEIATCSNDGTIKISDLDGN-------IKQVLSGHESFVYNVKLSKQGDKLVSCGED 245

Query: 126 KSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLL---LASSSYDDTVRIWAE 179
           +S+ IW   +++  F    V++  +      +W    L    +     D+TVRI+ E
Sbjct: 246 RSLRIW---DINNNFNIKQVIKLPAVS----IWCVDTLPNGDIVVGCSDNTVRIFTE 295

>AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH]
           (424004..425659) [1656 bp, 551 aa]
          Length = 551

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 99/225 (44%), Gaps = 21/225 (9%)

Query: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTA--HKKAVRSVAW 64
           +R+L  H DR   +  ++ +L++GS D KI   DVR   + E   +TA  H + V  + W
Sbjct: 322 IRTLSGHLDRVACLSWNQHILSSGSKDHKILHRDVR---MPEHYFETANTHSQEVCGLKW 378

Query: 65  RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS-HDGAYLAT-- 121
               N LA+G  D  V ++     D   +  +L   E H   VK++AWS H  A LAT  
Sbjct: 379 NVDENRLASGGNDNVVYVY-----DGPSKKPVLKFTE-HNAAVKAMAWSPHRRATLATGG 432

Query: 122 CSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQD 181
            + D+ + IW    ++     N V  +    V ++VW  +   + +S       +     
Sbjct: 433 GTADRRLKIW---NVNSGVRLNDV--DTGSQVCNMVWSKNTDEIVTSHGYSKFNLTLWDC 487

Query: 182 DDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCL 226
              E  AVL GH   V       +  G  + SG+ D T+R W+  
Sbjct: 488 PTLEPLAVLKGHSFRVL--HLTLSTDGTTIVSGAGDETLRYWKLF 530

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 72/145 (49%), Gaps = 16/145 (11%)

Query: 100 IEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVW- 158
           ++GH  +V +  +  +G Y+ T + DK + +++AD   E+F+   V  E        VW 
Sbjct: 362 LDGHRTKVVT-CFQFEGNYIITGADDKRINVYDADR--EQFKLELVGHEGG------VWA 412

Query: 159 --HASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIR-LCSGS 215
             +A   +L S S D TVRIW  +    +C  V  GH  TV C D      GI+ + +GS
Sbjct: 413 LKYAGDEILVSGSTDRTVRIWNVKAG--KCTHVFRGHTSTVRCLDVVE-HGGIKYVVTGS 469

Query: 216 DDTTVRIWRCLTDDADVFDKEWIQE 240
            D T+ +W+    ++  ++   +++
Sbjct: 470 RDNTLHVWKLPDPNSPDYNPNAMRQ 494

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 95/215 (44%), Gaps = 33/215 (15%)

Query: 27  LATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRD 86
           + TG+ D++I + D    +   EL    H+  V ++ +     +L +GS D TV IW   
Sbjct: 380 IITGADDKRINVYDADREQFKLEL--VGHEGGVWALKYAGD-EILVSGSTDRTVRIWN-- 434

Query: 87  DDDYSGETELLAVIEGHENEVKSV-AWSHDG-AYLATCSRDKSVWIWE-ADELSEEFECN 143
                   +   V  GH + V+ +    H G  Y+ T SRD ++ +W+  D  S ++  N
Sbjct: 435 ----VKAGKCTHVFRGHTSTVRCLDVVEHGGIKYVVTGSRDNTLHVWKLPDPNSPDYNPN 490

Query: 144 S---------------VLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAA 188
           +               VL+ H   V+ +  H +  ++ S SYD  + +W       +   
Sbjct: 491 AMRQFNSIEDNPFFVGVLRGHMASVRTVSGHGN--IVVSGSYDHNLMVW--DIAKMKLLY 546

Query: 189 VLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           VL+GH   ++ + ++      R  S S DTTV++W
Sbjct: 547 VLTGHTDRIYSTLYDHKRK--RCISASMDTTVKVW 579

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 43/86 (50%), Gaps = 8/86 (9%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
            H  +VR+V+   H N++ +GS+D  + +W         + +LL V+ GH + + S  + 
Sbjct: 510 GHMASVRTVSG--HGNIVVSGSYDHNLMVWD------IAKMKLLYVLTGHTDRIYSTLYD 561

Query: 114 HDGAYLATCSRDKSVWIWEADELSEE 139
           H      + S D +V +W+  +++  
Sbjct: 562 HKRKRCISASMDTTVKVWDLSDINNN 587

 Score = 32.3 bits (72), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 63/157 (40%), Gaps = 16/157 (10%)

Query: 3   NLHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSV 62
           N   V  L+ H     +V     ++ +GS D  + + D+   KL+  L  T H   + S 
Sbjct: 501 NPFFVGVLRGHMASVRTVSGHGNIVVSGSYDHNLMVWDIAKMKLLYVL--TGHTDRIYST 558

Query: 63  AWRPHCNVLAAGSFDTTVSIWGRDDDDYSGE------TELLAV------IEGHENEVKSV 110
            +        + S DTTV +W   D + +G       T  L V      + GH   V  +
Sbjct: 559 LYDHKRKRCISASMDTTVKVWDLSDINNNGPVSQINSTSALKVSGSVRTLCGHTALVGLL 618

Query: 111 AWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQ 147
             S    YL + + D S+  W+A + S+ F  +   Q
Sbjct: 619 GLS--DKYLVSAAADGSLRGWDASDYSKRFSFHHTNQ 653

>Sklu_2416.5 YNL317W, Contig c2416 8692-10071
          Length = 459

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/251 (21%), Positives = 110/251 (43%), Gaps = 36/251 (14%)

Query: 5   HLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAW 64
           H++ ++K      W+ +  + ++AT S +  +      NF+ + +    AH  AV ++ +
Sbjct: 82  HVIPAIK------WTPEGRRLVVATYSGEFSLWNGSTFNFESIMQ----AHDSAVTTMEY 131

Query: 65  RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVI-EGHENEVKSVAWSHDGAYLATCS 123
               + L +G  D  + IW  + +       ++ V+ + H   V+ V++S   +   TCS
Sbjct: 132 SHAGDWLISGDSDGIIKIWQPNFN-------MVKVLDQAHMECVRDVSFSGTDSKFVTCS 184

Query: 124 RDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDD 183
            D  + IW      +E     VL  H  DVK   WH +  L+ S S D+ +++W  +   
Sbjct: 185 DDNILKIWNFSNGQQE----RVLSGHHWDVKSCDWHPTMGLIVSGSKDNLIKLWDPRSG- 239

Query: 184 WECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW---------RCLTDDADVFD 234
            +C + + G   T+  + F+  + G  L   + D + +I+         +   D++D   
Sbjct: 240 -QCISTILGFKHTIIKTKFQPTK-GNLLAVVAKDKSCKIFDIRQNMKELKSFRDESDYMS 297

Query: 235 KEW--IQETVL 243
             W  I E++ 
Sbjct: 298 LTWHPINESIF 308

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGR 85
           AH K + S+++ P  ++LA+ S D T+  W R
Sbjct: 338 AHDKCITSLSYNPVGHILASASKDRTIRFWTR 369

 Score = 28.9 bits (63), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 71/161 (44%), Gaps = 17/161 (10%)

Query: 25  GLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRP-HCNVLAAGSFDTTVSIW 83
           GL+ +GS D  IKL D R+ + +  +     K  +    ++P   N+LA  + D +  I+
Sbjct: 220 GLIVSGSKDNLIKLWDPRSGQCISTI--LGFKHTIIKTKFQPTKGNLLAVVAKDKSCKIF 277

Query: 84  GRDDDDYSGETELLAVIEGHENEVKSVAWS--HDGAYLATCSRDKSVWIWEADELSEEFE 141
               D      EL +  +  E++  S+ W   ++  +   C  D S  +   D L +   
Sbjct: 278 ----DIRQNMKELKSFRD--ESDYMSLTWHPINESIFTVGC-YDGS--LKHFDLLQDTGS 328

Query: 142 CNS---VLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAE 179
            NS   +   H + +  + ++    +LAS+S D T+R W  
Sbjct: 329 SNSFHDIPYAHDKCITSLSYNPVGHILASASKDRTIRFWTR 369

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 103/223 (46%), Gaps = 45/223 (20%)

Query: 29  TGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDD 88
           TG+ D+ I++ D    K + EL  + H   V ++ +  +  +L +GS D +V IW    +
Sbjct: 384 TGADDKMIRIYDSITKKFLIEL--SGHDGGVWALKYAGN-GILVSGSTDRSVRIW----N 436

Query: 89  DYSGETELLAVIEGHENEVKSV-AWSHDGA-YLATCSRDKSVWIWEADELSEE------- 139
            + G+     V +GH + V+ +    H+G  Y+ T SRD ++ IW+  ++S+        
Sbjct: 437 IHLGKCT--HVFKGHTSTVRCLDIVEHEGVKYIVTGSRDNTLHIWKLPQMSDSNIDEGMP 494

Query: 140 --FECNSVLQEHSQD---------------VKHIVWHASRLLLASSSYDDTVRIWAEQDD 182
             +  N  L  HS +               V+ +  H    ++ S SYD+ + +W     
Sbjct: 495 NVYSNNGPLFFHSPEENPYFVGVLRGHIASVRTVSGHGR--IVISGSYDNNLIVW--DII 550

Query: 183 DWECAAVLSGHGGTVWCS--DFERAETGIRLCSGSDDTTVRIW 223
             +C  +L GH   ++ +  D++R     R  S S D+T++IW
Sbjct: 551 QMKCLYILMGHTDRIYSTIYDYKRN----RCISASMDSTIKIW 589

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 58/127 (45%), Gaps = 8/127 (6%)

Query: 98  AVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIV 157
             ++GH   V +     D  Y+ T + DK + I+  D ++++F     L  H   V  + 
Sbjct: 362 TTLKGHMTSVVTCLQFEDN-YVITGADDKMIRIY--DSITKKFLIE--LSGHDGGVWALK 416

Query: 158 WHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDD 217
           + A   +L S S D +VRIW       +C  V  GH  TV C D    E    + +GS D
Sbjct: 417 Y-AGNGILVSGSTDRSVRIWNIHL--GKCTHVFKGHTSTVRCLDIVEHEGVKYIVTGSRD 473

Query: 218 TTVRIWR 224
            T+ IW+
Sbjct: 474 NTLHIWK 480

 Score = 32.0 bits (71), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 60/144 (41%), Gaps = 26/144 (18%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
            H  +VR+V+   H  ++ +GS+D  + +W         + + L ++ GH + + S  + 
Sbjct: 520 GHIASVRTVSG--HGRIVISGSYDNNLIVWDII------QMKCLYILMGHTDRIYSTIYD 571

Query: 114 HDGAYLATCSRDKSVWIWEADELSEEFECNSV----------------LQEHSQDVKHIV 157
           +      + S D ++ IW+   +    EC +V                LQ H+  V   +
Sbjct: 572 YKRNRCISASMDSTIKIWDLQNIWNNGECVNVTNATVPCTKITGPMMTLQGHTALVG--L 629

Query: 158 WHASRLLLASSSYDDTVRIWAEQD 181
              S   L S++ D ++R W   D
Sbjct: 630 LKLSDKFLVSAAADGSLRGWDSSD 653

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 77/176 (43%), Gaps = 21/176 (11%)

Query: 54  AHKKAVRSVAWRPHC-NVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAW 112
            HK    S+ + P   ++L +G  D  + +W     D+  E ELL   EGH   +K + +
Sbjct: 133 GHKNGTTSLRFIPKTGHLLLSGGNDNIIKLW-----DFYHERELLRTYEGHSMTIKDLNF 187

Query: 113 SHDGAYLATCSRDKSVWIWEADE--LSEEFECNSV---LQEHSQDVKHIVWHASRLLLAS 167
           + +G   A+ S DK V IW  ++  + +    NSV   +  H +D   +V   S   +  
Sbjct: 188 TDNGHSFASASFDKWVKIWNTEKGIIDKRLRFNSVPNCITFHPKDKNQLVVGLSNSEI-- 245

Query: 168 SSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
             YD  +R+     +          H G++    +     G +L S S+D TVRIW
Sbjct: 246 RHYD--LRLSENHGE----VQKYDHHQGSILALKY--FPDGKKLISSSEDKTVRIW 293

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 78/195 (40%), Gaps = 28/195 (14%)

Query: 43  NFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEG 102
           N + V +   T+H +    + W P    +A  S D +V I             LL    G
Sbjct: 42  NRRTVSQTLVTSHARPFSELCWSPDGQCIATASDDFSVEIIHL-------SYGLLHTFIG 94

Query: 103 HENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHI-VWHAS 161
           H   V S+ ++  G  L T S D+S+ IW  D L+        +  HS+ V  + V    
Sbjct: 95  HTAPVISLTFNRKGNLLFTSSMDESIKIW--DTLNGSLM--KTISAHSEAVVSVDVPMND 150

Query: 162 RLLLASSSYDDTVRIWAEQ----------DDDWECAAVLSGHGGTVWCSDFERAETGIRL 211
             +L+S SYD  +RI+  +          D DW+         G V  S  + +E    L
Sbjct: 151 SSILSSGSYDGLIRIFDAETGHCLKTLTYDKDWK------RENGVVPISQVKFSENARYL 204

Query: 212 CSGSDDTTVRIWRCL 226
              S D  V+IW C+
Sbjct: 205 LVKSLDGVVKIWDCI 219

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 75/175 (42%), Gaps = 20/175 (11%)

Query: 98  AVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIV 157
            ++  H      + WS DG  +AT S D SV I     +   +        H+  V  + 
Sbjct: 49  TLVTSHARPFSELCWSPDGQCIATASDDFSVEI-----IHLSYGLLHTFIGHTAPVISLT 103

Query: 158 WHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDD 217
           ++    LL +SS D++++IW   +        +S H   V   D    ++ I L SGS D
Sbjct: 104 FNRKGNLLFTSSMDESIKIWDTLNGSL--MKTISAHSEAVVSVDVPMNDSSI-LSSGSYD 160

Query: 218 TTVRIW-----RCLTDDADVFDKEWIQET-VLPAVHTR----AVYSVSWSADGLI 262
             +RI+      CL      +DK+W +E  V+P    +    A Y +  S DG++
Sbjct: 161 GLIRIFDAETGHCL--KTLTYDKDWKRENGVVPISQVKFSENARYLLVKSLDGVV 213

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 77/185 (41%), Gaps = 15/185 (8%)

Query: 1   MPNLHLVRSLKLH-GDRCWSVDISK--GLLATGSADRKIKLVDVRNFKLVEELDDTAHKK 57
           MP L L     L   D   SV IS     +A    D  +K+  + + K    L    HK 
Sbjct: 514 MPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSL--YGHKL 571

Query: 58  AVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGA 117
            V S+       ++   S D  + IWG D  D      L A    H++ + +V +  +  
Sbjct: 572 PVLSMDISYDSKLIVTCSADKNIKIWGLDFGD--CHKSLFA----HQDSIMNVKFLPESY 625

Query: 118 YLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
              +CS+D +V  W+     ++FEC   L  H  +V  I        + S+ +D ++R+W
Sbjct: 626 NFFSCSKDATVKYWDG----QKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVW 681

Query: 178 AEQDD 182
            E +D
Sbjct: 682 EETED 686

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 70/163 (42%), Gaps = 17/163 (10%)

Query: 62  VAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLAT 121
           + + P  N+LAAG  D  + IW     D   +T L++   GH++ +  +A+   G  L +
Sbjct: 85  LKYHPETNLLAAGYADGVIKIW-----DLISKTVLIS-FNGHKSAITVLAFDTTGTRLIS 138

Query: 122 CSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQD 181
            S+D  + +W+    S  ++  S      +D    +W      L S+S D  V+IW  + 
Sbjct: 139 ASKDSDIIVWDLVGESGLYKLRS-----HKDAITGLWCEDENWLISTSKDGLVKIWDLKS 193

Query: 182 DDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWR 224
              +C      H G  W       E     CS   D+ V++W+
Sbjct: 194 Q--QCVETHLAHTGECWSLGI--IEDMAVTCSA--DSQVKLWK 230

 Score = 35.8 bits (81), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 58/244 (23%), Positives = 94/244 (38%), Gaps = 42/244 (17%)

Query: 2   PNLHLVRSLKLHGDRC----WSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKK 57
           P    + ++ LHG R      S+     LLAT S +  +K+ +++             K+
Sbjct: 374 PAPLKLHTIDLHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKT------------KR 420

Query: 58  AVRSV--AWRPHCNVLAAGSFDTTVSIWGRDDD----DYSGETELLAVIEGHENEVKSVA 111
            +RS    +   C  L  G+    V +  R+ +    D +  T L      H+  + S+ 
Sbjct: 421 CIRSFECGYALTCKFLPGGAL---VVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLD 477

Query: 112 WSHDGAYLATCSRDKSV--WIWEADELSEEFECNSVLQ----------EHSQDVKHIVWH 159
            + DG  L T S DK+V  W +E  E+    E N  +           E   D+  +V  
Sbjct: 478 LTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVIS 537

Query: 160 ASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTT 219
                +A S  D+TV+++    D  +    L GH   V   D       I  CS   D  
Sbjct: 538 PDDKFIAVSLLDNTVKVFFL--DSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSA--DKN 593

Query: 220 VRIW 223
           ++IW
Sbjct: 594 IKIW 597

>Scas_658.1
          Length = 442

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 77/174 (44%), Gaps = 17/174 (9%)

Query: 54  AHKKAVRSVAWRPHC-NVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAW 112
            H     S+ + P+  N+L +G  D  V +W     D+  +  LL   +GH   + S+ +
Sbjct: 147 GHTNGTTSLTFLPNSGNLLLSGGNDNIVKVW-----DFYHKRNLLRDYKGHSKAINSLDF 201

Query: 113 SHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLA---SSS 169
           + DG    + S D ++ IW+ ++   + + +   +    DVK   +++S  ++    S  
Sbjct: 202 NDDGTNFISSSFDHTIKIWDTEQGKVKTKLH--FKSTPNDVKFRPFNSSEFIVGFANSKI 259

Query: 170 YDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           Y    RI +E D   +   V   H  ++    F     G +  S S+D TVRIW
Sbjct: 260 YHYDTRI-SENDGRVQ---VYDHHMSSILALKF--FPDGSKFISSSEDKTVRIW 307

 Score = 35.0 bits (79), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 65/159 (40%), Gaps = 10/159 (6%)

Query: 23  SKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSI 82
           S  LL +G  D  +K+ D  + + +   D   H KA+ S+ +        + SFD T+ I
Sbjct: 161 SGNLLLSGGNDNIVKVWDFYHKRNLLR-DYKGHSKAINSLDFNDDGTNFISSSFDHTIKI 219

Query: 83  WGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEAD-ELSEEFE 141
           W    D   G+ +     +   N+VK   + +   ++   +  K   I+  D  +SE   
Sbjct: 220 W----DTEQGKVKTKLHFKSTPNDVKFRPF-NSSEFIVGFANSK---IYHYDTRISENDG 271

Query: 142 CNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQ 180
              V   H   +  + +        SSS D TVRIW  Q
Sbjct: 272 RVQVYDHHMSSILALKFFPDGSKFISSSEDKTVRIWDNQ 310

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 85/191 (44%), Gaps = 39/191 (20%)

Query: 18  WSVDISK--GLLATGSADRKIKLVDV---------------RNFKLVEELDDTA-HKKAV 59
           ++VD+S     +ATG  D KI++  V               R  +L + L + + H  +V
Sbjct: 21  YTVDVSSDGQRVATGGLDGKIRIWSVADILVFAKPKVSWPAREEQLRKPLANMSRHTGSV 80

Query: 60  RSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIE-------------GHENE 106
            ++ + P    LA+GS D  + IW +++    G  + L  +E              H+N+
Sbjct: 81  TALKFSPDNKYLASGSDDKILLIWEKEE----GAVQPLFDMENDLEHWNVRRRLVAHDND 136

Query: 107 VKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLA 166
           ++ + W+ D + L T   D+S+ +W        FE       H   VK +V+  +    A
Sbjct: 137 IQDICWAPDSSILVTVGLDRSIIVWNG----STFEKIKRFDVHQSHVKGVVFDPANKYFA 192

Query: 167 SSSYDDTVRIW 177
           ++S D TV+++
Sbjct: 193 TASDDRTVKVF 203

>KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomyces
           cerevisiae YPL183c, start by similarity
          Length = 990

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 41/157 (26%), Positives = 72/157 (45%), Gaps = 13/157 (8%)

Query: 67  HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDK 126
           H  ++ AG+    + +W  D        + +  + GHE  +  V  S++G  LA+CS D+
Sbjct: 150 HKVLVNAGTIMNGIIVWELD------SKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDR 203

Query: 127 SVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWEC 186
           S+ IW  D +S +    S    H+  + ++ +      L S S D T R+W  ++D+   
Sbjct: 204 SIIIW--DMVSGKLL--SRAWGHTARIWNLKFFNDDTQLISVSEDCTCRVWNYKNDELTI 259

Query: 187 AAVLSGH-GGTVWCSDFERAETGIRLCSGSDDTTVRI 222
             +   H    VW  D E  ET +   SG +D  +++
Sbjct: 260 KDIFESHLTKNVWGVDVE--ETNLIAISGGNDGRLKV 294

 Score = 41.2 bits (95), Expect = 0.001,   Method: Composition-based stats.
 Identities = 47/156 (30%), Positives = 69/156 (44%), Gaps = 22/156 (14%)

Query: 130 IWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAV 189
           +WE D   +       L+ H   + ++    +  LLAS S D ++ IW     D     +
Sbjct: 165 VWELDSKKKI----HTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIW-----DMVSGKL 215

Query: 190 LS---GHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAV 246
           LS   GH   +W   F   +T  +L S S+D T R+W    D+  + D   I E+ L   
Sbjct: 216 LSRAWGHTARIWNLKFFNDDT--QLISVSEDCTCRVWNYKNDELTIKD---IFESHL--- 267

Query: 247 HTRAVYSVSWSADGLIA-SVGSDGVLAVYKEVQAGR 281
            T+ V+ V      LIA S G+DG L V + V   R
Sbjct: 268 -TKNVWGVDVEETNLIAISGGNDGRLKVTELVPHNR 302

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 89/210 (42%), Gaps = 27/210 (12%)

Query: 67  HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDK 126
             N+L + S D T+  W    DD      + +  +GH + V+    + DGAY  + S DK
Sbjct: 29  QPNLLLSASRDKTLISWKLTGDDQKFGVPVRS-FKGHSHIVQDCTLTADGAYALSASWDK 87

Query: 127 SVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWEC 186
           ++ +W+        E       H  DV  +       ++ S S D T+++W  +    +C
Sbjct: 88  TLRLWDV----ATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKG---QC 140

Query: 187 AAVLSGHGGTVWCSDF-----ERA-ETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQE 240
            A L GH    W S       E+A +  + + S  +D  V+ W          ++  I+ 
Sbjct: 141 LATLLGHND--WVSQVRVVPNEKADDDSVTIISAGNDKMVKAWN--------LNQFQIEA 190

Query: 241 TVLPAVHTRAVYSVSWSADG-LIASVGSDG 269
             +   H   + +++ S DG LIAS G DG
Sbjct: 191 DFIG--HNSNINTLTASPDGTLIASAGKDG 218

 Score = 34.7 bits (78), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 37/179 (20%), Positives = 73/179 (40%), Gaps = 27/179 (15%)

Query: 5   HLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAW 64
           H+V+   L  D  +++        + S D+ ++L DV   +  +      HK  V SV  
Sbjct: 66  HIVQDCTLTADGAYAL--------SASWDKTLRLWDVATGETYQRF--VGHKSDVMSVDI 115

Query: 65  RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSV------AWSHDGAY 118
               +++ +GS D T+ +W       + + + LA + GH + V  V          D   
Sbjct: 116 DKKASMIISGSRDKTIKVW-------TIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVT 168

Query: 119 LATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
           + +   DK V  W  +    +F+  +    H+ ++  +       L+AS+  D  + +W
Sbjct: 169 IISAGNDKMVKAWNLN----QFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLW 223

>KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I subunit
           2 required for mRNA 3 -end processing, bridges two mRNA
           3 -end processing factors singleton, start by similarity
          Length = 452

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 84/202 (41%), Gaps = 26/202 (12%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVI-EGHENEVKSVAW 112
           AH  AV  + +    + + +GS D  + IW  + +       ++ V+ + H   V+ +++
Sbjct: 121 AHDSAVTVMTYSHTGDWMVSGSADGELKIWQPNFN-------MVKVMDQAHMECVREISF 173

Query: 113 SHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDD 172
           S       +CS D  + IW      +E     VL  H  DVK   WH    L+ S S D+
Sbjct: 174 SPTDQKFVSCSDDNVLKIWNFSNGQQE----RVLSGHHWDVKSCDWHPKMGLIVSGSKDN 229

Query: 173 TVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW--------- 223
            ++ W  +     C + + G   T+  + F+  + G  L   S D T +++         
Sbjct: 230 LIKFWDPRSG--SCVSTMLGFKHTIISTKFQPKQ-GNLLSVISKDKTCKVYDIRQQAKEL 286

Query: 224 RCLTDDADVFDKEW--IQETVL 243
             + DD D    +W  I ETV 
Sbjct: 287 FSVRDDVDYMTLQWHPIDETVF 308

 Score = 32.0 bits (71), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 9/49 (18%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGR---------DDDDYSGE 93
           AH+K V S+A+ P  +++A+ S D T+  W R         DD  Y+ E
Sbjct: 338 AHEKCVTSLAYSPIGHIMASASKDRTIRFWTRSRAVDPNAFDDPTYNNE 386

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 77/169 (45%), Gaps = 21/169 (12%)

Query: 59  VRSVAWRPHCNV-LAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGA 117
           VR VA  P  N     GS DTT+ +W    D  +G+  L   + GH   V+ VA S    
Sbjct: 142 VRCVAIDPVDNEWFITGSNDTTMKVW----DLATGK--LKTTLAGHVMTVRDVAVSDRHP 195

Query: 118 YLATCSRDKSVWIWEADELSEEFECNSVLQE---HSQDVKHIVWHASRLLLASSSYDDTV 174
           YL + S DK+V  W       + E N ++++   H   V+ +  H +  L+A++  D  +
Sbjct: 196 YLFSVSEDKTVKCW-------DLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVI 248

Query: 175 RIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           ++W  +         L GH G +  +  +      ++ S S D TVR+W
Sbjct: 249 KLWDMRTRI--PVITLVGHKGPI--NQVQCTPVDPQVVSSSTDATVRLW 293

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 92/220 (41%), Gaps = 23/220 (10%)

Query: 12  LHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVL 71
           L G R  S+  +  L+AT   D  IKL D+R    V  L    HK  +  V   P    +
Sbjct: 224 LSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIPVITL--VGHKGPINQVQCTPVDPQV 281

Query: 72  AAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLAT-CSRDKSVWI 130
            + S D TV +W    D  +G+T  + V+  H+  V++ A       +A+ C+ D   W 
Sbjct: 282 VSSSTDATVRLW----DVVAGKT--MKVLTHHKRSVRATALHPKEFSVASACTDDIRSWG 335

Query: 131 WEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLAS------SSYDDTVRIWAEQDDDW 184
                L   FE      E +  +  +  +   +L A       S YD       +     
Sbjct: 336 LAEGSLLTNFES-----EKTGIINTLSINQDDVLFAGGDNGVLSFYDYKSGHKYQSLATR 390

Query: 185 ECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWR 224
           E    L G   +V CS F++  TG+RL +G  D +++IW+
Sbjct: 391 EMVGSLEGE-RSVLCSTFDK--TGLRLITGEADKSIKIWK 427

>Scas_585.8
          Length = 460

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 79/169 (46%), Gaps = 17/169 (10%)

Query: 56  KKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHD 115
           K  + ++ W P    L   +++   S+W       +G +   ++++ H++ V  + +SH 
Sbjct: 90  KHVIPAITWTPEGRRLVVATYNGEFSLW-------NGTSFNESLMQAHDSAVSCIQYSHA 142

Query: 116 GAYLATCSRDKSVWIWEAD-ELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTV 174
           G ++ +   D  + IW+ +  + +EFE       H++ ++ I +  +     + S D+ +
Sbjct: 143 GDWMCSGDADGGIKIWQPNFNMVKEFE-----NAHTECIRDISFSNNDSKFVTCSDDNVL 197

Query: 175 RIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           +IW   +   E    LSGH   +   D+   E G+ + S S D  V++W
Sbjct: 198 KIWNFSNGQVE--RTLSGHHWDIKSCDWH-PEMGL-IVSASKDNLVKLW 242

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/263 (20%), Positives = 103/263 (39%), Gaps = 50/263 (19%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
           AH  AV  + +    + + +G  D  + IW + + +   E E       H   ++ +++S
Sbjct: 129 AHDSAVSCIQYSHAGDWMCSGDADGGIKIW-QPNFNMVKEFE-----NAHTECIRDISFS 182

Query: 114 HDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDT 173
           ++ +   TCS D  + IW       E      L  H  D+K   WH    L+ S+S D+ 
Sbjct: 183 NNDSKFVTCSDDNVLKIWNFSNGQVE----RTLSGHHWDIKSCDWHPEMGLIVSASKDNL 238

Query: 174 VRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW---------R 224
           V++W  +    +C + +     TV  + F+    G  L + S D + R++          
Sbjct: 239 VKLWDPRSG--QCISTIIKFKHTVLKTRFQPTR-GNLLAAISKDKSCRVFDIRHSMKELM 295

Query: 225 CLTDDADVFDKEW--IQET-------------------------VLPAVHTRAVYSVSWS 257
           C+ D+ D     W  I E+                         V+P  H + V S++++
Sbjct: 296 CVRDEVDYMTLTWNPINESMFTVGNYDGAMKYFDLLQDLEGPSHVIPYAHDKCVTSMAYN 355

Query: 258 ADG-LIASVGSDGVLAVYKEVQA 279
             G ++AS   D  +  +   + 
Sbjct: 356 PAGNILASASKDRTIRFWTRAKP 378

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 55/239 (23%), Positives = 97/239 (40%), Gaps = 19/239 (7%)

Query: 2   PNLHLVRSLKLHGDRCW---SVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKA 58
           PN ++V+  +     C    S   +     T S D  +K+ +  N ++   L  + H   
Sbjct: 160 PNFNMVKEFENAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNGQVERTL--SGHHWD 217

Query: 59  VRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAY 118
           ++S  W P   ++ + S D  V +W    D  SG+  +  +I+     +K+      G  
Sbjct: 218 IKSCDWHPEMGLIVSASKDNLVKLW----DPRSGQC-ISTIIKFKHTVLKTRFQPTRGNL 272

Query: 119 LATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHA-SRLLLASSSYDDTVRIW 177
           LA  S+DKS  +++     +E  C  V  E   D   + W+  +  +    +YD  ++ +
Sbjct: 273 LAAISKDKSCRVFDIRHSMKELMC--VRDE--VDYMTLTWNPINESMFTVGNYDGAMKYF 328

Query: 178 -AEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW-RCLTDDADVFD 234
              QD +     +   H   V    +  A  G  L S S D T+R W R    D + +D
Sbjct: 329 DLLQDLEGPSHVIPYAHDKCVTSMAYNPA--GNILASASKDRTIRFWTRAKPVDPNAYD 385

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 10/82 (12%)

Query: 22  ISKGLLATGSADRKIKLVDV-RNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTV 80
           I++ +   G+ D  +K  D+ ++ +    +   AH K V S+A+ P  N+LA+ S D T+
Sbjct: 311 INESMFTVGNYDGAMKYFDLLQDLEGPSHVIPYAHDKCVTSMAYNPAGNILASASKDRTI 370

Query: 81  SIWGR---------DDDDYSGE 93
             W R         DD  Y+ E
Sbjct: 371 RFWTRAKPVDPNAYDDPTYNNE 392

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 56/253 (22%), Positives = 103/253 (40%), Gaps = 55/253 (21%)

Query: 16  RCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGS 75
           +C +   +  +L  G ++ + +L ++  F ++++L  +  + AV +VA       LA GS
Sbjct: 260 KCSAFHAASNILTVGFSNGEFRLYELPEFIMIQQL--SMGQNAVNTVAINSSGEWLAFGS 317

Query: 76  FDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADE 135
                 I      ++  E+ +L   +GH + +  + +S DG+ + T S +  + IW   +
Sbjct: 318 SKLGQLIVY----EWQSESYILKQ-QGHFDTLNGLCYSPDGSKIVTASHEGKIKIW---D 369

Query: 136 LSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW------------------ 177
           ++  F C +   EH+  V  + +     +L S+S D TV+ W                  
Sbjct: 370 VASGF-CLATFDEHAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRYRNFRTFTATERIQ 428

Query: 178 --------------AEQDDDW----------ECAAVLSGHGGTVWCSDFERAETGIRLCS 213
                         A  +D +          +    LSGH G + C  F   E G+ L S
Sbjct: 429 FNSLAVDPSGEVVCAGSEDSFDIFVWSVQTGQLVDTLSGHEGPISCLSFSN-ENGV-LAS 486

Query: 214 GSDDTTVRIWRCL 226
            S D T+R+W   
Sbjct: 487 ASWDKTIRVWSLF 499

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 61/128 (47%), Gaps = 16/128 (12%)

Query: 26  LLATGSADRKIK---LVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTT-VS 81
           +L + S D  +K   L+  RNF+          +    S+A  P   V+ AGS D+  + 
Sbjct: 397 VLFSASLDGTVKAWDLIRYRNFRTFT----ATERIQFNSLAVDPSGEVVCAGSEDSFDIF 452

Query: 82  IWGRDDDDYSGET-ELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEF 140
           +W       S +T +L+  + GHE  +  +++S++   LA+ S DK++ +W     S++ 
Sbjct: 453 VW-------SVQTGQLVDTLSGHEGPISCLSFSNENGVLASASWDKTIRVWSLFGRSQQV 505

Query: 141 ECNSVLQE 148
           E   V  +
Sbjct: 506 EPFEVFSD 513

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 45/104 (43%), Gaps = 9/104 (8%)

Query: 106 EVKSVAWSHDGAYLA-TCSRDKSVWIWEADELSEEFECNSVLQE-----HSQDVKHIVWH 159
           +V  + +S DG   A  C R   + IW   E +E+ +    ++      H  D+  + W 
Sbjct: 98  KVYDLKFSPDGKLFALACGR--FLQIWRTPETTEDRQFAPFVRYRIHAGHFSDITSLTWS 155

Query: 160 ASRLLLASSSYDDTVRIWAEQDDDWECAA-VLSGHGGTVWCSDF 202
                + S+S D T RIW+   ++   A+   +GH   V  + F
Sbjct: 156 KDSRFIISTSKDLTARIWSVNSEEKNLASTTFAGHRDNVIGAYF 199

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 35/79 (44%), Gaps = 3/79 (3%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
            H   + S+ W      + + S D T  IW  + ++ +  +   A   GH + V    +S
Sbjct: 144 GHFSDITSLTWSKDSRFIISTSKDLTARIWSVNSEEKNLASTTFA---GHRDNVIGAYFS 200

Query: 114 HDGAYLATCSRDKSVWIWE 132
            D   + T S+D +++ WE
Sbjct: 201 DDQEKIYTVSKDGALFQWE 219

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 44/102 (43%), Gaps = 10/102 (9%)

Query: 43  NFKLVEELDDTAHKKAVRSVAWRPHCNV--LAAGSFDTTVSIWGRDD---DDYSGETELL 97
           NFK    L     K+ V  + + P   +  LA G F   + IW   +   D         
Sbjct: 83  NFKTRNVLHHFNFKEKVYDLKFSPDGKLFALACGRF---LQIWRTPETTEDRQFAPFVRY 139

Query: 98  AVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEE 139
            +  GH +++ S+ WS D  ++ + S+D +  IW  +  SEE
Sbjct: 140 RIHAGHFSDITSLTWSKDSRFIISTSKDLTARIWSVN--SEE 179

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 77/174 (44%), Gaps = 21/174 (12%)

Query: 54  AHKKAVRSVAWRPHCNV-LAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAW 112
            H   VR+VA  P  N   A GS DTT+ IW    D  +G+ +L   + GH   VK +  
Sbjct: 127 GHNGWVRTVAVDPIDNEWFATGSNDTTIKIW----DLATGKLKL--TLSGHIMTVKDICI 180

Query: 113 SHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQE---HSQDVKHIVWHASRLLLASSS 169
           S    Y+ + S DK V  W       + E N V+++   H   V  +  H +  L+A++ 
Sbjct: 181 SKRHPYMFSASEDKLVKCW-------DLEKNRVIRDYHGHLSGVHTVDIHPTLNLIATAG 233

Query: 170 YDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
            D  VR+W    D      V++  G     +  +      ++ S S D TVR+W
Sbjct: 234 RDSVVRLW----DIRTKLPVMTMAGHKSPINRVKCLPVDPQVVSCSADATVRLW 283

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 95/229 (41%), Gaps = 27/229 (11%)

Query: 6   LVRSLKLHGDRCWSVDISK--GLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVA 63
           ++R    H     +VDI     L+AT   D  ++L D+R    V  +    HK  +  V 
Sbjct: 206 VIRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVRLWDIRTKLPVMTM--AGHKSPINRVK 263

Query: 64  WRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYL--AT 121
             P    + + S D TV +W    D  +G+T  L V+  H+  V+ +   H G +   + 
Sbjct: 264 CLPVDPQVVSCSADATVRLW----DITAGKT--LKVLTHHKRSVRDIGI-HPGEFSISSA 316

Query: 122 CSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSS------YDDTVR 175
           C+ D   W     +L   F+      E +  +  +  +   +L A S       YD    
Sbjct: 317 CTDDIRSWKLPEGQLLTNFQS-----EKTGIINTLSINQDDVLFAGSDNGVLSFYDYKTG 371

Query: 176 IWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWR 224
              +Q D  E    L    G +  S F+  +TG+RL +G  D +++IW+
Sbjct: 372 HKYQQLDTTEIPGSLESERG-ILTSTFD--QTGLRLITGESDKSIKIWK 417

>Scas_721.7
          Length = 325

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 88/220 (40%), Gaps = 38/220 (17%)

Query: 23  SKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSI 82
             G L   +   +I + D++  + +  +  T+H   +  VAW P    LA+ S D T+ I
Sbjct: 25  PNGRLIAVTQLTQILIYDLQT-RAIHSIIPTSHVAPISEVAWSPDNQCLASASDDFTIEI 83

Query: 83  WGRDDDDYSGETEL----LAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSE 138
                      T L    L  + GH   V S+ ++  G  L T S D+S+ IW+    + 
Sbjct: 84  -----------THLTHGCLHRLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWD----TF 128

Query: 139 EFECNSVLQEHSQDVKHIVWHASR--LLLASSSYDDTVRIWAEQ----------DDDWEC 186
                  +  HS+ V  +     R   +LAS S+D  +R++  +          D DW+ 
Sbjct: 129 HGAILKTISAHSESVVSLSICPDRDSSVLASGSFDGLIRLFDTRTGHCLKTLTYDKDWK- 187

Query: 187 AAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCL 226
                   G V  S    +  G  L   S D  V+IW C+
Sbjct: 188 -----SDDGVVPISQVRFSPNGKFLLVSSFDGIVKIWDCV 222

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 39/90 (43%), Gaps = 14/90 (15%)

Query: 6   LVRSLKLHGDRCWSVDISK----GLLATGSADRKIKLVDVRNFKLVEEL--------DDT 53
           +++++  H +   S+ I       +LA+GS D  I+L D R    ++ L        DD 
Sbjct: 132 ILKTISAHSESVVSLSICPDRDSSVLASGSFDGLIRLFDTRTGHCLKTLTYDKDWKSDDG 191

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIW 83
                +  V + P+   L   SFD  V IW
Sbjct: 192 V--VPISQVRFSPNGKFLLVSSFDGIVKIW 219

>Kwal_23.6240
          Length = 913

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 99/254 (38%), Gaps = 57/254 (22%)

Query: 16  RCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGS 75
           +C +   +   L  G  + + +L ++  F L+++L  +  + AV +V        LA GS
Sbjct: 260 KCVTFHANSNTLVVGFNNGEFRLYELPEFTLIQQL--SMGQNAVNTVCVNDSGEWLAFGS 317

Query: 76  FDT-TVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEAD 134
                + ++     ++  E+ +L   +GH +   +V +S DG+ + T S D  + IW   
Sbjct: 318 SKLGQLLVY-----EWQSESYILKQ-QGHFDATNAVTYSPDGSRVVTASEDGKIKIW--- 368

Query: 135 ELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW------------AEQDD 182
           ++   F C    QEH+  V  + +     +L S+S D TVR W            A +  
Sbjct: 369 DVVSGF-CLVTFQEHTAAVSALAFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERI 427

Query: 183 DWECAA------------------------------VLSGHGGTVWCSDFERAETGIRLC 212
            + C A                               L GH G V C  F +  +   L 
Sbjct: 428 QFNCLAADPSGEVVCAGSVDSFAVHVWSVQTGQLVETLDGHEGPVSCLSFSQENS--VLA 485

Query: 213 SGSDDTTVRIWRCL 226
           S S D T+RIW   
Sbjct: 486 SASWDKTIRIWSIF 499

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 60/121 (49%), Gaps = 16/121 (13%)

Query: 26  LLATGSADRKIK---LVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDT-TVS 81
           +L + S D  ++   LV  RNF+        A +     +A  P   V+ AGS D+  V 
Sbjct: 397 VLFSASLDGTVRAWDLVRYRNFRTFT----AAERIQFNCLAADPSGEVVCAGSVDSFAVH 452

Query: 82  IWGRDDDDYSGET-ELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEF 140
           +W       S +T +L+  ++GHE  V  +++S + + LA+ S DK++ IW     S++ 
Sbjct: 453 VW-------SVQTGQLVETLDGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQV 505

Query: 141 E 141
           E
Sbjct: 506 E 506

 Score = 35.8 bits (81), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 90/214 (42%), Gaps = 25/214 (11%)

Query: 5   HLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAW 64
           +L+ ++   G+  +S D ++ +   G+      L+  +++    E     H+K V+ VA 
Sbjct: 9   NLLGTVYRQGNILFSEDGTQLISPVGNRVSVFDLIHNKSYTFEYE-----HRKNVQCVAL 63

Query: 65  RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLA-TCS 123
            P   +L +   D    +      ++  +T L       +  V  + +S DG   A  C 
Sbjct: 64  NPQGTLLLSVDEDGRAILV-----NFRAKTVLHHF--NFKEPVSDLKFSPDGKVFAIACG 116

Query: 124 RDKSVWIWEADELSEE-----FECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWA 178
           R   V +W+  +++E+     F  + V   H  ++  + W      L S+S D T RIW+
Sbjct: 117 R--FVQVWKTPDVAEDRQFAPFVRHRVHAGHFSNIISLTWSRDSRFLISTSKDLTARIWS 174

Query: 179 EQDDDWECAAV-LSGH----GGTVWCSDFERAET 207
               +   A+V  +GH     G  + +D ER  T
Sbjct: 175 LDSQEKGLASVTFAGHRDYVMGAFFSADQERIYT 208

>Kwal_56.24163
          Length = 729

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 56/120 (46%), Gaps = 14/120 (11%)

Query: 62  VAWRPH-CNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENE-VKSVAWS--HDGA 117
           VA+ P   +  A+   D TV IW        G+      ++ HE   V  V +    D  
Sbjct: 3   VAFNPKDPSTFASACLDHTVKIWSL------GQPTANFTLQAHETRGVNYVDYYPLQDKP 56

Query: 118 YLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
           YL T S D++V IW+    S    C + L+ H  +V + V+H S  ++ S S D T+++W
Sbjct: 57  YLITSSDDRTVKIWDYQTKS----CVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVW 112

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 55/118 (46%), Gaps = 11/118 (9%)

Query: 113 SHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEH-SQDVKHIVWHA--SRLLLASSS 169
             D +  A+   D +V IW   + +  F     LQ H ++ V ++ ++    +  L +SS
Sbjct: 7   PKDPSTFASACLDHTVKIWSLGQPTANF----TLQAHETRGVNYVDYYPLQDKPYLITSS 62

Query: 170 YDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLT 227
            D TV+IW  Q     C A L GH   V  + F  +   I   SGS+D T+++W   T
Sbjct: 63  DDRTVKIWDYQTK--SCVATLEGHMANVSYAVFHPSLPII--LSGSEDGTLKVWNSNT 116

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 2/63 (3%)

Query: 24  KGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIW 83
           K  L T S DR +K+ D +    V  L+   H   V    + P   ++ +GS D T+ +W
Sbjct: 55  KPYLITSSDDRTVKIWDYQTKSCVATLE--GHMANVSYAVFHPSLPIILSGSEDGTLKVW 112

Query: 84  GRD 86
             +
Sbjct: 113 NSN 115

>YIR012W (SQT1) [2677] chr9 (378483..379778) Protein that may be
           required for ribosomal assembly, contains WD (WD-40)
           repeats [1296 bp, 431 aa]
          Length = 431

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/237 (20%), Positives = 98/237 (41%), Gaps = 33/237 (13%)

Query: 55  HKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSH 114
           H  +V ++   P+  ++  G  D    +W      +S   +    + G+   V S +++ 
Sbjct: 64  HTDSVFAIGHHPNLPLVCTGGGDNLAHLW----TSHSQPPKFAGTLTGYGESVISCSFTS 119

Query: 115 DGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASS----SY 170
           +G +L T      V +    +   +++  S +QE    V+ IVW  +   +A +    + 
Sbjct: 120 EGGFLVTADMSGKVLVHMGQKGGAQWKLASQMQE----VEEIVWLKTHPTIARTFAFGAT 175

Query: 171 DDTVRIWAEQDDDWECAAVLSGHGGTVWCS-----DFERAETGIRLCSGSDDTTVRIWRC 225
           D +V  +   + D     ++SG      CS     + ++ E  + L + S D+T+  W C
Sbjct: 176 DGSVWCYQINEQDGSLEQLMSGFVHQQDCSMGEFINTDKGENTLELVTCSLDSTIVAWNC 235

Query: 226 LT-------DDADV--FDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAV 273
            T         A++   +  WI  ++ P   T+          G++A   ++G+LAV
Sbjct: 236 FTGQQLFKITQAEIKGLEAPWISLSLAPETLTKG-------NSGVVACGSNNGLLAV 285

>ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH]
           complement(590077..591354) [1278 bp, 425 aa]
          Length = 425

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 77/175 (44%), Gaps = 21/175 (12%)

Query: 53  TAHKKAVRSVAWRPHCNV-LAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVA 111
             H   VR V   P  N   A GS D+T+ +W    D  +G+  L   ++GH   V+ + 
Sbjct: 110 NGHTGWVRCVCVDPVDNAWFATGSNDSTIRVW----DLATGK--LKVTLQGHIMTVRDIC 163

Query: 112 WSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHS---QDVKHIVWHASRLLLASS 168
            S    Y+ + S+DK V  W       + E N+V+++       V  +  H S  L+ S+
Sbjct: 164 ISARHPYMFSASQDKLVKCW-------DLERNTVVRDFHGTLSGVHSVDLHPSLDLIVSA 216

Query: 169 SYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
             D  VR+W  +     C   L+GH G +  +         ++ S S D TV++W
Sbjct: 217 GRDSVVRVWDIRSR--SCVLTLAGHRGPI--NKVRCLPVDPQIVSCSTDATVKLW 267

 Score = 35.4 bits (80), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 64/151 (42%), Gaps = 13/151 (8%)

Query: 27  LATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRD 86
           + + S D+ +K  D+    +V +   T     V SV   P  +++ +   D+ V +W   
Sbjct: 171 MFSASQDKLVKCWDLERNTVVRDFHGTL--SGVHSVDLHPSLDLIVSAGRDSVVRVW--- 225

Query: 87  DDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVL 146
             D    + +L  + GH   +  V        + +CS D +V +W+        +    L
Sbjct: 226 --DIRSRSCVLT-LAGHRGPINKVRCLPVDPQIVSCSTDATVKLWDL----VAGKPMKTL 278

Query: 147 QEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
             H ++V+ + ++ +    AS+  DD +R W
Sbjct: 279 THHKRNVRDLAFNPTEFSFASACTDD-IRSW 308

 Score = 33.1 bits (74), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 42/97 (43%), Gaps = 1/97 (1%)

Query: 166 ASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRC 225
           A + Y++ V    +    W+   V++GH G V C   +  +      +GS+D+T+R+W  
Sbjct: 85  ALARYEEVVSQKPQWHAPWKLTRVINGHTGWVRCVCVDPVDNAW-FATGSNDSTIRVWDL 143

Query: 226 LTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLI 262
            T    V  +  I       +  R  Y  S S D L+
Sbjct: 144 ATGKLKVTLQGHIMTVRDICISARHPYMFSASQDKLV 180

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 43/98 (43%), Gaps = 5/98 (5%)

Query: 40  DVRNFKLVEELDDTAHKKAVRSVAWRPHCN---VLAAGSFDTTVSIWGRDDDDYSGETEL 96
           D+R++KLV+    T        +     CN   VL AG     +S +         + E 
Sbjct: 304 DIRSWKLVDGQLLTNFNSEALGIVNTLACNQDGVLFAGGDTGELSFFDYKTGHKFQKLET 363

Query: 97  LAVIEGHENEVKSVAWSHD--GAYLATCSRDKSVWIWE 132
            A+    E+E   +A + D  G  L TC RDKS+ IW+
Sbjct: 364 TAMPGSLESEKGVLASTFDRTGLRLLTCERDKSIKIWK 401

>Kwal_33.15591
          Length = 714

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 81/176 (46%), Gaps = 27/176 (15%)

Query: 73  AGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWE 132
           +GS+DTT  +W      + G   L   ++GH   V  V    +  +  T S D ++ +WE
Sbjct: 120 SGSWDTTAKVW------FQGA--LKHELKGHTASVWDVKMLPEVGFYMTASADGTIKLWE 171

Query: 133 ADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSG 192
            +++ + F        H+  ++HI   AS    AS S D TV+I    D + +    L G
Sbjct: 172 GEKVLKTFTG-----LHTDVIRHIDIDASGEKFASCSNDGTVKI---NDMEGKTLKTLVG 223

Query: 193 HGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHT 248
           H   V+   F  A  G  +  G +D TVRIW+     AD   K+ I+   +PAV T
Sbjct: 224 HESFVYSVKF--APNGDVISCG-EDRTVRIWK-----ADGTVKQVIR---VPAVST 268

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 93/222 (41%), Gaps = 61/222 (27%)

Query: 95  ELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADE----------LSEEF---- 140
           +L A + GHE +VKSVA  ++   +ATCSRD SV +W+              S+EF    
Sbjct: 7   KLSATLSGHEQDVKSVAVLNNDT-VATCSRDGSVRLWKKGHNNLWQDAVVYQSDEFVNSL 65

Query: 141 --------------EC--NSV---LQEHSQDVKHI---------VWHASRLLLASSSYDD 172
                          C  NSV   L +  QD + +         V ++S+  + S S+D 
Sbjct: 66  CYDNTSGLLFCGGQNCLINSVSPLLGDVGQDSEFVLIGHENNVCVLNSSQGYVLSGSWDT 125

Query: 173 TVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADV 232
           T ++W +     E    L GH  +VW       E G  + + S D T+++W         
Sbjct: 126 TAKVWFQGALKHE----LKGHTASVWDVKM-LPEVGFYM-TASADGTIKLW--------- 170

Query: 233 FDKEWIQETVLPAVHTRAVYSVSWSADG-LIASVGSDGVLAV 273
            + E + +T    +HT  +  +   A G   AS  +DG + +
Sbjct: 171 -EGEKVLKT-FTGLHTDVIRHIDIDASGEKFASCSNDGTVKI 210

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 110/254 (43%), Gaps = 39/254 (15%)

Query: 71  LAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWI 130
            A GS DTT+ IW    D  +G+ ++  +  GH   V+ +A S    Y+ + S DK V  
Sbjct: 138 FATGSNDTTIKIW----DLAAGKLKITLI--GHVMSVRDIAISKRHPYMFSASEDKLVKC 191

Query: 131 WEADELSEEFECNSVLQE---HSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECA 187
           W       + E N+ +++   H   V  +  H S  ++A++  D  VR+W  +       
Sbjct: 192 W-------DLERNTAIRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVRLWDIRSRSE--I 242

Query: 188 AVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVH 247
            VL GH   +        +  I  CSG  D TVR+W  +   A           VL   H
Sbjct: 243 MVLPGHKSPINKVKCLPVDPQIISCSG--DATVRLWDIIAGKA---------SKVL-THH 290

Query: 248 TRAVYSVSW-SADGLIASVGSDGVLAVYKEVQAGRWEVVARVDCAHTVYEINVVKWLALD 306
           +R +  ++   A+   ASV ++ V    +  +    +++      +T     ++  ++++
Sbjct: 291 SRNIRDLTLHPAEFSFASVSTNDV----RSWKLPEGQLLTNFQSQNT----GILNTVSIN 342

Query: 307 GRVLLVTGGDDGCV 320
              +L+ GGDDG +
Sbjct: 343 HDNVLLAGGDDGTL 356

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 45/112 (40%), Gaps = 1/112 (0%)

Query: 151 QDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIR 210
           Q V+ +     + +     Y+ T     +    W+ + V++GH G V C   +  +    
Sbjct: 79  QLVRRVFQQPHQQISLMERYEKTRSYKPQWHAPWKLSKVINGHTGWVRCVCVDPVDNEW- 137

Query: 211 LCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLI 262
             +GS+DTT++IW        +     +      A+  R  Y  S S D L+
Sbjct: 138 FATGSNDTTIKIWDLAAGKLKITLIGHVMSVRDIAISKRHPYMFSASEDKLV 189

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 75/187 (40%), Gaps = 36/187 (19%)

Query: 52  DTAHKKAVRSVAWRPHCNVLAAGSFDTTVSI----WGRDDDDYSGETELLAVIEGHENEV 107
           +T H + +  + W P    +A+GS D TV I    +GR           L  + GH   V
Sbjct: 51  ETTHTEPINDICWSPDSACVASGSEDFTVEITHLEYGR-----------LHKLRGHSAPV 99

Query: 108 KSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHI-VWHASRLLLA 166
            SV ++  G  L T S D+S+  W  D LS        +  HS  V  I        +L+
Sbjct: 100 LSVVFNCKGNLLCTASVDESIKQW--DVLSGTLL--KTMSAHSDPVVSIDTPDCDATILS 155

Query: 167 SSSYDDTVRIWAEQ----------DDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSD 216
           S SYD  +RI+  +          D DW+         G V  S  + +  G  L   S 
Sbjct: 156 SGSYDGLIRIFDTESGHCLKTLTYDKDWQ------TDDGVVPISQVKFSRNGKFLLVRSL 209

Query: 217 DTTVRIW 223
           D  V++W
Sbjct: 210 DGVVKLW 216

>Kwal_26.8776
          Length = 433

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 75/175 (42%), Gaps = 21/175 (12%)

Query: 53  TAHKKAVRSVAWRPHCNV-LAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVA 111
             H   VR V   P  N   A GS DTT+ +W    D  SG+ +L   + GH   V+SVA
Sbjct: 118 NGHNGWVRCVCPDPVDNAWFATGSNDTTIKVW----DMASGKLKL--TLTGHVMTVRSVA 171

Query: 112 WSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQE---HSQDVKHIVWHASRLLLASS 168
            S     + + S DK V  W       + E N+ +++   H   V  +  H +  L+AS+
Sbjct: 172 VSQRHPLMFSASEDKMVKCW-------DLERNAAIRDYHGHFSGVNTVDVHPTLDLIASA 224

Query: 169 SYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
             D  VR+W  +         L+GH   +        +  I  C  S D TVR+W
Sbjct: 225 GRDAVVRLWDIRTR--LPVMTLAGHKSPINQVKCFPVDPQIMSC--SSDATVRLW 275

>ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH]
           complement(387122..388393) [1272 bp, 423 aa]
          Length = 423

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 101/235 (42%), Gaps = 30/235 (12%)

Query: 55  HKKAVRSVAWRPHCN-VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAW- 112
           HK+    +A+ PH +  L +GS DTTV++W     D     +  +++  H++ V  V W 
Sbjct: 185 HKENGYGLAFNPHISGELLSGSDDTTVALW-----DIEAAKKPKSILTSHDDIVNDVKWH 239

Query: 113 SHDGAYLATCSRDKSVWIWEAD---ELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSS 169
             +     T S DK++ + +     E  ++    S     S   KH     SR LLA++ 
Sbjct: 240 EFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFS-KH-----SRNLLAAAG 293

Query: 170 YDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCL--- 226
            D  + ++ +  D      V+SGH  +V   +F     GI   SGSD   + IW      
Sbjct: 294 VDSQIYLY-DMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAI-IWDLTQIG 351

Query: 227 ----TDDADVFDKEWIQETVLPAVHTRAVYSVSWSADG--LIASVGSDGVLAVYK 275
                DDAD    E +   ++ A H   V   S++     L+AS   D V+  +K
Sbjct: 352 AEQSQDDADDGAPELM---MMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403

 Score = 35.8 bits (81), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 55/121 (45%), Gaps = 13/121 (10%)

Query: 23  SKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCN-VLAAGSFDTTVS 81
           S+ LLA    D +I L D+R+      +  + H+ +V +V + PH + ++ +   D    
Sbjct: 285 SRNLLAAAGVDSQIYLYDMRDMSSPLHV-MSGHQDSVTTVEFSPHTDGIICSSGSDRRAI 343

Query: 82  IW---------GRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAY-LATCSRDKSVWIW 131
           IW          +DD D  G  EL+ +  GH + V   +++    + LA+   D  +  W
Sbjct: 344 IWDLTQIGAEQSQDDAD-DGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402

Query: 132 E 132
           +
Sbjct: 403 K 403

>Kwal_27.10385
          Length = 536

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 77/176 (43%), Gaps = 29/176 (16%)

Query: 27  LATGSADRKIKL----VDVRNFKLVEELDD----TAHKKAVRSVAWRPHCNVLAAGSFDT 78
           L T   D KI++     + +N   V+ +D     T H++AV  + +    +VLA    D 
Sbjct: 34  LVTAGGDNKIRVWQLNFEEQNENKVDTIDFLSSLTQHEQAVNVIRFNSRNDVLATAGDDG 93

Query: 79  TVSIWGRDDD---DYSGETELLAVIE--------------GHENEVKSVAWSHDGAYLAT 121
            + +W R+D    ++  + E  A  +                 +E+  +AWS D  Y+ T
Sbjct: 94  QLLLWKRNDSISKEFGVDEEEFAEFKESWYVWKRLRSSSTAGSSEIYDLAWSPDDNYIVT 153

Query: 122 CSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
            S D S+ I+E     EE  C +   +H+  V+ +VW      + S S D +V ++
Sbjct: 154 GSMDNSLRIFEV----EEGTCVANAADHNHYVQGVVWDPQNEFIFSQSADRSVHVY 205

 Score = 32.7 bits (73), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 6/83 (7%)

Query: 53  TAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAW 112
           TA    +  +AW P  N +  GS D ++ I+  +      E   +A    H + V+ V W
Sbjct: 133 TAGSSEIYDLAWSPDDNYIVTGSMDNSLRIFEVE------EGTCVANAADHNHYVQGVVW 186

Query: 113 SHDGAYLATCSRDKSVWIWEADE 135
                ++ + S D+SV ++  ++
Sbjct: 187 DPQNEFIFSQSADRSVHVYRIEK 209

>Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement
          Length = 997

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 62/259 (23%), Positives = 112/259 (43%), Gaps = 26/259 (10%)

Query: 73  AGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWE 132
           AG+    V IW     D   ET++  ++ GHE  +  V  S +G Y+ +CS D+S+ +W 
Sbjct: 156 AGTVMGGVFIW-----DLFSETKVHNLL-GHEGSIFYVTLSKNGEYVVSCSDDRSIKLWN 209

Query: 133 ADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW--AEQDDDWECAAVL 190
                +  E  S    H+  +  + +  +   + S S D T R+W  A+  DD   + + 
Sbjct: 210 L----KSGELLSTGWGHTARIWQLKFIDNDTKVVSVSEDCTCRVWDIAKPHDDLVQSGIY 265

Query: 191 SGHG-GTVWCSDFERAETGIRLCSGSDD----TTVRIWRCLTDDADVFDKEWIQETVLPA 245
             H    VW  D E  E  + + SG+D     T ++      D+ +VF  + I    +  
Sbjct: 266 EVHLIKNVWGVDVEEDEM-LAITSGNDGRLKLTDLKPLSRKGDEVEVFSLQDISSGKINL 324

Query: 246 VHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQAGRWEVVAR------VDCAHTVYEINV 299
                +    W + GL+A + S G +  + + ++ +W VV +            + E+N 
Sbjct: 325 EKNEIIKGFYWLSFGLVA-ITSVGQIIKFDQ-KSSQWSVVMKDSRFSSYSVTSGIQELNT 382

Query: 300 VKWLALDGRVLLVTGGDDG 318
           V + +    +LL+   +DG
Sbjct: 383 VIFSSNKCNLLLLKFTEDG 401

>KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777.1
           Kluyveromyces lactis CRN1 homologue, start by similarity
          Length = 707

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 63/122 (51%), Gaps = 22/122 (18%)

Query: 26  LLATGSADRKIKLVDV-RNFKLVEELDD-------------TAHKKAVRSVAWRPHC-NV 70
           ++A+GS D KI + ++  ++ L E +D+             + H + V  + + P   N+
Sbjct: 108 IVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRMLSGHSRKVGHLLFHPLAENI 167

Query: 71  LAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWI 130
           LA+ S D TV IW     D S E     +   H + V S+++S+DG +L T SRDK + +
Sbjct: 168 LASSSLDYTVKIW-----DISQEEVKFTL--KHPDMVTSMSFSYDGKHLVTVSRDKKLRV 220

Query: 131 WE 132
           W+
Sbjct: 221 WD 222

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 74/182 (40%), Gaps = 28/182 (15%)

Query: 53  TAHKKAVRSVAWRPHCNVLAAGSFDTTVS----IWGRDDDDYSGETELLAVIEGHENEVK 108
           T HK+ +  + W P    +A+GS D TV     I+GR           +  + GH   V 
Sbjct: 66  TTHKECINCLCWSPDSKCIASGSEDFTVEITHIIYGR-----------IRRLMGHTAPVI 114

Query: 109 SVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHI-VWHASRLLLAS 167
           S+ +++ G  L + S D+S+  W     +        +  HS  V  I +      +L+S
Sbjct: 115 SICYNNKGNILCSSSMDESIKEWHVLSGTAL----KTMSAHSDAVVSIDIPKFDSSILSS 170

Query: 168 SSYDDTVRIWAEQDDDWECAAVLS------GHGGTVWCSDFERAETGIRLCSGSDDTTVR 221
            SYD  +RI+    +   C   L+         G V  S  + +  G  L   S D  V+
Sbjct: 171 GSYDGLIRIF--DTESGHCLKTLTYDKDWIAEDGVVPISTVKFSRNGKFLLVKSLDNVVK 228

Query: 222 IW 223
           +W
Sbjct: 229 LW 230

>Kwal_26.7570
          Length = 218

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 60/141 (42%), Gaps = 9/141 (6%)

Query: 54  AHKKAVRSVAWRP-HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAW 112
            H   V S+A  P   N+L +GS D ++  W    DD      + +   GH + V+    
Sbjct: 15  GHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRS-FRGHSHIVQDCTV 73

Query: 113 SHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDD 172
           + DG Y  + S DK+V +WE        +C      H  DV  +        + S+S D 
Sbjct: 74  TPDGEYALSASWDKTVRLWEL----ATGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDK 129

Query: 173 TVRIWAEQDDDWECAAVLSGH 193
           TV++W   +   EC   L GH
Sbjct: 130 TVKVW---NTLGECMVTLLGH 147

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 57/133 (42%), Gaps = 6/133 (4%)

Query: 96  LLAVIEGHENEVKSVAWSH-DGAYLATCSRDKSVWIWEADELSEEFECN-SVLQEHSQDV 153
           L   +EGH   V S+A S      L + SRDKS+  W+     +++       + HS  V
Sbjct: 9   LRGTLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIV 68

Query: 154 KHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCS 213
           +            S+S+D TVR+W       +C     GH   V     +R  +  ++ S
Sbjct: 69  QDCTVTPDGEYALSASWDKTVRLWELATG--KCIQRFVGHKSDVLSVTIDRRAS--QIVS 124

Query: 214 GSDDTTVRIWRCL 226
            S D TV++W  L
Sbjct: 125 ASRDKTVKVWNTL 137

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 62/163 (38%), Gaps = 29/163 (17%)

Query: 27  LATGSADRKIKLVDVRNFKLVE---ELDDTAHKKAVRSVAWRPH----CNVLAAGSF--- 76
           LAT  A   + L   R+  L+      DD  +   VRS     H    C V   G +   
Sbjct: 23  LATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCTVTPDGEYALS 82

Query: 77  ---DTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEA 133
              D TV +W           + +    GH+++V SV      + + + SRDK+V +W  
Sbjct: 83  ASWDKTVRLWEL------ATGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNT 136

Query: 134 DELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRI 176
                  EC   L  H+  V  +     R+    S  D+TV +
Sbjct: 137 LG-----ECMVTLLGHNDWVSQV-----RVAPNESPEDETVTV 169

>YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of
           the WD (WD-40) repeat family that binds to substrates
           (CLB2, CLB3, CDC5, HSL1) of the anaphase promoting
           complex (APC) and targets them for degradation [1701 bp,
           566 aa]
          Length = 566

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 109/246 (44%), Gaps = 50/246 (20%)

Query: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRN----FKLVEELDDTAHKKAVRSV 62
           +R+L  H DR   +  +  +L +GS D +I   DVR     F+ +E     +H + V  +
Sbjct: 337 IRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMPDPFFETIE-----SHTQEVCGL 391

Query: 63  AWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS-HDGAYLAT 121
            W    N LA+G  D  V ++     + + ++ +L   E H+  VK++AWS H    LAT
Sbjct: 392 KWNVADNKLASGGNDNVVHVY-----EGTSKSPILTFDE-HKAAVKAMAWSPHKRGVLAT 445

Query: 122 --CSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLAS----SSYDDTVR 175
              + D+ + IW  +   +  + +S  Q     + ++VW  +   L +    S Y+ T+ 
Sbjct: 446 GGGTADRRLKIWNVNTSIKMSDIDSGSQ-----ICNMVWSKNTNELVTSHGYSKYNLTL- 499

Query: 176 IWAEQDDDWECA-----AVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDA 230
                   W+C      A+L GH   V       +  G  + SG+ D T+R W+      
Sbjct: 500 --------WDCNSMDPIAILKGHSFRVL--HLTLSNDGTTVVSGAGDETLRYWK------ 543

Query: 231 DVFDKE 236
            +FDK 
Sbjct: 544 -LFDKP 548

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 67/128 (52%), Gaps = 14/128 (10%)

Query: 24  KGLLATG--SADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCN--VLAAGSFDTT 79
           +G+LATG  +ADR++K+ +V     + ++D  +    + ++ W  + N  V + G     
Sbjct: 440 RGVLATGGGTADRRLKIWNVNTSIKMSDIDSGSQ---ICNMVWSKNTNELVTSHGYSKYN 496

Query: 80  VSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEA-DELSE 138
           +++W  +  D       +A+++GH   V  +  S+DG  + + + D+++  W+  D+   
Sbjct: 497 LTLWDCNSMD------PIAILKGHSFRVLHLTLSNDGTTVVSGAGDETLRYWKLFDKPKA 550

Query: 139 EFECNSVL 146
           + + NS++
Sbjct: 551 KVQPNSLI 558

 Score = 28.9 bits (63), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 43/92 (46%), Gaps = 14/92 (15%)

Query: 185 ECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLP 244
           +C   LSGH   V C  +        L SGS D      R L  D  + D  +  ET+  
Sbjct: 335 KCIRTLSGHIDRVACLSWNNHV----LTSGSRD-----HRILHRDVRMPDPFF--ETI-- 381

Query: 245 AVHTRAVYSVSWS-ADGLIASVGSDGVLAVYK 275
             HT+ V  + W+ AD  +AS G+D V+ VY+
Sbjct: 382 ESHTQEVCGLKWNVADNKLASGGNDNVVHVYE 413

>Scas_720.45
          Length = 755

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 52/119 (43%), Gaps = 12/119 (10%)

Query: 62  VAWRPH-CNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSH--DGAY 118
           VA+ P   N  A+G  D TV +W          T    +  G E  V  V +    D  Y
Sbjct: 3   VAFNPKDPNTFASGCLDRTVKVWS-----LGQATPNFTLNSGQEKGVNYVDYYPLPDKPY 57

Query: 119 LATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
           L T S D +  +W+    S    C + L+ H  +V   V+H +  ++ S S D T++IW
Sbjct: 58  LITSSDDLTCKVWDYQTKS----CVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKIW 112

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 49/113 (43%), Gaps = 5/113 (4%)

Query: 115 DGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTV 174
           D    A+   D++V +W   + +  F  NS  QE   +         +  L +SS D T 
Sbjct: 9   DPNTFASGCLDRTVKVWSLGQATPNFTLNSG-QEKGVNYVDYYPLPDKPYLITSSDDLTC 67

Query: 175 RIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLT 227
           ++W  Q     C A L GH   V  + F    T   + SGS+D T++IW   T
Sbjct: 68  KVWDYQTKS--CVATLEGHMANVSFAVFH--PTLPIIISGSEDGTLKIWNSAT 116

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 48/84 (57%), Gaps = 8/84 (9%)

Query: 53  TAHKKAVRSVAWRPHC-NVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVA 111
           T H + V  + + P   +VLA+ S D TV IW  +    +GE ++  +   H + V S++
Sbjct: 136 TGHSRKVGHILYHPTAKDVLASSSLDYTVRIWNVE----TGE-DIYKL--KHPDMVTSMS 188

Query: 112 WSHDGAYLATCSRDKSVWIWEADE 135
           +S+DG +LAT +RDK + +W   E
Sbjct: 189 FSYDGTHLATVARDKKLRVWNVRE 212

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 62/164 (37%), Gaps = 31/164 (18%)

Query: 165 LASSSYDDTVRIW-------------AEQDDDWECAAVLSGHGGTVWCSDFERAETGIRL 211
           +ASSS D  + IW              E+  D E    L+GH   V    +      + L
Sbjct: 97  VASSSDDGKIGIWDIPQDYSILKSGDNEEIKDIEPTKFLTGHSRKVGHILYHPTAKDV-L 155

Query: 212 CSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGL-IASVGSDGV 270
            S S D TVRIW   T            E +    H   V S+S+S DG  +A+V  D  
Sbjct: 156 ASSSLDYTVRIWNVETG-----------EDIYKLKHPDMVTSMSFSYDGTHLATVARDKK 204

Query: 271 LAVYKEVQAGRWEVVARVDCAHTVYEINVVKWLALDGRVLLVTG 314
           L V+      R E V     AH   +   V WL    R L  TG
Sbjct: 205 LRVWN----VREEKVVSEGAAHAGAKNQRVVWLGNSER-LATTG 243

>CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces
           cerevisiae YGR200c subunit of elongating RNA polymerase
           II holoenzyme, start by similarity
          Length = 793

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 115/306 (37%), Gaps = 57/306 (18%)

Query: 23  SKGLLATGSADRKIKLVD--------VRNFKLVEELDDTAHKKAVRSVAWR----PHCNV 70
           +K LLA G    KI +          + NF L  EL+   H+  V+S+ +R    P   +
Sbjct: 165 NKYLLAIGGTTVKIFIYSFVLSEGKVIENFNLAAELE--GHEDWVKSIQFRHQETPGDYL 222

Query: 71  LAAGSFDTTVSIWGRD-----DDDYSGETELL----------------------AVIEGH 103
           L +GS D  + IW        DD    ET+L                       A+I GH
Sbjct: 223 LCSGSQDRYIRIWRIRTNDLIDDSEDDETKLTLLSSKQHKFHISEDLRIGINFEALIIGH 282

Query: 104 ENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRL 163
           ++ V S+ W      L   + D +V IWE DE S  + C+S L E S         +S  
Sbjct: 283 DDWVSSLQWHESKLQLLASTADTAVMIWEPDESSGVWVCSSRLGEMSSKGASTATGSSGG 342

Query: 164 L-------------LASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIR 210
                         + ++    + RIW E  D+  C   +   G     +D   A  G  
Sbjct: 343 FWSCLWFEENGADYILTNGKTGSWRIW-EAKDEIMCEQRVGITGAVRPVTDVAWAPCGKY 401

Query: 211 LCSGSDDTTVRIWR--CLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSD 268
           L S S D T R++      ++ ++  ++   E   P +H   +  V    D    S G +
Sbjct: 402 LLSTSLDQTTRLFAPWIYNENNELRSRKTWHEFSRPQIHGYDMICVEPVNDERFISGGDE 461

Query: 269 GVLAVY 274
            +L  +
Sbjct: 462 KILRSF 467

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 59/129 (45%), Gaps = 9/129 (6%)

Query: 56  KKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHD 115
            K  +  ++    NVLA G+    +++W   D D  G   + A ++GHE EV  V +   
Sbjct: 14  NKQTQVCSYNKARNVLAFGA-GKNIALWNPLDADCRG---IYATLKGHEAEVTCVKFMPG 69

Query: 116 GAYLATCSRDKSV--WIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDT 173
              L + S D  V  W ++A E SEE EC   +  +S  +  I   A  +++ S+     
Sbjct: 70  TDILVSASEDHHVKLWKYKAPE-SEELECIQTITHYSHTIVSIETLAGLIVIGSAG--GL 126

Query: 174 VRIWAEQDD 182
           V IW  + +
Sbjct: 127 VSIWVPETE 135

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 38/194 (19%), Positives = 77/194 (39%), Gaps = 8/194 (4%)

Query: 102 GHENEVKSVAWSHDGAYLATCSRDKSVW--IWEADELSEEFECNSVLQEHSQDVKHIVWH 159
           GH  E+ SV  S D   + +  R  +    +    +L    E    L  HS  +  + + 
Sbjct: 561 GHGYEITSVDVSPDQKLVVSACRSNNAQHAVIRIFDLDTWLEVKPNLSFHSLTITRLRFS 620

Query: 160 ASRLLLASSSYDDTVRIWAEQDDDWECAAVLS---GHGGTVWCSDFERAETGIRLCSGSD 216
                L S   D    +W    DD       +    H   +W  ++   E G    + S 
Sbjct: 621 PDSKYLLSVCRDRKWAVWERNFDDNTFTLKYTDEKPHSRIIWDGEWAPLEFGNVFLTTSR 680

Query: 217 DTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSD-GVLAVYK 275
           D  V++W   T +++ F      +   P +   ++Y+   + + LI +VG + G + +Y 
Sbjct: 681 DRKVKVWSLETSESNAFSMLHFIKLNSP-ITAISIYNKVIN-NKLIVAVGLETGEIFIYN 738

Query: 276 EVQAGRWEVVARVD 289
             ++  +E++++ +
Sbjct: 739 YSKSDGFELISQFE 752

>Scas_719.52
          Length = 628

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 110/257 (42%), Gaps = 36/257 (14%)

Query: 40  DVRNFKLVEELDDTAHKKAVRSVAWRPHC-NVLAAGSFDTTVSIWGRDDDDYSGETELLA 98
           + +N K V+ L  + H + V  V + P   NVLA+ S D TV +W  +    +GE    A
Sbjct: 126 EPKNIKPVKFL--SGHSRKVGHVLFHPVAENVLASSSLDYTVKLWNIE----TGE----A 175

Query: 99  VIE-GHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIV 157
           VI   H + V S+++S+ G +LAT  RDK + +W+  E     E  +     +Q    +V
Sbjct: 176 VITLKHPDMVTSMSFSYGGNHLATVCRDKKLRVWDIREGKIVSEGPAHAGAKNQ---RVV 232

Query: 158 WHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSD--------FERAETGI 209
           W  +   LA++ +    R+   Q   W+   +  G  G  +  D        F      I
Sbjct: 233 WLGNSDRLATTGFS---RLSDRQIGIWDAFNLEKGDLGGFYTVDQSSGILMPFYDDGNKI 289

Query: 210 RLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDG 269
              +G  D  +R +    D  ++F+    Q T       +  ++V   A   + ++  + 
Sbjct: 290 LYLAGKGDGNIRYYEFQND--ELFELSEFQST-----EAQRGFAV---APKRMVNIKENE 339

Query: 270 VLAVYKEVQAGRWEVVA 286
           VL  +K V   R E ++
Sbjct: 340 VLKCFKTVVDQRIEPIS 356

 Score = 34.7 bits (78), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 53/118 (44%), Gaps = 18/118 (15%)

Query: 119 LATCSRDKSVWIWEADE-------LSEEFECNSV-----LQEHSQDVKHIVWHA-SRLLL 165
           +A+ S D  + IW+  E       L  + E  ++     L  HS+ V H+++H  +  +L
Sbjct: 97  IASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNIKPVKFLSGHSRKVGHVLFHPVAENVL 156

Query: 166 ASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           ASSS D TV++W  +  +   A +   H   V    F     G  L +   D  +R+W
Sbjct: 157 ASSSLDYTVKLWNIETGE---AVITLKHPDMVTSMSFSYG--GNHLATVCRDKKLRVW 209

 Score = 28.5 bits (62), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 67/166 (40%), Gaps = 32/166 (19%)

Query: 164 LLASSSYDDTVRIWAEQDD--------------DWECAAVLSGHGGTVWCSDFERAETGI 209
           ++ASSS D  + IW   +D              + +    LSGH   V    F      +
Sbjct: 96  IIASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNIKPVKFLSGHSRKVGHVLFHPVAENV 155

Query: 210 RLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGL-IASVGSD 268
            L S S D TV++W   T +A           V+   H   V S+S+S  G  +A+V  D
Sbjct: 156 -LASSSLDYTVKLWNIETGEA-----------VITLKHPDMVTSMSFSYGGNHLATVCRD 203

Query: 269 GVLAVYKEVQAGRWEVVARVDCAHTVYEINVVKWLALDGRVLLVTG 314
             L V+ +++ G+   +     AH   +   V WL    R L  TG
Sbjct: 204 KKLRVW-DIREGK---IVSEGPAHAGAKNQRVVWLGNSDR-LATTG 244

>Kwal_26.8628
          Length = 422

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 97/234 (41%), Gaps = 43/234 (18%)

Query: 99  VIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVW 158
            + GH N++   AWS D   + + S+D  + +W+A   S  F+ N++  + SQ V     
Sbjct: 81  TLNGHNNKISDFAWSSDSRSILSASQDGFMIVWDA---SLGFKKNAIPLD-SQWVLTCAI 136

Query: 159 HASRLLLASSSYDDT---VRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGS 215
           ++S  L+AS+   ++    RI  E     +  ++  GH  T + S  E  E    + + S
Sbjct: 137 NSSGNLVASAGLTNSCTIYRISQENRVQQQIVSMFKGH--TCYVSQVEFFENN-SIITAS 193

Query: 216 DDTTVRIWRCLTDDADVFDKEWIQE----------TVLPAVHTRAVYSVSWSADGLIASV 265
            D T  +W       D+   + I E            LP  H +       ++  + AS 
Sbjct: 194 GDMTCALW-------DIPKAKRIAEFSDHLGDVLALALPPPHAQ-------TSSPIFASG 239

Query: 266 GSDGVLAVYKEVQAGRWEVVARVDC-AHTVYEINVVKWLALDGRVLLVTGGDDG 318
           GSDG + +        W+  AR    +  V E ++      +    +VTG DDG
Sbjct: 240 GSDGYVYI--------WDTRARAAAQSFFVSESDISTLKFFNNGYAIVTGADDG 285

 Score = 28.1 bits (61), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 23/42 (54%)

Query: 95  ELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADEL 136
           E++  +EGH + +  V  S DG  + T S D ++ +W  + +
Sbjct: 381 EIVGKLEGHSSRISGVKTSPDGMAVCTGSWDATLKLWSPNYM 422

>Scas_670.21
          Length = 595

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 95/224 (42%), Gaps = 19/224 (8%)

Query: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNF-KLVEELDDTAHKKAVRSVAWR 65
           VR+L  H DR   +  +  +L +GS D  I   DVR      E L+   H + V  + W 
Sbjct: 366 VRTLSGHVDRVACLSWNGHILTSGSRDHNILHRDVRMPDPFFERLN--THSQEVCGLQWN 423

Query: 66  PHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS-HDGAYLAT--C 122
              N LA+G  D  V ++     D +    ++  IE H+  VK++AWS H    LAT   
Sbjct: 424 TEENKLASGGNDNVVCVY-----DGTSRNPMIKFIE-HKAAVKALAWSPHKRGILATGGG 477

Query: 123 SRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDD 182
           + D+ + IW  +   +  + ++  Q     V +++W  +   + +S       +      
Sbjct: 478 TVDRRLKIWNVNTSMKLSDVDTGSQ-----VCNMIWSKNTDEIVTSHGYSKYHLTLWDYP 532

Query: 183 DWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCL 226
                A+L GH   V       +  G  + SG+ D T+R W+  
Sbjct: 533 TMNPVAILKGHSFRVL--HLTLSADGTTVVSGAGDETLRYWKLF 574

 Score = 28.9 bits (63), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 60/120 (50%), Gaps = 13/120 (10%)

Query: 24  KGLLATG--SADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCN--VLAAGSFDTT 79
           +G+LATG  + DR++K+ +V     + ++D  +    V ++ W  + +  V + G     
Sbjct: 469 RGILATGGGTVDRRLKIWNVNTSMKLSDVDTGSQ---VCNMIWSKNTDEIVTSHGYSKYH 525

Query: 80  VSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEE 139
           +++W     DY      +A+++GH   V  +  S DG  + + + D+++  W+  E S+ 
Sbjct: 526 LTLW-----DYP-TMNPVAILKGHSFRVLHLTLSADGTTVVSGAGDETLRYWKLFEKSKP 579

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 8/81 (9%)

Query: 53  TAHKKAVRSVAWRPHCN-VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVA 111
           T H++ V  V + P    VLA+ S D TV +W       + E     ++  H + V S++
Sbjct: 137 TGHQRKVGHVLYHPTAQGVLASSSLDHTVRLW-------NVEQGTNPIVLTHPDMVTSMS 189

Query: 112 WSHDGAYLATCSRDKSVWIWE 132
           +S+ G YLAT  RDK + +W+
Sbjct: 190 FSYGGTYLATVCRDKMLRVWD 210

>Kwal_23.5035
          Length = 744

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 88/207 (42%), Gaps = 27/207 (13%)

Query: 6   LVRSLKLHGDRCWSVDISK-GLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAW 64
            +  L  H    W++     G+L +GS DR +++ ++++ K         H   VR +  
Sbjct: 402 FITQLSGHDGGVWALKYGHDGILVSGSTDRSVRVWNIKSGKCTHVFK--GHTSTVRCLDI 459

Query: 65  RPHC--NVLAAGSFDTTVSIWGRDD---DDYSGE-----------TELLAVIEGHENEVK 108
             H     +  GS D T+ +W   +   +DY+ E              + V+ GH   V+
Sbjct: 460 VEHNGKKFIVTGSRDHTLHVWKLPNCNAEDYNPEVCEVFNTTDANPYFVGVLRGHMAAVR 519

Query: 109 SVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASS 168
           +V  S  G  + + S D ++ +W+  ++    +C  VL  H+  +   ++   R    S+
Sbjct: 520 TV--SGHGNIVVSGSYDFNLMVWDIAQM----KCLYVLTGHTDRIYSTIYDYQRNRCISA 573

Query: 169 SYDDTVRIW--AEQDDDWECAAVLSGH 193
             D TV++W  A+   +  C  + S +
Sbjct: 574 GMDSTVKVWDLADVSKNGPCTTITSSN 600

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 66/149 (44%), Gaps = 19/149 (12%)

Query: 43  NFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDD------DD-----YS 91
           +F  +  +++ A+ K      ++PH   L   +      +   DD      DD     Y 
Sbjct: 337 DFFRLHFMENRAYLKNWYDSKFKPHRTTLRGHTMKIVTCLQFEDDYVITGADDKMIRVYD 396

Query: 92  GETE-LLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHS 150
            +TE  +  + GH+  V ++ + HDG  L + S D+SV +W      +  +C  V + H+
Sbjct: 397 AKTEKFITQLSGHDGGVWALKYGHDGI-LVSGSTDRSVRVWNI----KSGKCTHVFKGHT 451

Query: 151 QDVK--HIVWHASRLLLASSSYDDTVRIW 177
             V+   IV H  +  + + S D T+ +W
Sbjct: 452 STVRCLDIVEHNGKKFIVTGSRDHTLHVW 480

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 164 LLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           +L S S D +VR+W  +    +C  V  GH  TV C D         + +GS D T+ +W
Sbjct: 423 ILVSGSTDRSVRVWNIKSG--KCTHVFKGHTSTVRCLDIVEHNGKKFIVTGSRDHTLHVW 480

Query: 224 RCLTDDADVFDKE 236
           +    +A+ ++ E
Sbjct: 481 KLPNCNAEDYNPE 493

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 82/180 (45%), Gaps = 31/180 (17%)

Query: 67  HCNVLAAGSFDTTVSIWGRDD----DDYSGETELLAVIEGHENEVKSVAWSHDGAYLATC 122
           + N++A GS D TV +W  +D     +    +E L  ++ H +EV S+    DGA L T 
Sbjct: 458 NYNMVATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAHLDEVSSLYI--DGANLMTA 515

Query: 123 SRDKSVWIWE--ADELSEEFECN--------SVLQEHSQDVKHIVWHASRLL-------- 164
           S+DK++  W+  + +  + F+ N        S   + ++D   +    + ++        
Sbjct: 516 SQDKTIRRWDLYSGKCIQVFDVNFPSLSAYKSSFMKSNEDSMILKTVNTPIIGSIQSFDA 575

Query: 165 -LASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
            LA+ + D  +R+W  +    E   VL GH   +    F+       + SGS D T+R+W
Sbjct: 576 ALATGTKDGLIRLWDMR--TGEVVRVLEGHMDAITSLKFD----ATTIISGSLDGTIRLW 629

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 63/131 (48%), Gaps = 15/131 (11%)

Query: 54  AHKKAVRSVAWRPHCNVL-AAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAW 112
           AH  A+  + + PH + L  AG  D  V +W     DY+ + ++ A +EGH   +  +  
Sbjct: 402 AHDDAITCLDFDPHFSTLCTAGYMDHIVKLW-----DYTKKRQIGA-MEGHVATISCMQV 455

Query: 113 SHDGAYLATCSRDKSVWIWEADELSEEFE--CNS----VLQEHSQDVKHIVWHASRLLLA 166
             +   +AT S+D +V +W A+++   +E   NS     L  H  +V  +    + L+ A
Sbjct: 456 DKNYNMVATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAHLDEVSSLYIDGANLMTA 515

Query: 167 SSSYDDTVRIW 177
           S   D T+R W
Sbjct: 516 SQ--DKTIRRW 524

>CAGL0L04950g complement(562491..564908) highly similar to sp|Q04660
           Saccharomyces cerevisiae YMR049c, start by similarity
          Length = 805

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 47/88 (53%), Gaps = 12/88 (13%)

Query: 186 CAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPA 245
           C+ + SGH G +     +   TGI L +GSDD +VRIW  LT   +V+  + + +   P 
Sbjct: 428 CSTIYSGHEGKIRTLSID--PTGIWLATGSDDGSVRIWEILT-GREVYRVQLVNKEDNPE 484

Query: 246 VHTRAVYSVSWSADGLIASVGSDGVLAV 273
            +   ++SV W+ DG +      G+LAV
Sbjct: 485 DN---IHSVEWNPDGSV------GILAV 503

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (62%)

Query: 98  AVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWE 132
            +  GHE ++++++    G +LAT S D SV IWE
Sbjct: 430 TIYSGHEGKIRTLSIDPTGIWLATGSDDGSVRIWE 464

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 61/265 (23%), Positives = 104/265 (39%), Gaps = 35/265 (13%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGR 85
           LL +GS DR I+L  +R   L+++ ++ + K             +L+   +   +     
Sbjct: 220 LLCSGSQDRYIRLWRIRINDLIDDSEEDSKK-----------LTLLSNKQYKFQI----- 263

Query: 86  DDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSV 145
            DD+        A+I GH++ + S+ W      L   + D S+ +WE DE S  + C+  
Sbjct: 264 -DDELRVGINFEALIMGHDDWISSLQWHESRLQLLAATADTSLMVWEPDETSGIWVCSLR 322

Query: 146 LQEHSQDVKHI-----------VW--HASRLLLASSSYDDTVRIWAEQDDDWECAAVLSG 192
           L E S                 +W  H       ++    + R+WA +D+   C   L  
Sbjct: 323 LGEMSSKGASTATGSSGGFWSCLWFTHERMDFFLTNGKTGSWRMWATKDNII-CDQRLGI 381

Query: 193 HGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKE---WIQETVLPAVHTR 249
            G T   +D   + +G  L + S D T R++     DA    +E   W  E   P +H  
Sbjct: 382 SGATKDVTDIAWSPSGEYLLATSLDQTTRLFAPWIYDASGRKREIATW-HEFSRPQIHGY 440

Query: 250 AVYSVSWSADGLIASVGSDGVLAVY 274
            +  V    D    S G + +L  +
Sbjct: 441 DMICVETVTDTRFVSGGDEKILRSF 465

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 82/209 (39%), Gaps = 64/209 (30%)

Query: 79  TVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSE 138
           T+++W   + +  G   + A ++GHE EV  V +  D  ++ + S D  V IW+  + S 
Sbjct: 37  TIALWDPIEPNNKG---VYATLKGHEAEVTCVRFVPDSDFMVSASEDHHVKIWKFTDYS- 92

Query: 139 EFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAE--QDDDWECA--------- 187
             +C   +Q +S+ +  +   A   L++    D T+ IW +  Q+D++  A         
Sbjct: 93  HLQCIQTIQHYSKTI--VALSALPSLISVGCADGTISIWRQNIQNDEFGLAHEFTIKKGF 150

Query: 188 --------------AVLSGHGGT---VWCSDFERAETGIR-------------------- 210
                           L   GGT   V+ + F  +++GI                     
Sbjct: 151 FYPLCLSLSKVEEKKYLLAIGGTNVNVFIASFILSDSGIEKCRVVAELEGHEDWVKSLAF 210

Query: 211 ----------LCSGSDDTTVRIWRCLTDD 229
                     LCSGS D  +R+WR   +D
Sbjct: 211 RHQETPGDYLLCSGSQDRYIRLWRIRIND 239

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 53/231 (22%), Positives = 97/231 (41%), Gaps = 20/231 (8%)

Query: 100 IEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEE--FECNSVLQEHSQDVKHIV 157
           + GH  E+  +  S D   +A+  R  +V        S E   E    L  HS  +  + 
Sbjct: 554 LYGHGFEITCLDISPDQKLIASACRSNNVQNAVIRIFSTENWLEIKPALPFHSLTITRLK 613

Query: 158 WHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSG---HGGTVWCSDFERAETGIRLCSG 214
           +      L S   D    +W    +D            H   +W +D+   E G    + 
Sbjct: 614 FSKDGKFLLSVCRDRKWALWERNMEDNTFELRFKNEKPHTRIIWDADWAPLEFGNVFVTA 673

Query: 215 SDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSV----SWSADGLIASVG-SDG 269
           S D TV++WR   + AD    +++ E  +   HT+AV ++    S   + ++ SVG  +G
Sbjct: 674 SRDKTVKVWRHQKEPAD----DYVLEASIK--HTKAVTAISIHDSMIREKILISVGLENG 727

Query: 270 VLAVYKEVQAGRWEVVARVDCAHTVY-EINVVKW--LALDGRVLLVTGGDD 317
            + +Y     G++E++ +++   T   +I  ++W  L  +G++ L  G  D
Sbjct: 728 EIYLY-SYTLGKFELITQLNEDITPADKITRLRWSHLKRNGKLFLGVGSSD 777

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/242 (21%), Positives = 107/242 (44%), Gaps = 47/242 (19%)

Query: 3   NLHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKL--VDVRNFKLVEELDDTAHKKAVR 60
           +L  +++++ +     ++     L++ G AD  I +   +++N +        AH+  ++
Sbjct: 93  HLQCIQTIQHYSKTIVALSALPSLISVGCADGTISIWRQNIQNDEF-----GLAHEFTIK 147

Query: 61  SVAWRPHC----------NVLAAGSFDTTVSIWGRDDDDYSGET-ELLAVIEGHENEVKS 109
              + P C           +LA G  +  V I      D   E   ++A +EGHE+ VKS
Sbjct: 148 KGFFYPLCLSLSKVEEKKYLLAIGGTNVNVFIASFILSDSGIEKCRVVAELEGHEDWVKS 207

Query: 110 VAWSHD---GAY-LATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLL 165
           +A+ H    G Y L + S+D+ + +W           N ++ +  +D K +       LL
Sbjct: 208 LAFRHQETPGDYLLCSGSQDRYIRLW-------RIRINDLIDDSEEDSKKLT------LL 254

Query: 166 ASSSY----DDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVR 221
           ++  Y    DD +R+    +      A++ GH    W S  +  E+ ++L + + DT++ 
Sbjct: 255 SNKQYKFQIDDELRVGINFE------ALIMGHDD--WISSLQWHESRLQLLAATADTSLM 306

Query: 222 IW 223
           +W
Sbjct: 307 VW 308

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 76/186 (40%), Gaps = 36/186 (19%)

Query: 53  TAHKKAVRSVAWRPHCNVLAAGSFDTTVSI----WGRDDDDYSGETELLAVIEGHENEVK 108
           T+H +++  + W P    +A  S D T+ I    +GR           L  + GH   V 
Sbjct: 53  TSHVESMSDICWSPDSQCIATASDDFTIEINHITYGR-----------LHRLVGHTAPVL 101

Query: 109 SVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHI-VWHASRLLLAS 167
           S+ ++  G  L + S D+S+ IW  D L+        +  HS+ V  I +      +L+S
Sbjct: 102 SLVYTSKGNLLCSASMDESIKIW--DVLTGTLL--KTISAHSEPVVSIDMPVCDPSILSS 157

Query: 168 SSYDDTVRIW----------AEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDD 217
            SYD  +RI+             D DW+         G V  S  + +  G  L   S D
Sbjct: 158 GSYDGLIRIFDTTTGHCLKTLTYDKDWK------SENGVVPISQVKFSVNGKYLLVKSLD 211

Query: 218 TTVRIW 223
             ++IW
Sbjct: 212 GVLKIW 217

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 86/210 (40%), Gaps = 28/210 (13%)

Query: 113 SHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDD 172
           S DG ++A  S+  S  ++   +    F    +   H + +  I W      +A++S D 
Sbjct: 24  SPDGKFIAV-SQGTSYLLYNVSDGLSAF----IPTSHVESMSDICWSPDSQCIATASDDF 78

Query: 173 TVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADV 232
           T+ I       +     L GH   V          G  LCS S D +++IW  LT     
Sbjct: 79  TIEI---NHITYGRLHRLVGHTAPVL--SLVYTSKGNLLCSASMDESIKIWDVLTGT--- 130

Query: 233 FDKEWIQETVLPAVHTRAVYSVSWSA-DGLIASVGS-DGVLAVYKEVQAGRWEVVARVD- 289
                + +T+  + H+  V S+     D  I S GS DG++ ++ +   G        D 
Sbjct: 131 -----LLKTI--SAHSEPVVSIDMPVCDPSILSSGSYDGLIRIF-DTTTGHCLKTLTYDK 182

Query: 290 ---CAHTVYEINVVKWLALDGRVLLVTGGD 316
                + V  I+ VK+ +++G+ LLV   D
Sbjct: 183 DWKSENGVVPISQVKF-SVNGKYLLVKSLD 211

>KLLA0E23617g 2095246..2096499 similar to sp|P13712 Saccharomyces
           cerevisiae YBR195c MSI1 chromatin assembly complex,
           subunit p50, start by similarity
          Length = 417

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 57/116 (49%), Gaps = 10/116 (8%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAH--KKAVRSVAWRPHCNVLAAGSFDTT--VS 81
           +L TG +  ++K+ D+R+FK  E + +  H  +  + ++ W P    + A +   +  V 
Sbjct: 296 ILCTGDSQGQLKIWDIRDFK--EPIKEWEHGDQDPISAIQWNPQIPQILATADQQSGLVK 353

Query: 82  IW---GRDDDDYSGETELLAVIEGHENEVKSVAWS-HDGAYLATCSRDKSVWIWEA 133
           IW   G  +D  +    LL V  GH   V  ++WS HD   + + S D S+ IW+ 
Sbjct: 354 IWDASGEQEDSNAENNMLLFVHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWKP 409

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/235 (20%), Positives = 92/235 (39%), Gaps = 47/235 (20%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
           + ++ + SV+W P   ++  G+    + +W +       + +L  +++ H + + ++ W+
Sbjct: 207 SEEEPIISVSWSPDGELVLTGTTSGELRLWNK-------QGKLKNILDSHRSPIVAMKWN 259

Query: 114 HDGAYLATCSRDKSVWIWEADELSE----EFECNSVLQEHSQDV--------KHIVWHAS 161
            D  +L T      V +W     ++     F+   +  E S  +        K ++    
Sbjct: 260 QDCTHLLTTDVSNVVILWSTLTGTQLQHFSFKEGDIENEDSLGIDLEWVETDKFVIPGPG 319

Query: 162 RLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVR 221
             LL  +  ++            +    L GH  T+   +F ++     L S SDD T++
Sbjct: 320 GSLLVYTIGNN------------KPLGRLLGHTSTITTLEFNKSNKS--LLSASDDNTIK 365

Query: 222 IWRCLTDDA--DVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVY 274
           +WR     A  D  D            HT+ + S  W  D LI S   DG + V+
Sbjct: 366 VWRGGNSSAANDFTD------------HTKTISSAHWINDDLIISTAYDGTVKVW 408

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/87 (20%), Positives = 42/87 (48%), Gaps = 5/87 (5%)

Query: 92  GETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQ 151
           G  + L  + GH + + ++ ++     L + S D ++ +W     S      +   +H++
Sbjct: 328 GNNKPLGRLLGHTSTITTLEFNKSNKSLLSASDDNTIKVWRGGNSS----AANDFTDHTK 383

Query: 152 DVKHIVWHASRLLLASSSYDDTVRIWA 178
            +    W    L++ S++YD TV++W+
Sbjct: 384 TISSAHWINDDLII-STAYDGTVKVWS 409

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 99/235 (42%), Gaps = 33/235 (14%)

Query: 97  LAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHI 156
           +  ++GH N+V S  WS D   + + S+D  + +W+A   +   + N++   HSQ V   
Sbjct: 120 VTTLKGHNNKVSSFRWSSDSRTILSASQDGFMLLWDA---ATGLKSNAI-PLHSQWVLSC 175

Query: 157 VWHASRLLLASSSYDDTVRIWAEQDDD---WECAAVLSGHGGTVWCSDFERAETGIRLCS 213
               +  L+AS+  D+   I+     D       ++  GH  T + S+ E  +    + +
Sbjct: 176 AICPNGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGH--TCYISEIEFLDDN-SILT 232

Query: 214 GSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSAD------GLIASVGS 267
            S D T  +W       D+   + I E    A H   V S+S +         + AS GS
Sbjct: 233 ASGDMTCALW-------DITKSKRINEF---ADHLGDVLSLSAAPTETEGNGNVFASGGS 282

Query: 268 DGVLAVYKEVQAGRWEVVARVDCAHTVYEINVVKWLALDGRVLLVTGGDDGCVNV 322
           DG L ++ +       V   V  +  V + +V K         + TG DDGC N+
Sbjct: 283 DGYLYIWDK------RVPTSVQ-SFFVSDSDVSKVKFFRNGNTIATGSDDGCTNL 330

 Score = 28.5 bits (62), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 22/39 (56%)

Query: 95  ELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEA 133
           E++  ++GH + +  VA S DG  + T S D ++ +W  
Sbjct: 426 EIIGKLDGHSDRISGVATSPDGLAICTGSWDMTMKVWSP 464

>KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces
           cerevisiae YKL213c DOA1 involved in ubiquitin-dependent
           proteolysis, start by similarity
          Length = 706

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 75/182 (41%), Gaps = 50/182 (27%)

Query: 95  ELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADE---------LSEEFECNSV 145
           +L A + GH  +V+SV  S     +A+ SRD +V IW  D           S E   NS+
Sbjct: 3   QLSAQLRGHTQDVRSVV-SLSTTQVASASRDGTVRIWNLDADGNWEGSIAFSSEKFVNSL 61

Query: 146 LQEHSQDV------KHIVWHASRLL--------------------------LASSSYDDT 173
             +  Q V      + I++  S LL                          L SSS+D T
Sbjct: 62  TYDAKQCVLFCGGQEKIIYGVSPLLALGQEPVYTLVGHEGNICSLSGDFESLVSSSWDKT 121

Query: 174 VRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVF 233
            ++W      WE    L GH  +VW  D +    G  + + S DTTV++W+  T  A  F
Sbjct: 122 AKVWTNGIVKWE----LKGHSASVW--DAKLLNDG-SVLTASADTTVKLWKNGT-LAKTF 173

Query: 234 DK 235
           DK
Sbjct: 174 DK 175

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 77/178 (43%), Gaps = 15/178 (8%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGR 85
            + + S D+   L+D    K    L    H   V S+++    ++++    D    IW  
Sbjct: 277 FIGSTSFDKTWILIDT--VKQAPILIQEGHSAEVFSLSFHNDGSLVSTAGLDAIALIW-- 332

Query: 86  DDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSV 145
             D  SG+   +  ++GH   + SV WS +G  LA+ S D ++ +W   ++ ++    ++
Sbjct: 333 --DIRSGKN--IMSLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVW---DIRKKGNVETI 385

Query: 146 LQEHSQDVKHIVWHASR-LLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDF 202
           L  H+  V  + ++      L SS YD  V I+   D +W     L GH   V   D 
Sbjct: 386 L-AHNSIVSQVKFNKQNGGYLVSSGYDKKVNIF--NDGNWIKERSLEGHLDKVMSIDI 440

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 62/291 (21%), Positives = 121/291 (41%), Gaps = 42/291 (14%)

Query: 35  KIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGET 94
           K+K   ++  ++++E       K +  +   P  +++A GS+   +S+     D+   + 
Sbjct: 165 KLKQFSLKGMQVIDE-------KPISEINTSPGGDLMACGSWSGNLSLV----DNSLSKI 213

Query: 95  ELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEA-DELSEEFECNSVLQEHSQDV 153
                + G   ++  + WS D   +  C+ D  + I+++ DE + +     +L ++    
Sbjct: 214 YCNRSLSG--TKISGLDWSVDSKNIFVCTHDGRIVIYDSGDETTVK-----ILYKNDARF 266

Query: 154 KHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLS-GHGGTVWCSDFERAETGIRLC 212
             +  H     + S+S+D T   W   D   +   ++  GH   V+   F     G  + 
Sbjct: 267 AQVRCHPCNSFIGSTSFDKT---WILIDTVKQAPILIQEGHSAEVFSLSFH--NDGSLVS 321

Query: 213 SGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGL-IASVGSDGVL 271
           +   D    IW       D+   + I        H++ +YSV WS +G  +AS   DG +
Sbjct: 322 TAGLDAIALIW-------DIRSGKNIMSL---QGHSKPIYSVDWSQNGYQLASGSGDGTI 371

Query: 272 AVYKEVQAGRWEVVARVDCAHTVYEINVVKWLALDGRVLLVTGGDDGCVNV 322
            V+   + G  E +     AH    ++ VK+   +G   LV+ G D  VN+
Sbjct: 372 KVWDIRKKGNVETI----LAHNSI-VSQVKFNKQNGG-YLVSSGYDKKVNI 416

>Kwal_33.15475
          Length = 783

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 68/299 (22%), Positives = 119/299 (39%), Gaps = 43/299 (14%)

Query: 1   MPNLHLVRSLKLHGDRCWSVDI---SKG--LLATGSADRKIKLVDVRNFKLVEELDDTAH 55
           + N  L   L+ H D   ++D    S G  LLATGS DR I+L  +R  +L++  D+   
Sbjct: 185 LNNFQLAAELEGHEDWVKAMDFYEESPGNMLLATGSQDRYIRLWRIRTNELIDNSDEDEF 244

Query: 56  KKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHD 115
           K            N+L        ++       D        A+I GH++ +  + W  +
Sbjct: 245 K-----------LNLLGNKQSKFFIT------PDLKVAINFDALIVGHDDWISCLKWHKE 287

Query: 116 GAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHI-------VW------HASR 162
              L   + D +V +WE D  S  + C S L E S              W      H +R
Sbjct: 288 RPQLLASTADTAVMVWEPDADSGVWICASRLGELSSKGASTATGSSGGFWSCSWFTHKNR 347

Query: 163 LLLASSSYDDTVRIW-AEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVR 221
             + ++    + R+W +++ + W+    ++G    V  +D   +  G+ + + S D T R
Sbjct: 348 DHILTNGKTGSWRMWVSDELEGWKQQLAITGPTKAV--TDVAWSPNGLYMLATSLDQTTR 405

Query: 222 -IWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQA 279
            I RC   + D     W  E   P +H   +  V   ++    S G + ++  + E + 
Sbjct: 406 LISRC---NYDANAGSWF-EFARPQIHGYDMICVEPLSNTRFISGGDEKIMRSFDEPKG 460

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 83/358 (23%), Positives = 131/358 (36%), Gaps = 114/358 (31%)

Query: 6   LVRSLKLHGDRCWSVDISKG--LLATGSADRKIKL-----VDVRNFKLVEELDDTAHKKA 58
           + R+LK H      V    G  L+ + S D +++L      D    K V+ +D   H   
Sbjct: 48  VYRTLKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWAFEEKDQDALKCVQVIDHHKHTIT 107

Query: 59  VRSVAWRPHCNVLAAGSFDTTVSIWGRDDDD----------------------YSGETEL 96
             SV      N+L+ G  D +VS+W  +++                         G+  L
Sbjct: 108 SLSVI----SNILSVGCADGSVSLWLTENNQAILLHSFNLQTNVYPLCMALKLVEGDKYL 163

Query: 97  LAV---------------------------IEGHENEVKSVAW---SHDGAYLATCSRDK 126
           LA+                           +EGHE+ VK++ +   S     LAT S+D+
Sbjct: 164 LAIGGTNPRVFIYSFTLQDGTLNNFQLAAELEGHEDWVKAMDFYEESPGNMLLATGSQDR 223

Query: 127 SVWIW--EADEL-----SEEFECNSVLQEHSQ-----DVKHIV----------------- 157
            + +W    +EL      +EF+ N +  + S+     D+K  +                 
Sbjct: 224 YIRLWRIRTNELIDNSDEDEFKLNLLGNKQSKFFITPDLKVAINFDALIVGHDDWISCLK 283

Query: 158 WHASRLLLASSSYDDTVRIWAEQDDD--WECAAVL-----------SGHGGTVW-CSDFE 203
           WH  R  L +S+ D  V +W    D   W CA+ L           +G  G  W CS F 
Sbjct: 284 WHKERPQLLASTADTAVMVWEPDADSGVWICASRLGELSSKGASTATGSSGGFWSCSWFT 343

Query: 204 RAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGL 261
                  L +G   +    WR    D     + W Q+  +    T+AV  V+WS +GL
Sbjct: 344 HKNRDHILTNGKTGS----WRMWVSDE---LEGWKQQLAITGP-TKAVTDVAWSPNGL 393

 Score = 36.2 bits (82), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 80/204 (39%), Gaps = 56/204 (27%)

Query: 79  TVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSE 138
           T+++W   D  + G   +   ++GH  EV  V +      + + S D  V +W  +E  +
Sbjct: 34  TIALWKPLDPAHHG---VYRTLKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWAFEEKDQ 90

Query: 139 E-FECNSVLQEH---------------------------SQDVKHIVWHASRL------- 163
           +  +C  V+  H                           +++ + I+ H+  L       
Sbjct: 91  DALKCVQVIDHHKHTITSLSVISNILSVGCADGSVSLWLTENNQAILLHSFNLQTNVYPL 150

Query: 164 ------------LLASSSYDDTVRIWAE--QD---DDWECAAVLSGHGGTVWCSDF-ERA 205
                       LLA    +  V I++   QD   ++++ AA L GH   V   DF E +
Sbjct: 151 CMALKLVEGDKYLLAIGGTNPRVFIYSFTLQDGTLNNFQLAAELEGHEDWVKAMDFYEES 210

Query: 206 ETGIRLCSGSDDTTVRIWRCLTDD 229
              + L +GS D  +R+WR  T++
Sbjct: 211 PGNMLLATGSQDRYIRLWRIRTNE 234

 Score = 29.3 bits (64), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 54/125 (43%), Gaps = 27/125 (21%)

Query: 116 GAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIV--------WHASRLLLAS 167
           G    T SRDK +  W+  E  +++E     Q+H+  +   V         H  +LL+A+
Sbjct: 659 GHVFVTASRDKHIKAWKLSEDGQQYE-----QQHALKLAVPVTAISVFPGLHNGKLLVAA 713

Query: 168 S---------SYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDT 218
                     +YD+  R ++E D  +  A  +S      W S+ E+    I L   S D 
Sbjct: 714 GLENGNIQVFTYDNQFRCYSEIDTRFTPADRVS---RLRWSSNQEKGR--ILLAVTSADH 768

Query: 219 TVRIW 223
           ++R++
Sbjct: 769 SIRVF 773

>Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement
          Length = 1140

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 37/128 (28%), Positives = 57/128 (44%), Gaps = 10/128 (7%)

Query: 99  VIEGHENEVKSVAW-SHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIV 157
           ++ GH   +  + +  H    LATCS D  V  W+       +   S  +  +  VK   
Sbjct: 109 ILHGHFRAITDINFHPHHPEILATCSVDTYVLAWDMRSPQRPYYSTSEWRAGASQVK--- 165

Query: 158 WHASRLLLASSSYDDTVRIWAEQDDDWECAAV--LSGHGGTVWCSDFERAETGIRLCSGS 215
           W+     + +SS+ D V IW   D    C  +  L GH G+V   DF +A+    + S S
Sbjct: 166 WNFRNSNIMASSHSDHVCIW---DLRKGCTPLYTLQGHEGSVNNIDFNKAKE-TEIMSSS 221

Query: 216 DDTTVRIW 223
           +D TV+ W
Sbjct: 222 NDGTVKFW 229

>AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH]
           complement(1497416..1499560) [2145 bp, 714 aa]
          Length = 714

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 91/208 (43%), Gaps = 31/208 (14%)

Query: 71  LAAGSFDTTVSIWGRDDDD---YSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKS 127
           +A+GS D TV +W RD  D   +SG     A++   E  V +V +  +   L      ++
Sbjct: 32  IASGSRDGTVRVWTRDTSDSRLWSG-----AILHSTERYVNAVCY-EENEQLVFFGGQEA 85

Query: 128 VWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECA 187
           V    +  + E  + + +L  HS +V      A    L SSS+D T R+W E  ++    
Sbjct: 86  VIGAVSPLVLEVQDASYLLAGHSGNV--CALEARDGQLVSSSWDQTARVWREGTEE---- 139

Query: 188 AVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVH 247
             LSGH  TVW +    A    R  + S D T+++W    D A               VH
Sbjct: 140 RALSGHNATVWHA---LALGYDRFLTASADKTIKLWDGARDLATY------------NVH 184

Query: 248 TRAVYSVSWSADG-LIASVGSDGVLAVY 274
           T  V  ++ + DG   AS  +DG + V+
Sbjct: 185 TDVVRHLALAPDGHHFASCSNDGSVKVH 212

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 140 FECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDD 183
           +E +S L  HS DVK +V   S   +AS S D TVR+W     D
Sbjct: 8   YELSSSLLGHSMDVKSVV-AISDTQIASGSRDGTVRVWTRDTSD 50

>AER280C [2782] [Homologous to ScYML102W (CAC2) - SH]
           (1148956..1150488) [1533 bp, 510 aa]
          Length = 510

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 63/142 (44%), Gaps = 21/142 (14%)

Query: 53  TAHKKAVRSVAWRPHCNVLAAGSFDTTVSIW----------GRDDDDYSGETELLAVIEG 102
           T H++AV    + P  +VLA    D  + +W          G DDD+++   E   V+E 
Sbjct: 68  TQHEQAVNVARFNPSGDVLATAGDDGLLLLWKKNDTIVKEFGIDDDEFADFKESWCVVEK 127

Query: 103 HE-------NEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKH 155
                    +E+  +AWS    Y+ T   D  V I++  E +    C + + EH+  V+ 
Sbjct: 128 LRTVSTIGTSEIYDLAWSPCAKYIVTGCMDNGVRIFDIAEKT----CVAHVVEHNHYVQG 183

Query: 156 IVWHASRLLLASSSYDDTVRIW 177
           +VW      + S S D +V I+
Sbjct: 184 VVWDPQNEYIISQSADRSVHIY 205

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 6/77 (7%)

Query: 62  VAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLAT 121
           +AW P    +  G  D  V I+     D + +T +  V+E H + V+ V W     Y+ +
Sbjct: 142 LAWSPCAKYIVTGCMDNGVRIF-----DIAEKTCVAHVVE-HNHYVQGVVWDPQNEYIIS 195

Query: 122 CSRDKSVWIWEADELSE 138
            S D+SV I++ +  +E
Sbjct: 196 QSADRSVHIYKIETSTE 212

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/219 (21%), Positives = 88/219 (40%), Gaps = 21/219 (9%)

Query: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRP 66
           V S+    D  W        + + S D  IK+ DVR+  +     +  H   V  V   P
Sbjct: 78  VTSIAFQQDNKW--------MVSSSEDGTIKVWDVRSPSVQR---NYKHDAPVNEVVIHP 126

Query: 67  HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDK 126
           +   L +   D  + IW   ++  + +  L          ++S++ + DG+ L   +   
Sbjct: 127 NQGELISCDQDGNIKIWDLGENQCTNQLAL-----EDNTALQSLSIASDGSMLVAGNNKG 181

Query: 127 SVWIWEADELSEEFECNSV--LQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDW 184
           + ++W+    ++      V   + HS+ +  ++       LA+ S D T R+W+ + D++
Sbjct: 182 NCYVWKMPNHTDTASLKPVTKFRSHSKYITRVLLSVDVKHLATCSADHTARVWSVE-DNF 240

Query: 185 ECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           +    L  H   VW  D   +     L +   D  VR+W
Sbjct: 241 QLETTLDAHSRWVW--DCAFSADSAYLVTACSDHYVRLW 277

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 54/125 (43%), Gaps = 8/125 (6%)

Query: 100 IEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWH 159
            EGH   V S+A+  D  ++ + S D ++ +W+    S +        +H   V  +V H
Sbjct: 71  FEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRN-----YKHDAPVNEVVIH 125

Query: 160 ASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTT 219
            ++  L S   D  ++IW   ++  +C   L+    T   S    A  G  L +G++   
Sbjct: 126 PNQGELISCDQDGNIKIWDLGEN--QCTNQLALEDNTALQS-LSIASDGSMLVAGNNKGN 182

Query: 220 VRIWR 224
             +W+
Sbjct: 183 CYVWK 187

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 5/79 (6%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
           +H K +  V        LA  S D T  +W  +D+      +L   ++ H   V   A+S
Sbjct: 205 SHSKYITRVLLSVDVKHLATCSADHTARVWSVEDN-----FQLETTLDAHSRWVWDCAFS 259

Query: 114 HDGAYLATCSRDKSVWIWE 132
            D AYL T   D  V +W+
Sbjct: 260 ADSAYLVTACSDHYVRLWD 278

>YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protein
           containing five WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           low similarity to a region of S. pombe Tup11p, which is
           a transcriptional repressor functioning redundantly with
           Tup12p [3042 bp, 1013 aa]
          Length = 1013

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 56/105 (53%), Gaps = 10/105 (9%)

Query: 73  AGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWE 132
           AG+    V IW     D   ET++  ++ GHE  +  V  S++G Y+A+CS D+S+ +W+
Sbjct: 154 AGTVMGGVIIW-----DLFSETKIHNLL-GHEGSIFYVNLSNNGRYVASCSDDRSIRLWD 207

Query: 133 ADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
             E  ++    SV   H+  + ++++  +   L S S D T R+W
Sbjct: 208 L-ETGKQL---SVGWSHTARIWNLMFFDNDSKLISVSEDCTCRVW 248

>CAGL0L03201g complement(366795..368534) some similarities with
           sp|P47025 Saccharomyces cerevisiae YJL112w MDV1 or
           sp|P36130 Saccharomyces cerevisiae YKR036c CAF4 CCR4,
           hypothetical start
          Length = 579

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 104/238 (43%), Gaps = 27/238 (11%)

Query: 5   HLVRSLKLHGDRCWSVDISK--GLLA-TGSADRKIKLVDVRNFKLVEELDDTAHKKAVRS 61
            L ++LK H D   S+ I+   G+L+ T + D +IKL D+   + +  L  + H+  V +
Sbjct: 271 QLGKTLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTTQCLGVL--SGHRATVNT 328

Query: 62  VAWRPHCNVLAAGSFDTTVSIWGRDD----DDYSGETELLAVIEGHENEVKSVAWSHDGA 117
             +     +LA+   D +V +W  D+    D  + +   LA  +GH++ V ++A +  G 
Sbjct: 329 TRFIDDTRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTALATT--GN 386

Query: 118 YLATCSRDKSVWIWE--ADELSEEFECNSVLQEHSQDVKH--IVWHASRLLLASSSYDDT 173
            + + S DK++  W+  + +  +  +    L+   Q V    I    +  L+  +   D 
Sbjct: 387 AIVSGSNDKTLRHWDLGSGKCIQSIDLTIALKMVPQSVSKLDITPSFNTPLIGGADCIDN 446

Query: 174 VRIWAEQDD-----DWECAAV---LSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
             +   +D      D     V   L GH G +    +     G  L +GS D + RIW
Sbjct: 447 ALVTGTKDGIVYLWDLRIGRVVGSLEGHRGPITSLKY----MGSELITGSMDKSTRIW 500

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 71/165 (43%), Gaps = 38/165 (23%)

Query: 13  HGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDT-AHKKAVRSVA---WRPHC 68
           H D   ++  +   + +GS D+ ++  D+ + K ++ +D T A K   +SV+     P  
Sbjct: 374 HKDSVTALATTGNAIVSGSNDKTLRHWDLGSGKCIQSIDLTIALKMVPQSVSKLDITPSF 433

Query: 69  NV------------LAAGSFDTTVSIW----GRDDDDYSGETELLAVIEGHENEVKSVAW 112
           N             L  G+ D  V +W    GR          ++  +EGH   + S+ +
Sbjct: 434 NTPLIGGADCIDNALVTGTKDGIVYLWDLRIGR----------VVGSLEGHRGPITSLKY 483

Query: 113 SHDGAYLATCSRDKSVWIWE------ADELSEEFECNSVLQEHSQ 151
              G+ L T S DKS  IW+      A+ LS E E  SV +  +Q
Sbjct: 484 M--GSELITGSMDKSTRIWDLRMGSVAELLSFEKEVVSVEESQTQ 526

>KLLA0C07425g complement(647673..649007) highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein singleton, start by
           similarity
          Length = 444

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 93/216 (43%), Gaps = 27/216 (12%)

Query: 19  SVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDT 78
           S+D+    + +GS D    +V   N     E   + H   +R+V +     +++AG+ D 
Sbjct: 108 SLDVGSNYIYSGSYD---GIVRTYNLSGKVEKQYSGHSGPIRAVHYISSTRLVSAGN-DR 163

Query: 79  TVSIWGRDDDDYSG--ETEL-----LAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIW 131
           T+ +W   +DD     E E+     LA++EGH+  V S+  S D    A+C  D +V +W
Sbjct: 164 TLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKAPVVSIDVSKDRILSASC--DNTVSLW 221

Query: 132 EADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLS 191
             +   +E      +++   +V        +L L     D ++R  A         A+  
Sbjct: 222 STNY--KEMTVIDPMEDLGGNVSTAAKKRRKLTLK----DGSIRRRAP-------LALFE 268

Query: 192 GHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLT 227
            H   V    F++++  +   S S D T++ W  +T
Sbjct: 269 SHSAPVEAVIFDKSDDTVGY-SVSQDHTIKTWDLIT 303

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 48/103 (46%), Gaps = 9/103 (8%)

Query: 165 LASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWR 224
           + S SYD  VR +   +   +     SGH G +    +    +  RL S  +D T+R+W+
Sbjct: 116 IYSGSYDGIVRTY---NLSGKVEKQYSGHSGPIRAVHYI---SSTRLVSAGNDRTLRLWK 169

Query: 225 CLTDDADVFDKEWIQETVLPAV---HTRAVYSVSWSADGLIAS 264
              DD    D+E I++    A+   H   V S+  S D ++++
Sbjct: 170 TKNDDLKSIDEEEIEDGKTLAILEGHKAPVVSIDVSKDRILSA 212

 Score = 31.6 bits (70), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 59/282 (20%), Positives = 109/282 (38%), Gaps = 52/282 (18%)

Query: 10  LKLHGDRCWSVDISKGLLATGSADRKIKL--VDVRNFKLVEELDDTAHKKAVRSVAWRPH 67
           L+ H     S+D+SK  + + S D  + L   + +   +++ ++D      V + A +  
Sbjct: 192 LEGHKAPVVSIDVSKDRILSASCDNTVSLWSTNYKEMTVIDPMEDLGGN--VSTAAKKRR 249

Query: 68  CNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAW-SHDGAYLATCSRDK 126
              L  GS                     LA+ E H   V++V +   D     + S+D 
Sbjct: 250 KLTLKDGSIRRRAP---------------LALFESHSAPVEAVIFDKSDDTVGYSVSQDH 294

Query: 127 SVWIWE------ADELSEEFECNSVLQEHSQDV-------KHIVWHASRLLLASSSYDDT 173
           ++  W+       D  +  +   SV Q    ++       +HI  H  R+       + +
Sbjct: 295 TIKTWDLITAKCVDTKTTSYSLLSVAQLPKLNLLACGSSARHITLHDPRV-------NSS 347

Query: 174 VRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVF 233
            +I  +Q         L GH   V   D    E    +CS S D TV++W   ++ A ++
Sbjct: 348 SKITQQQ---------LVGHKNFVVALD-TCPENEYMICSASHDGTVKVWDVRSNTA-MY 396

Query: 234 DKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYK 275
                 + V+  V+ + V++V W+    I S G D  + + K
Sbjct: 397 TITREDKNVVKGVNDK-VFAVKWAKGVGIISGGQDKKIQINK 437

>Scas_605.18
          Length = 424

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 97/232 (41%), Gaps = 29/232 (12%)

Query: 99  VIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVW 158
            ++GH N++    WS D   + + S+D  + IW+    +   + N++  + SQ V     
Sbjct: 86  TLKGHNNKISDFRWSRDSKSILSASQDGFMLIWDT---ASGLKRNAIPLD-SQWVLSCAL 141

Query: 159 HASRLLLASSSYDDTVRIW---AEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGS 215
             S  L AS+  ++   I+    E        ++  GH  T + SD E  +    + + S
Sbjct: 142 SPSGNLAASAGLNNNCTIYRVSKENRVQQNVVSIFKGH--TCYISDIEFLDNS-HIITSS 198

Query: 216 DDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSAD-----GLIASVGSDGV 270
            D T  +W       D+   + ++E         A+     SAD      + AS GSDG 
Sbjct: 199 GDMTCALW-------DIPKAKRVREYADHLGDVLALALPPPSADENTGANIFASCGSDGY 251

Query: 271 LAVYKEVQAGRWEVVARVDCAHTVYEINVVKWLALDGRVLLVTGGDDGCVNV 322
             ++    +   +     D      ++N +++   DG   +VTGGDDG +N+
Sbjct: 252 TYIWDTRTSAAVQKFFASDT-----DVNAIQFFK-DGNS-IVTGGDDGVINM 296

 Score = 33.1 bits (74), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%)

Query: 93  ETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADEL 136
           + E++  +EGH N V SV  S DG  + T S D ++ IW  + +
Sbjct: 381 KAEIVGKLEGHSNRVSSVRTSPDGLGVCTGSWDSTMRIWSPNYM 424

>Scas_442.2*
          Length = 795

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 59/289 (20%), Positives = 109/289 (37%), Gaps = 52/289 (17%)

Query: 41  VRNFKLVEELDDTAHKKAVRSVAWR----PHCNVLAAGSFDTTVSIW-----------GR 85
           +   +L  +L+   H+  ++S+A+R    P   +L +GS D  + +W             
Sbjct: 195 IETLQLAAKLE--GHEDWIKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDLMKKQDE 252

Query: 86  DDDDYSGETELL--------------------AVIEGHENEVKSVAWSHDGAYLATCSRD 125
           DD+D + +  LL                    A+I GH++ + S+ W      L   + D
Sbjct: 253 DDEDIATKLALLNNKQYKFHVTDALRVCINFEALIMGHDDWISSLQWHETRLQLLASTAD 312

Query: 126 KSVWIWEADELSEEFECNSVLQEHSQDVKHI-----------VW--HASRLLLASSSYDD 172
            ++ +WE DE S  + C   L E S                 +W  H ++  + ++    
Sbjct: 313 TALMVWEPDEASGIWVCGLRLGELSSKGASTATGSAGGFWSCLWFSHQNKDYILTNGKTG 372

Query: 173 TVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWR--CLTDDA 230
           + R+W  ++ +  C   L   G T   +D   +  G  L S S D T R++      +D 
Sbjct: 373 SWRVWTTEEGNTLCDQELGITGATKQVTDIAWSPKGEYLLSTSLDQTTRLFAPWIYNNDG 432

Query: 231 DVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQA 279
              +     E   P +H   +  V   +     S G + +L  + E + 
Sbjct: 433 TKRNTATWHEFSRPQIHGYDMICVEPMSGARFVSGGDEKILRSFDEPKG 481

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 55/120 (45%), Gaps = 12/120 (10%)

Query: 65  RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSR 124
           + H     AG    T+++W   D++  G   + A ++GHE EV  V +  D  Y+ +CS 
Sbjct: 26  KTHIVAFGAGQ---TIALWNPLDENSQG---VFATLKGHEAEVTCVKFITDTPYMVSCSE 79

Query: 125 DKSVWIWEADE-LSEEFE---CNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQ 180
           D  V IW+ +  ++ E +   C   L  +S  V  +       L+A    D  V +W ++
Sbjct: 80  DHHVKIWKQNPGVAREVDGWTCVQTLDHYSHTV--VALAVLPGLIAVGCADGKVSLWVQK 137

 Score = 28.9 bits (63), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 80/189 (42%), Gaps = 11/189 (5%)

Query: 95  ELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECN-SVLQEHSQDV 153
           E+   +  H   V  + +S D  YL +  RD+   +WE D  +++F       + H++ +
Sbjct: 607 EVKPPLAFHTLTVTKLRFSPDSKYLLSVCRDRQWVVWERDPETDKFTLKYKTAKPHTRII 666

Query: 154 KHIVWHASRL--LLASSSYDDTVRIWA--EQDDDWECAAVLSGHGGTVWCSDFERAETG- 208
               W       +  + S D T+++W   E   +++    L+        S  +    G 
Sbjct: 667 WDGDWAPLEFGNVFVTGSRDRTIKLWKFDENKSNFDLENSLNMTSLVTALSVXDSVLDGR 726

Query: 209 IRLCSGSDDTTVRIWRCLTDDADVFD-KEWIQETVLPAVH-TRAVYSVSWSADGL-IASV 265
           + +  G +D ++ I++   D    FD  E + + + PA   TR  +S S   + L +A+ 
Sbjct: 727 LLIAXGLEDGSIYIYKY--DSTSGFDVVEVLNDLITPAEKLTRLRWSRSQRNNKLWLAAA 784

Query: 266 GSDGVLAVY 274
            SD    +Y
Sbjct: 785 SSDTSTRIY 793

>AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH]
           (409496..411169) [1674 bp, 557 aa]
          Length = 557

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 77/192 (40%), Gaps = 28/192 (14%)

Query: 101 EGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHA 160
           E H +EV  + +  DG  LA+   D +V IW+    + + E   V + H+  VK I WH 
Sbjct: 344 EKHTSEVCGIKFRQDGLQLASGGNDNTVMIWD----TRQDEPLWVKRNHNAAVKAITWHP 399

Query: 161 ---SRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTV-----WCSDFERAETG--IR 210
              + L     S D  +  W    +    A + S + G+      W   +E +     I 
Sbjct: 400 DVVNLLATGGGSLDRHIHFW----NTTTGARIGSINTGSQVSSLHWGQSYEDSHMNREIV 455

Query: 211 LCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADG-LIASVGSDG 269
              GS D ++ I+     D+ V   E  Q       H   + S   S DG  IA+VG D 
Sbjct: 456 ATGGSPDNSISIYNY---DSKVKVAEITQ------AHESRIVSSQLSPDGTTIATVGGDE 506

Query: 270 VLAVYKEVQAGR 281
            L  Y+   A R
Sbjct: 507 NLKFYRVFDAKR 518

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 90/206 (43%), Gaps = 39/206 (18%)

Query: 69  NVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENE-VKSVAWSHDGAYLATCSRDKS 127
           NVLA  + D ++ +W       +GET  ++++   E E + SV WS+D  +++    D +
Sbjct: 235 NVLAI-ALDQSIYLW-------NGETGEVSLLTEFETETITSVVWSNDDCHISIGKDDGN 286

Query: 128 VWIWEADELSEEFECNSVLQEH--SQDVKHIVWHASRLLLASSSYD---DTVRIWAEQDD 182
             IW+ + +S      S L     SQD     W  + + + + S +   + VR+      
Sbjct: 287 TEIWDVETMSHVRTMRSSLGVRICSQD-----WLDTVVCIGAKSGEIQVNDVRVKDHIVS 341

Query: 183 DWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETV 242
            WE       H   V    F   + G++L SG +D TV IW    D+       W++   
Sbjct: 342 TWE------KHTSEVCGIKFR--QDGLQLASGGNDNTVMIWDTRQDEP-----LWVKRN- 387

Query: 243 LPAVHTRAVYSVSWSAD--GLIASVG 266
               H  AV +++W  D   L+A+ G
Sbjct: 388 ----HNAAVKAITWHPDVVNLLATGG 409

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 70/172 (40%), Gaps = 12/172 (6%)

Query: 88  DDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQ 147
           D  S     ++  EGH+  V S+A+  +  ++ + S D ++ +W+    S +        
Sbjct: 59  DIRSNNPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRN-----Y 113

Query: 148 EHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAET 207
           +H+  V  +  H ++  L S   D  +RIW   ++  +C   L+    T   S    A  
Sbjct: 114 KHNAPVNEVAIHPNQGELISCDQDGNIRIWDLGEN--QCTNQLTPEDNTPLQS-LSVASD 170

Query: 208 GIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSAD 259
           G  L +G++     +W+         D   ++       HT+ +  V  SAD
Sbjct: 171 GSMLVAGNNKGNCYVWKM----PHHTDASTLEPVTKFKSHTKYITRVLLSAD 218

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/177 (20%), Positives = 74/177 (41%), Gaps = 9/177 (5%)

Query: 19  SVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDT 78
           ++  ++G L +   D  I++ D+   +   +L        ++S++     ++L AG+   
Sbjct: 123 AIHPNQGELISCDQDGNIRIWDLGENQCTNQLT-PEDNTPLQSLSVASDGSMLVAGNNKG 181

Query: 79  TVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSE 138
              +W       +   E +   + H   +  V  S D  +LATCS D +  +W    + +
Sbjct: 182 NCYVWKMPHHTDASTLEPVTKFKSHTKYITRVLLSADVKHLATCSADHTARVW---NIED 238

Query: 139 EFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGG 195
            FE  + L  H + V    + A    L ++  D  VR+W     D   + ++  +GG
Sbjct: 239 NFELETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLW-----DLSTSEIVRQYGG 290

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 46/226 (20%), Positives = 90/226 (39%), Gaps = 41/226 (18%)

Query: 36  IKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIW-------GRD-- 86
           ++L D+R+           HK  V S+A++     + + S D T+ +W        R+  
Sbjct: 55  VRLYDIRSNNPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYK 114

Query: 87  --------------------DDDYS------GETELLAVIEGHEN-EVKSVAWSHDGAYL 119
                               D D +      GE +    +   +N  ++S++ + DG+ L
Sbjct: 115 HNAPVNEVAIHPNQGELISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVASDGSML 174

Query: 120 ATCSRDKSVWIWEADELSE--EFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
              +   + ++W+    ++    E  +  + H++ +  ++  A    LA+ S D T R+W
Sbjct: 175 VAGNNKGNCYVWKMPHHTDASTLEPVTKFKSHTKYITRVLLSADVKHLATCSADHTARVW 234

Query: 178 AEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
              +D++E    L GH   VW  D   +     L +   D  VR+W
Sbjct: 235 -NIEDNFELETTLDGHQRWVW--DCAFSADSAYLVTACSDHYVRLW 277

>KLLA0F22000g complement(2044973..2047354) similar to sp|P42935
           Saccharomyces cerevisiae YGR200c ELP2 90 kDa subunit of
           elongator and elongating RNA polymerase II holoenzyme
           singleton, start by similarity
          Length = 793

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 107/273 (39%), Gaps = 41/273 (15%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGR 85
           LLA+GS DR I+L  +R  + ++  ++   K  + S       N +    FD +      
Sbjct: 218 LLASGSQDRYIRLWRIRTNEKIDTSEEDEKKLTLLS-------NKIY--KFDISA----- 263

Query: 86  DDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSV 145
              D        A+I GH++ + S+ W      L T + D +V +WE D +S  + C+S 
Sbjct: 264 ---DVHVAINFEALIMGHDDWISSLQWHKTKLQLLTSTADTAVMVWEPDTISGIWICSSR 320

Query: 146 LQEHSQDVKHI-----------VW--HASRLLLASSSYDDTVRIWAEQDD---DWECAAV 189
           L E S                 +W  H  + ++ ++    + RIW   D    D E    
Sbjct: 321 LGELSSKGASTATGSSGGFWSCIWFTHDGKDVILTNGKTGSWRIWTSTDGLLWDQELGIT 380

Query: 190 LSGHGGTVWCSDFERAETGIRLCSGSDDTTVRI---WRCLTDDADVFDKEWIQETVLPAV 246
               G T   +D   +  G  L S S D T R+   W+  T   +     W  E   P +
Sbjct: 381 ----GATKSVTDVAWSIDGNYLLSTSLDQTTRLFAEWKYETSGVERKTPSWC-EMARPQI 435

Query: 247 HTRAVYSVSWSADGLIASVGSDGVLAVYKEVQA 279
           H   +  V   ++    S G + +L  + E +A
Sbjct: 436 HGYDMLCVEPISNTRFVSGGDEKILRSFDEPKA 468

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 73/176 (41%), Gaps = 12/176 (6%)

Query: 68  CNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKS 127
             V+A G+   T+++W   D  + G   +   ++GH  EV  V +      + + S D  
Sbjct: 24  TKVVAYGA-GKTIALWKSMDTSHHG---VFKTLKGHTAEVTCVRFVKGTDMMVSASEDFE 79

Query: 128 VWIWEADELSE----EFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDD 183
           V +W   +L E    E EC  V++ H   +   V+   + LL     D ++ +W+  +D 
Sbjct: 80  VRVWNFPKLREGHMDEVECIQVIKHHKHTI--TVFAVLKNLLVVGCADGSISVWSFIEDQ 137

Query: 184 WECAAVLSGHGG--TVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEW 237
           +      S   G   +  S  E  +T   L  G  +  V I+  +++   V   E+
Sbjct: 138 YVLQEEFSVQKGVFPLCLSMHEIEKTQFILAIGGTNVNVFIYSLVSNSEGVSKLEF 193

 Score = 35.0 bits (79), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 46/97 (47%), Gaps = 13/97 (13%)

Query: 95  ELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVK 154
           +L  V+  H   +  + +S D  YL + SRD+   +WE +     F+ NS +    ++  
Sbjct: 598 QLPQVLPFHNLTITKLRFSKDNRYLLSVSRDRLWSLWERN-----FDNNSFVLRSFKEKP 652

Query: 155 H--IVWHASRLLLA------SSSYDDTVRIWAEQDDD 183
           H  I+W A  + LA      ++S D T++ W    +D
Sbjct: 653 HSRIIWDADWVPLAKGLAFITASRDKTLKFWRLSKED 689

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 82/378 (21%), Positives = 145/378 (38%), Gaps = 88/378 (23%)

Query: 6   LVRSLKLHGDRCWSVDISKG--LLATGSADRKIKLVDVRNFKLVEE--LDDTA------- 54
           + ++LK H      V   KG  ++ + S D +++   V NF  + E  +D+         
Sbjct: 48  VFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVR---VWNFPKLREGHMDEVECIQVIKH 104

Query: 55  HKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEG--------HENE 106
           HK  +   A     N+L  G  D ++S+W   +D Y  + E  +V +G        HE E
Sbjct: 105 HKHTITVFAVLK--NLLVVGCADGSISVWSFIEDQYVLQEE-FSVQKGVFPLCLSMHEIE 161

Query: 107 VKSVAWSHDGAYLATCSRDKSVWIWEADELSE---EFECNSVLQEHSQDVKHIVWHAS-- 161
                       LA    + +V+I+     SE   + E  + L+ H   +K +V+  +  
Sbjct: 162 KTQF-------ILAIGGTNVNVFIYSLVSNSEGVSKLEFATKLEGHEDWIKSLVFRETVP 214

Query: 162 -RLLLASSSYDDTVRIW----------AEQDDD---------------------WECAAV 189
              LLAS S D  +R+W          +E+D+                          A+
Sbjct: 215 GDYLLASGSQDRYIRLWRIRTNEKIDTSEEDEKKLTLLSNKIYKFDISADVHVAINFEAL 274

Query: 190 LSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTR 249
           + GH    W S  +  +T ++L + + DT V +W     + D     WI  + L  + ++
Sbjct: 275 IMGHDD--WISSLQWHKTKLQLLTSTADTAVMVW-----EPDTISGIWICSSRLGELSSK 327

Query: 250 AVYSVSWSADGLIASV--GSDGVLAVYKEVQAGRWEVVARVDCAHTVYEINV-------- 299
              + + S+ G  + +    DG   +    + G W +    D      E+ +        
Sbjct: 328 GASTATGSSGGFWSCIWFTHDGKDVILTNGKTGSWRIWTSTDGLLWDQELGITGATKSVT 387

Query: 300 -VKWLALDGRVLLVTGGD 316
            V W ++DG  LL T  D
Sbjct: 388 DVAW-SIDGNYLLSTSLD 404

>Scas_700.27*
          Length = 433

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 80/209 (38%), Gaps = 63/209 (30%)

Query: 69  NVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSV 128
           N++A    D+ V +W     D      ++ +I GH+N +  V        + +CS D ++
Sbjct: 219 NLIATAGRDSVVRLW-----DIRARVAVMTLI-GHKNPINKVHCLPVDPQIVSCSTDATI 272

Query: 129 WIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWA---------- 178
            +W+        +   V+  H + V++I +H +   ++S S +D +R W           
Sbjct: 273 RLWDI----VAGKSMKVITHHKKSVRNIAFHPTEFSMSSCSAND-IRSWKLPEGGLLTNF 327

Query: 179 -------------EQDD--------------DW------------ECAAVLSGHGGTVWC 199
                         QDD              D+            E    L    G + C
Sbjct: 328 NSDGLGIINTLSINQDDVLFAGSDNGMLSFYDYKSGHKYQSMMTKEIPGSLESERG-ILC 386

Query: 200 SDFERAETGIRLCSGSDDTTVRIWRCLTD 228
           S F+R  TG+RL +G  D +++IW   +D
Sbjct: 387 STFDR--TGLRLLTGETDKSIKIWSMDSD 413

>YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein
           required for the second catalytic step of mRNA splicing,
           member of WD (WD-40) repeat family [1368 bp, 455 aa]
          Length = 455

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 75/181 (41%), Gaps = 29/181 (16%)

Query: 53  TAHKKAVRSVAWRPHC-NVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVA 111
             H +   ++ + P   +++ +G  D T+ IW     D+  + E L   +GH   +K++ 
Sbjct: 159 PGHPEGTTALKFLPKTGHLILSGGNDHTIKIW-----DFYHDYECLRDFQGHNKPIKALR 213

Query: 112 WSHDGAYLATCSRDKSVWIW--EADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSS 169
           ++ D     + S D+SV IW  E  ++      NS       DV+    +    ++  S+
Sbjct: 214 FTEDCQSFLSSSFDRSVKIWDTETGKVKTRLHLNST----PADVESRPTNPHEFIVGLSN 269

Query: 170 -----YDDTV--RIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRI 222
                YDD V       Q  D   +++L+           +    G +  S S+D TVRI
Sbjct: 270 SKILHYDDRVSENQGLVQTYDHHLSSILA----------LKYFPDGSKFISSSEDKTVRI 319

Query: 223 W 223
           W
Sbjct: 320 W 320

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/239 (19%), Positives = 89/239 (37%), Gaps = 46/239 (19%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDD-TAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWG 84
           L+ +G  D  IK+ D   +   E L D   H K ++++ +   C    + SFD +V IW 
Sbjct: 177 LILSGGNDHTIKIWDF--YHDYECLRDFQGHNKPIKALRFTEDCQSFLSSSFDRSVKIWD 234

Query: 85  RD---------------------------------------DDDYSGETELLAVIEGHEN 105
            +                                       DD  S    L+   + H +
Sbjct: 235 TETGKVKTRLHLNSTPADVESRPTNPHEFIVGLSNSKILHYDDRVSENQGLVQTYDHHLS 294

Query: 106 EVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLL 165
            + ++ +  DG+   + S DK+V IWE ++++   +  S   +HS    ++  H S+   
Sbjct: 295 SILALKYFPDGSKFISSSEDKTVRIWE-NQINVPIKQISDTAQHSMPFLNV--HPSQNYF 351

Query: 166 ASSSYDDTVRIWAEQDD-DWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
            + S D+ +  ++ +         +  GH    +      +  G  +CSG   + +  W
Sbjct: 352 CAQSMDNRIYSFSLKPKYKRHPKKIFKGHSSAGYGISLAFSGDGRYICSGDSKSRLFTW 410

>Kwal_0.212
          Length = 303

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 69/161 (42%), Gaps = 10/161 (6%)

Query: 20  VDISKGLLATGSADRKIKLVDVRNFKLVEEL---DDTAHKKAVRSVAWRPHCNVLAAGSF 76
           +  ++G L +   D  +++ D+   + V +L   DDT     ++S++     ++L AG+ 
Sbjct: 124 IHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTP----LQSLSVASDGSMLVAGNN 179

Query: 77  DTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADEL 136
                +W       +   + +     H   +  V  S D  +LATCS D +  +W  D  
Sbjct: 180 KGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSID-- 237

Query: 137 SEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
            + F+  + L  H + V    + A    L ++  D  VR+W
Sbjct: 238 -DNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 54/125 (43%), Gaps = 8/125 (6%)

Query: 100 IEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWH 159
            EGH   V S+A+  +  ++ + S D ++ +W+    S +        +H   V  +V H
Sbjct: 71  FEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRN-----YKHQAAVNEVVIH 125

Query: 160 ASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTT 219
            ++  L S   D  VRIW   ++  +C   L+    T   S    A  G  L +G++   
Sbjct: 126 PNQGELISCDQDGNVRIWDLGEN--QCVHQLAPEDDTPLQS-LSVASDGSMLVAGNNKGN 182

Query: 220 VRIWR 224
             +W+
Sbjct: 183 CYVWQ 187

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 40/94 (42%), Gaps = 7/94 (7%)

Query: 39  VDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLA 98
            D  N K V +    +H K +  V        LA  S D T  +W  DD+      +L  
Sbjct: 192 TDAANPKPVTKF--RSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDN-----FQLET 244

Query: 99  VIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWE 132
            ++ H+  V   A+S D AYL T   D  V +W+
Sbjct: 245 TLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWD 278

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 42/229 (18%), Positives = 87/229 (37%), Gaps = 45/229 (19%)

Query: 35  KIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIW-------GRDD 87
            ++L D+R            H+  V S+A++     + + S D T+ +W        R+ 
Sbjct: 54  NVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNY 113

Query: 88  DDYSGETELLAVIEGHENE-------------------------------VKSVAWSHDG 116
              +   E+  VI  ++ E                               ++S++ + DG
Sbjct: 114 KHQAAVNEV--VIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDG 171

Query: 117 AYLATCSRDKSVWIWEADELSEEFECNSV--LQEHSQDVKHIVWHASRLLLASSSYDDTV 174
           + L   +   + ++W+    ++      V   + H++ +  ++  +    LA+ S D T 
Sbjct: 172 SMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTA 231

Query: 175 RIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           R+W+  DD+++    L  H   VW   F  +     L +   D  VR+W
Sbjct: 232 RVWS-IDDNFQLETTLDNHQRWVWDCAF--SADSAYLVTACSDHYVRLW 277

>KLLA0F10791g complement(991642..993279) similar to sp|P26309
           Saccharomyces cerevisiae YGL116w CDC20 cell division
           control protein, hypothetical start
          Length = 545

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 86/203 (42%), Gaps = 33/203 (16%)

Query: 69  NVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSV 128
           NVLA  + D ++ +W    D  SG+  LL  ++       S+ WS D  +++    D +V
Sbjct: 222 NVLAI-ALDNSIYLW----DGESGDVNLLVELKA---TCTSLTWSDDSCHISIGKNDGNV 273

Query: 129 WIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYD---DTVRIWAEQDDDWE 185
            IW+A+ ++      S L      +    W  +  +  S S +   + VRI       WE
Sbjct: 274 EIWDAETMTHVRTMRSGL---GVRIGSQSWLDTLCVTGSKSGEIQINDVRIKNHVVQTWE 330

Query: 186 CAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPA 245
                  H G V    F   E GI+L SG++D TV IW    D     D  W +      
Sbjct: 331 ------RHQGEVCGLSFR--EDGIQLASGANDNTVMIW----DTRQNNDPIWTKRN---- 374

Query: 246 VHTRAVYSVSWSAD--GLIASVG 266
            H  AV ++SW  +   L+A+ G
Sbjct: 375 -HKAAVKAISWHPEITNLLATGG 396

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 74/190 (38%), Gaps = 21/190 (11%)

Query: 101 EGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHA 160
           E H+ EV  +++  DG  LA+ + D +V IW+  + ++        + H   VK I WH 
Sbjct: 330 ERHQGEVCGLSFREDGIQLASGANDNTVMIWDTRQNNDPIWTK---RNHKAAVKAISWHP 386

Query: 161 ---SRLLLASSSYDDTVRIWAEQDDDW-----ECAAVLSGHGGTVWCSDFERAETGIRLC 212
              + L     S D  +  W     +        + V S H G  +       +T I   
Sbjct: 387 EITNLLATGGGSLDKHIHFWNTTTGNRLGTIDTGSQVSSLHWGQSYSKHSGCMDTEIVAT 446

Query: 213 SGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADG-LIASVGSDGVL 271
            G+ +  + I+   T     F    IQ+      H   + S   S DG  IASVG D  L
Sbjct: 447 GGTPNNCITIYNYETK----FKVAEIQQ-----AHDSRIVSSQLSPDGTTIASVGGDENL 497

Query: 272 AVYKEVQAGR 281
             Y+  +  R
Sbjct: 498 KFYRVFEERR 507

>Kwal_56.24478
          Length = 1296

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 49/220 (22%), Positives = 95/220 (43%), Gaps = 18/220 (8%)

Query: 15  DRCWSVDISKGLLATGSADRKI-KLVDVRNFKLVEELDDTAHKKAVRSVAW--RPHCNVL 71
           D  WS D S   + TG+ D  + +      +K + +L    H   V++V +  + H NVL
Sbjct: 67  DLDWSYDNS---VLTGALDNGVVEFFSPSEYKSIAKL--AQHSTPVKTVRFNAKQH-NVL 120

Query: 72  AAGSFDTTVSIWGRDDDDYSGETELL-AVIEGHENEVKSVAWSHDGAYL---ATCSRDKS 127
            +G     + IW  +  +  G    +        +E+ S+AW+ +  ++   A  S   S
Sbjct: 121 CSGGSKGEIYIWDANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQGHVFASAGSSGFAS 180

Query: 128 VWIWEADELSEEFECNSVLQEHSQDVKHIVWH---ASRLLLAS-SSYDDTVRIWAEQDDD 183
           +W  +A +        S +      +  + WH   ++R+  AS S  D ++ +W  ++ +
Sbjct: 181 IWDLKAKKEVIHLSHTSSITGQKNQLSIVEWHPNNSTRIATASGSDSDPSILVWDLRNAN 240

Query: 184 WECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
                +  GH   V   D+ + +  + L SG D++ V +W
Sbjct: 241 VPLQTLSQGHTKGVLSLDWCKQDETLLLSSGRDNSCV-LW 279

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 85/206 (41%), Gaps = 29/206 (14%)

Query: 35  KIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGET 94
           ++ + +   ++L E L    H   V  + W P    +A+ S D TV +  R       + 
Sbjct: 35  EVYIYETSGYQLRETLV-LEHAAGVSQICWSPDGKCIASCSDDFTVVVTHR-------QL 86

Query: 95  ELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVK 154
            LL  + GH   V S+ +++ G  L T S D+S+ +W  D L+        +  HS+ V 
Sbjct: 87  GLLHRLVGHTAPVISLCYNNKGNLLFTSSMDESIKVW--DVLTGTVM--KTMSAHSEPVV 142

Query: 155 HI-VWHASRLLLASSSYDDTVRIW----------AEQDDDWECAAVLSGHGGTVWCSDFE 203
            I +      +L+S S+D  +RI+             D DW+         G V  +  +
Sbjct: 143 SIDLSDNDGSILSSGSHDGLIRIFDTATGHCLKTLTYDKDWQ------SETGVVPIAKVK 196

Query: 204 RAETGIRLCSGSDDTTVRIWRCLTDD 229
            +     L   S D  V+IW  ++ D
Sbjct: 197 FSANTKYLLVKSYDGVVKIWDSVSGD 222

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 74/167 (44%), Gaps = 25/167 (14%)

Query: 112 WSHDGAYLATCSRDKSVWIWEAD--ELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSS 169
           +S DG +LA   R   V+I+E    +L E     +++ EH+  V  I W      +AS S
Sbjct: 21  FSRDGQWLAVV-RGIEVYIYETSGYQLRE-----TLVLEHAAGVSQICWSPDGKCIASCS 74

Query: 170 YDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDD 229
            D TV +   Q         L GH   V    +     G  L + S D ++++W  LT  
Sbjct: 75  DDFTVVVTHRQ---LGLLHRLVGHTAPVISLCYNNK--GNLLFTSSMDESIKVWDVLTGT 129

Query: 230 ADVFDKEWIQETVLPAVHTRAVYSVSWS-ADGLIASVGS-DGVLAVY 274
                   + +T+  + H+  V S+  S  DG I S GS DG++ ++
Sbjct: 130 --------VMKTM--SAHSEPVVSIDLSDNDGSILSSGSHDGLIRIF 166

>KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces
           cerevisiae YDR142c PAS7 peroxisomal import protein -
           peroxin singleton, start by similarity
          Length = 372

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 9/78 (11%)

Query: 26  LLATGSADRKIKLVDVR--------NFKLVEELDDTAHKKAVRSVAWRPH-CNVLAAGSF 76
           ++ATG  D+ IK+ D+R          + +   +   H+ AVR V W PH  N+L + S+
Sbjct: 242 IIATGGVDKMIKVWDLRMCRKMLSQGHQPININEIQGHELAVRKVTWSPHHSNMLLSTSY 301

Query: 77  DTTVSIWGRDDDDYSGET 94
           D T  +W    DD  G T
Sbjct: 302 DMTCRVWTDLSDDGHGLT 319

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 43/86 (50%), Gaps = 17/86 (19%)

Query: 119 LATCSRDKSVWIWEA----DELSEEFECNSV--LQEHSQDVKHIVW--HASRLLLASSSY 170
           +AT   DK + +W+       LS+  +  ++  +Q H   V+ + W  H S +LL S+SY
Sbjct: 243 IATGGVDKMIKVWDLRMCRKMLSQGHQPININEIQGHELAVRKVTWSPHHSNMLL-STSY 301

Query: 171 DDTVRIWAEQDDDWECAAVLSGHGGT 196
           D T R+W +  DD        GHG T
Sbjct: 302 DMTCRVWTDLSDD--------GHGLT 319

>KLLA0B11077g complement(970761..972464) similar to sgd|S0006341
           Saccharomyces cerevisiae YPR137w RRP9 protein associated
           with the U3 small nucleolar RNA, required for
           pre-ribosomal RNA processing, start by similarity
          Length = 567

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 74/166 (44%), Gaps = 21/166 (12%)

Query: 92  GETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQ 151
           G+ E   V EGH +E+ +VA S DG Y+ +  RD+ + +W  + L+      +  ++   
Sbjct: 220 GKFEYENVTEGHYDEILTVAASPDGKYVVSGGRDRKLIVWSTESLAPVKIIPT--KDRRG 277

Query: 152 DVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVW---CSDFERAETG 208
           +V  + +  +   L ++  D  +R +A   + +    +L GH   V      + ER    
Sbjct: 278 EVLGLAFKKNSDQLFAACADYKIRTYA--INQFSQLEILYGHQDLVIDISALNMERC--- 332

Query: 209 IRLCSGSDDTTVRIWRC-----LT----DDADVFDKEWIQETVLPA 245
             +  GS D T  +W+      LT    DD +   K+W++   L A
Sbjct: 333 --VTVGSRDRTAMLWKIADESRLTFRGGDDPERLRKKWLKNQQLSA 376

>Kwal_14.1710
          Length = 574

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 54/113 (47%), Gaps = 16/113 (14%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDT--AHKKAVRSVAWRPHCNVLAAGSFDTTVSIW 83
           L+ATGS   +I + DVR   +   +  T   HK  V  +A+RP    LA+GS D TV+IW
Sbjct: 333 LIATGSKSGEIHINDVR---IKNHIVSTWEEHKGEVCGIAYRPDGLQLASGSNDNTVAIW 389

Query: 84  GRDDDDYSGETELLAVIE-GHENEVKSVAWSHD-GAYLAT--CSRDKSVWIWE 132
                     T L   I+  H   VK++AWS D    LAT     DK +  W 
Sbjct: 390 -------DTRTSLPQHIKRQHTAAVKALAWSPDISNLLATGGGQTDKHIHFWN 435

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 86/203 (42%), Gaps = 32/203 (15%)

Query: 69  NVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSV 128
           NVLA  + D+ + +W    +  SG+  LL   E     + SV WS D  +++    + + 
Sbjct: 249 NVLAI-ALDSALYLW----NGASGDVSLLVDFE-QPGAITSVTWSDDDCHISIGKVEGNT 302

Query: 129 WIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYD---DTVRIWAEQDDDWE 185
            IW+ D +S      S L      +    W  + +   S S +   + VRI       WE
Sbjct: 303 EIWDVDSMSHVRTMRSGL---GVRIGSQSWLETLIATGSKSGEIHINDVRIKNHIVSTWE 359

Query: 186 CAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPA 245
                  H G V C    R + G++L SGS+D TV IW   T       ++         
Sbjct: 360 ------EHKGEV-CGIAYRPD-GLQLASGSNDNTVAIWDTRTSLPQHIKRQ--------- 402

Query: 246 VHTRAVYSVSWSAD--GLIASVG 266
            HT AV +++WS D   L+A+ G
Sbjct: 403 -HTAAVKALAWSPDISNLLATGG 424

 Score = 36.6 bits (83), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 91/221 (41%), Gaps = 29/221 (13%)

Query: 70  VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVW 129
           ++A GS    + I     +D   +  +++  E H+ EV  +A+  DG  LA+ S D +V 
Sbjct: 333 LIATGSKSGEIHI-----NDVRIKNHIVSTWEEHKGEVCGIAYRPDGLQLASGSNDNTVA 387

Query: 130 IWEADELSEEFECNSVLQEHSQDVKHIVWHA--SRLLLASSSYDDT-VRIW-----AEQD 181
           IW+      +     + ++H+  VK + W    S LL       D  +  W     A   
Sbjct: 388 IWDTRTSLPQH----IKRQHTAAVKALAWSPDISNLLATGGGQTDKHIHFWNTTTGARTG 443

Query: 182 DDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQET 241
                + V S H G  + S+  + E  I    G  +  V I+         +D ++    
Sbjct: 444 SINTGSQVSSLHWGQSYNSNAIQRE--IVATGGIPENAVSIYN--------YDTKFKVAE 493

Query: 242 VLPAVHTRAVYSVSWSADG-LIASVGSDGVLAVYKEVQAGR 281
           ++ A H   + S   S DG ++A+VG D  L  YK  +  R
Sbjct: 494 IVHA-HEARICSSQLSPDGTVLATVGGDENLKFYKVFEPRR 533

>Kwal_56.23895
          Length = 367

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 59/129 (45%), Gaps = 21/129 (16%)

Query: 26  LLATGSADRKIKLVDVR-------NFKLVEELDDT-AHKKAVRSVAWRPH-CNVLAAGSF 76
           ++ATG  D  IK+ D+R       N +    +++   H  A+R V+W PH  N+L + S+
Sbjct: 236 IVATGGVDNMIKVWDLRMVRKAASNSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSY 295

Query: 77  DTTVSIWGRDDDD---YSGETELL-------AVIEGHENEVKSVAWSHDG--AYLATCSR 124
           D T  +W    DD    +G+T  +        V   H   V    WS  G   Y+A+ S 
Sbjct: 296 DMTCRVWQDLSDDGRRPTGKTNSVDPARGCRFVFPHHTEFVFGADWSLWGKPGYIASTSW 355

Query: 125 DKSVWIWEA 133
           D  V +W A
Sbjct: 356 DGDVCVWYA 364

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 37/186 (19%), Positives = 77/186 (41%), Gaps = 25/186 (13%)

Query: 16  RCWSVDISKGL--LATGSADRKIKLVDVRNFKLVEELDDTA---HKKAVRSVAWRPH-CN 69
           + WS    K L  L       +  L+  ++  +  + + T+   +K  +    + PH  N
Sbjct: 130 KVWSPTRPKSLATLTPKPMAAQNPLMPSKDIPMSNQQNHTSLSKNKNCIYQSQFSPHDPN 189

Query: 70  VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAW---SHDGAYLATCSRDK 126
           V+ + + ++ V+++       + +   LA      N ++++      +    +AT   D 
Sbjct: 190 VIMSCAGNSYVTMFDLRQPPGANQYSFLA-----HNGMETLTCDFNKYRSHIVATGGVDN 244

Query: 127 SVWIWE-------ADELSEEFECNSVLQEHSQDVKHIVW--HASRLLLASSSYDDTVRIW 177
            + +W+       A    +    N +   H   ++ + W  H S +LL S+SYD T R+W
Sbjct: 245 MIKVWDLRMVRKAASNSRQPMSVNEIC-GHDLAIRKVSWSPHHSNMLL-STSYDMTCRVW 302

Query: 178 AEQDDD 183
            +  DD
Sbjct: 303 QDLSDD 308

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 5/90 (5%)

Query: 88  DDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQ 147
           D  +  +  +A  EGH   V SV++  D  ++ T S D ++ +W+    S          
Sbjct: 59  DIKTSNSNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRN-----Y 113

Query: 148 EHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
           +H+  V  +V H ++  L S   D  +RIW
Sbjct: 114 KHNAPVNEVVIHPNQGELISCDRDGNIRIW 143

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 45/108 (41%), Gaps = 3/108 (2%)

Query: 70  VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVW 129
           +L A +      +W   +   +   +     + H + +  V  S D  ++ATCS D +  
Sbjct: 173 MLVAANNKGNCYVWEMPNHTDASNLKPATKFKAHPSYITRVLLSSDVKHMATCSADHTAR 232

Query: 130 IWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
           IW  +   + F   S L  H + V    + A    L ++S D  VR+W
Sbjct: 233 IWSVE---DNFNLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277

 Score = 36.2 bits (82), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 40/94 (42%), Gaps = 7/94 (7%)

Query: 39  VDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLA 98
            D  N K   +    AH   +  V        +A  S D T  IW  +D+       L +
Sbjct: 192 TDASNLKPATKF--KAHPSYITRVLLSSDVKHMATCSADHTARIWSVEDN-----FNLES 244

Query: 99  VIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWE 132
            ++GH+  V   A+S D AYL T S D  V +W+
Sbjct: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 50/251 (19%), Positives = 86/251 (34%), Gaps = 56/251 (22%)

Query: 24  KGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIW 83
           K LLA  +  + I+L D++            H+  V SV+++     +   S D T+ +W
Sbjct: 44  KKLLA-AAGHQNIRLYDIKTSNSNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVW 102

Query: 84  GRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADE------LS 137
                      +       H   V  V    +   L +C RD ++ IW+  E      L+
Sbjct: 103 DIRSPSVPRNYK-------HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 138 EE---------------------------------------FECNSVLQEHSQDVKHIVW 158
            E                                        +  +  + H   +  ++ 
Sbjct: 156 PEDDVPLQSLSVASDGSMLVAANNKGNCYVWEMPNHTDASNLKPATKFKAHPSYITRVLL 215

Query: 159 HASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDT 218
            +    +A+ S D T RIW+ + D++   + L GH   VW   F  +     L + S D 
Sbjct: 216 SSDVKHMATCSADHTARIWSVE-DNFNLESTLDGHQRWVWDCAF--SADSAYLVTASSDH 272

Query: 219 TVRIWRCLTDD 229
            VR+W   T D
Sbjct: 273 YVRLWDLSTRD 283

>AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH]
           (1107932..1109335) [1404 bp, 467 aa]
          Length = 467

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 74/188 (39%), Gaps = 29/188 (15%)

Query: 65  RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSR 124
           R   ++  +G  D  + IW     D   E  LL    GH   + + ++SHD    A+ S 
Sbjct: 184 RKTGHLFLSGGNDGVLKIW-----DMYHERLLLRDYCGHRKAISATSFSHDNVQFASSSY 238

Query: 125 DKSVWIWEA------DELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWA 178
           DK+V IW+       + LS +   N  +  H Q+         +LL+  S  D  +R + 
Sbjct: 239 DKTVKIWDTETGDIINRLSFKATPN-CMTFHPQN-------KEQLLVGFS--DSKIRHFD 288

Query: 179 EQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTD-------DAD 231
            + D  +    +  H      +       G +  S SDD ++RIW    +       D D
Sbjct: 289 LRVDKKDGVIQIYDH-HLAAINALRYFPDGSKFISSSDDKSIRIWENQINIPIKQISDTD 347

Query: 232 VFDKEWIQ 239
            +   WIQ
Sbjct: 348 QYPAPWIQ 355

 Score = 36.6 bits (83), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 49/243 (20%), Positives = 94/243 (38%), Gaps = 54/243 (22%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNV-LAAGSFDTTVSIWG 84
           L  +G  D  +K+ D+ + +L+   D   H+KA+ + ++  H NV  A+ S+D TV IW 
Sbjct: 189 LFLSGGNDGVLKIWDMYHERLLLR-DYCGHRKAISATSFS-HDNVQFASSSYDKTVKIWD 246

Query: 85  RDDDDY-----------------SGETELL----------------------AVIEGHEN 105
            +  D                    + +LL                       + + H  
Sbjct: 247 TETGDIINRLSFKATPNCMTFHPQNKEQLLVGFSDSKIRHFDLRVDKKDGVIQIYDHHLA 306

Query: 106 EVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKH----IVWHAS 161
            + ++ +  DG+   + S DKS+ IWE        + N  +++ S   ++    I  H  
Sbjct: 307 AINALRYFPDGSKFISSSDDKSIRIWEN-------QINIPIKQISDTDQYPAPWIQLHPE 359

Query: 162 RLLLASSSYDDTVRIWAEQDD-DWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTV 220
               A+ S D+++ +++ +            GH    + S F+ A  G  + +G     +
Sbjct: 360 HNQFAAQSMDNSIYVYSMKPKYKRHPRKAFRGHKSAGYNSMFDIAPDGRYVAAGDTSGRL 419

Query: 221 RIW 223
            IW
Sbjct: 420 FIW 422

>CAGL0B01529g 137174..138283 highly similar to sp|P39108
           Saccharomyces cerevisiae YDR142c PAS7 peroxisomal import
           protein - peroxin, start by similarity
          Length = 369

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 64/148 (43%), Gaps = 29/148 (19%)

Query: 14  GDRCWSVDISK---GLLATGSADRKIKLVDVRNFK------------LVEELDDTAHKKA 58
           G    S D +K    ++AT   D  I + D+R               LV E+ + AH  A
Sbjct: 221 GKGALSCDFNKYRPNIIATSGVDNSIGIWDIRMLPNSSNQQGFQTGTLVNEIVN-AHDLA 279

Query: 59  VRSVAWRP-HCNVLAAGSFDTTVSIW---GRDDDDYSGETE-------LLAVIEGHENEV 107
           V+ V W P H ++L + S+D +  IW      ++  +G+T        LL+  + H   V
Sbjct: 280 VKKVCWSPHHSDILLSTSYDMSCKIWKDVSVQNNVPTGKTNGSLLSNGLLSNFKHHTEFV 339

Query: 108 KSVAWSHDG--AYLATCSRDKSVWIWEA 133
               WS  G   Y+AT   D +V+IW  
Sbjct: 340 FGADWSLWGIPGYVATAGWDSNVFIWNG 367

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 12/72 (16%)

Query: 119 LATCSRDKSVWIWEADELS-----EEFEC----NSVLQEHSQDVKHIVW--HASRLLLAS 167
           +AT   D S+ IW+   L      + F+     N ++  H   VK + W  H S +LL S
Sbjct: 237 IATSGVDNSIGIWDIRMLPNSSNQQGFQTGTLVNEIVNAHDLAVKKVCWSPHHSDILL-S 295

Query: 168 SSYDDTVRIWAE 179
           +SYD + +IW +
Sbjct: 296 TSYDMSCKIWKD 307

>Kwal_27.12586
          Length = 509

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 64/173 (36%), Gaps = 25/173 (14%)

Query: 59  VRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAY 118
           V  + W P  +    G     + +W  D        +L    + H++ + ++ W+ D  +
Sbjct: 209 VTCLEWSPKGDSFLTGVESGEIRLWTHD-------AKLQNAFDFHKSSIVTIKWNSDATH 261

Query: 119 LATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWA 178
             T   D    +W A       +  + LQ+ S      V   S  + AS    D   I  
Sbjct: 262 FLTYDVDNVAIVWNA-------QTGTALQQFSFRENGTV--DSLGVDASWIGPDKFVIPG 312

Query: 179 EQDDDWECA-------AVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWR 224
            Q   + C          L+GH  T+   DF        L SGSDD T+R+WR
Sbjct: 313 PQGSIYICGMGESRPLGKLNGHSATITAFDFNSENN--MLLSGSDDKTLRVWR 363

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/101 (19%), Positives = 48/101 (47%), Gaps = 5/101 (4%)

Query: 92  GETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQ 151
           GE+  L  + GH   + +  ++ +   L + S DK++ +W +  LS     ++    ++ 
Sbjct: 323 GESRPLGKLNGHSATITAFDFNSENNMLLSGSDDKTLRVWRSGSLS----SSNCFMGNTL 378

Query: 152 DVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSG 192
            +    W     ++A +S D +VR+W+   +  +  +++ G
Sbjct: 379 GITSAFWIDDDKVIA-TSLDGSVRLWSHLTNTLQAISMVDG 418

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/282 (21%), Positives = 122/282 (43%), Gaps = 29/282 (10%)

Query: 1   MPNLHLVRSLKLHGDRCWSVDISKG--LLATGSADRKIKLVDVRNFK-LVEELDDTAHKK 57
           M NL L  S  +      +V +S    ++ATGS    +++++ +  + L ++LD  +H  
Sbjct: 162 MANLELAGSQLVSTKPISAVSLSTDDMVVATGSWAGDLQVLNSQTLQPLTQKLD--SHVG 219

Query: 58  AVRSVAWRPHCN-VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDG 116
            + ++ W P  N  + + + D  +  +   +++  G   LL  + GHE  +  V +   G
Sbjct: 220 KIGAIDWHPDSNNQMISCAEDGLIKNFQYSNEE--GGLRLLGDLVGHERRISDVKYHPSG 277

Query: 117 AYLATCSRDKSVWIWEADELSEEFECNSVLQE-HSQDVKHIVWHASRLLLASSSYDDTVR 175
            ++ + S D +  +W+A    E      +LQE H + V  + +     L+ S   D    
Sbjct: 278 KFIGSASHDMTWRLWDASTHQE-----LLLQEGHDKGVFSLSFQCDGSLVCSGGMDSLSM 332

Query: 176 IWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDK 235
           +W  +         L+GH   ++   +  +  G ++ +G  D  + +W       D+  +
Sbjct: 333 LWDIRSG--SKVMTLAGHSKPIYTVAW--SPNGYQVATGGGDGIINVW-------DIRKR 381

Query: 236 EWIQETVLPAVHTRAVYSVSWSA-DG--LIASVGSDGVLAVY 274
           +  Q   + A H   V  V +S  DG   + S G D ++ VY
Sbjct: 382 DEGQLNQILA-HRNIVTQVRFSKEDGGKKLVSCGYDNLINVY 422

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 91/219 (41%), Gaps = 24/219 (10%)

Query: 107 VKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHA-SRLLL 165
           + +V+ S D   +AT S    + +  +  L         L  H   +  I WH  S   +
Sbjct: 178 ISAVSLSTDDMVVATGSWAGDLQVLNSQTLQP---LTQKLDSHVGKIGAIDWHPDSNNQM 234

Query: 166 ASSSYDDTVR--IWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
            S + D  ++   ++ ++        L GH   +  SD +   +G  + S S D T R+W
Sbjct: 235 ISCAEDGLIKNFQYSNEEGGLRLLGDLVGHERRI--SDVKYHPSGKFIGSASHDMTWRLW 292

Query: 224 RCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQAGRWE 283
              T           QE +L   H + V+S+S+  DG +   G    L++  ++++G  +
Sbjct: 293 DASTH----------QELLLQEGHDKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGS-K 341

Query: 284 VVARVDCAHTVYEINVVKWLALDGRVLLVTGGDDGCVNV 322
           V+     +  +Y    V W     +V   TGG DG +NV
Sbjct: 342 VMTLAGHSKPIY---TVAWSPNGYQV--ATGGGDGIINV 375

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 58/146 (39%), Gaps = 42/146 (28%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIW-- 83
           L+ +G  D    L D+R+   V  L    H K + +VAW P+   +A G  D  +++W  
Sbjct: 321 LVCSGGMDSLSMLWDIRSGSKVMTL--AGHSKPIYTVAWSPNGYQVATGGGDGIINVWDI 378

Query: 84  -GRDDDD------------------------------------YSGETEL-LAVIEGHEN 105
             RD+                                      YS +T L +  + GH +
Sbjct: 379 RKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVYSSDTWLKMGSLAGHTD 438

Query: 106 EVKSVAWSHDGAYLATCSRDKSVWIW 131
           ++ S+  S++  +L +   D+S+ +W
Sbjct: 439 KIISLDISNNSHFLVSGGWDRSIKLW 464

>Scas_465.4
          Length = 1002

 Score = 41.2 bits (95), Expect = 0.001,   Method: Composition-based stats.
 Identities = 32/114 (28%), Positives = 55/114 (48%), Gaps = 10/114 (8%)

Query: 64  WRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCS 123
           + P    ++AG+    V IW     D   ET+L  ++ GHE  +     S +G Y+ +CS
Sbjct: 145 FSPEKVYISAGTVMGGVLIW-----DLFLETKLYNLV-GHEGSIFYATISDNGRYITSCS 198

Query: 124 RDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
            D+S+ +W   +  EE  C      H+  + ++ +  +   L S S D+T R+W
Sbjct: 199 DDRSIKLWNL-QTGEEL-CTG--WGHTARIWNLKFFNNDTQLISVSEDNTCRVW 248

 Score = 35.4 bits (80), Expect = 0.058,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 4/67 (5%)

Query: 165 LASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWR 224
           + S S D ++++W  Q  +  C     GH   +W   F   +T  +L S S+D T R+W 
Sbjct: 194 ITSCSDDRSIKLWNLQTGEELCTG--WGHTARIWNLKFFNNDT--QLISVSEDNTCRVWD 249

Query: 225 CLTDDAD 231
            L D+ +
Sbjct: 250 ILQDEGN 256

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 97/226 (42%), Gaps = 27/226 (11%)

Query: 99  VIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVW 158
            ++GH N++    WS D   + + S+D  + IW  D +S   + N++  + SQ V     
Sbjct: 83  TLKGHNNKISDFRWSRDSKSILSASQDGFMLIW--DPMS-GLKKNAIPLD-SQWVLACAI 138

Query: 159 HASRLLLASSSYDDT---VRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGS 215
             SR L+AS    +     RI  E     +  ++  GH  T + SD E       + + S
Sbjct: 139 SPSRNLVASGGLSNNCTIYRISQENRTQQKIVSIFKGH--TCYVSDLEFINNE-SILTAS 195

Query: 216 DDTTVRIWRCLTDDADVFDKEWIQETV--LPAVHTRAVYSV-SWSADGLIASVGSDGVLA 272
            D T  +W       D+   + + E    L  V T +V    + S D + AS GSDG + 
Sbjct: 196 GDMTCALW-------DIPKSKRVSEYSDHLGDVLTLSVPPAGTTSYDSMFASGGSDGYVY 248

Query: 273 VYKEVQAGRWEVVARVDCAHTVYEINVVKWLALDGRVLLVTGGDDG 318
           ++        +     D      +I+ V++ + DG   ++TG DDG
Sbjct: 249 LWDTRSPSSVQNFFVSDS-----DISTVRFFS-DGNS-IITGSDDG 287

>YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein with
           possible role in ribosome biogenesis, has similarity to
           mouse Bop1 growth suppressor, has five WD (WD-40)
           domains [2424 bp, 807 aa]
          Length = 807

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 12/88 (13%)

Query: 186 CAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPA 245
           C+ + +GH G V     +   +G+ L +GSDD TVR+W  LT   +V+    I +   P 
Sbjct: 429 CSTIYAGHKGKVRTLSID--PSGLWLATGSDDGTVRVWEILT-GREVYRTTLIDDEENPD 485

Query: 246 VHTRAVYSVSWSADGLIASVGSDGVLAV 273
            H   +  + W+ D       ++G+LAV
Sbjct: 486 YH---IECIEWNPD------ANNGILAV 504

>Scas_701.45
          Length = 1276

 Score = 40.8 bits (94), Expect = 0.001,   Method: Composition-based stats.
 Identities = 56/259 (21%), Positives = 101/259 (38%), Gaps = 69/259 (26%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRP-HCNVLAAGSFDTTVSIWG 84
           L +    D KI L  +  FK         H  AV ++ + P   NVLA+   +  + IW 
Sbjct: 91  LFSKEENDTKISLKSLGKFK--------KHTTAVNTLRFNPKQQNVLASAGNNGEILIWD 142

Query: 85  RD----DDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVW--IWEADELSE 138
            +      DYS     +A+    ++E+KSV+W+   A++   + D + +  IW+      
Sbjct: 143 INKTLSSTDYSPSAPGIAM--STQDEIKSVSWNKSLAHVFASAGDTTTYASIWDL----- 195

Query: 139 EFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVW 198
                    +  ++V H+ + + +  L  +                   AV+  H     
Sbjct: 196 ---------KAKKEVIHLNYTSPKTGLKPN------------------LAVVEWH----- 223

Query: 199 CSDFERAETGIRLCSGSD-DTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWS 257
                +  T +   SGSD D  + IW     +  +        T L   HT+ + S+ W 
Sbjct: 224 ----PKVTTYVATASGSDSDPVILIWDLRNSNMPM--------TTLEGPHTKGIMSLDWC 271

Query: 258 A--DGLIASVGSDGVLAVY 274
              + L+ S G DG++A++
Sbjct: 272 TKDESLLLSSGRDGIVALW 290

>ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH]
           complement(1012413..1013798) [1386 bp, 461 aa]
          Length = 461

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 60/128 (46%), Gaps = 14/128 (10%)

Query: 54  AHKKAVRSVAWRPHCN---VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSV 110
           AH K V S+A     N   +++  S D    IW   D+      +LL  +  HE+ V   
Sbjct: 161 AHMKGVTSLAVMEAENGSLLISTTSKDLQCKIWSFTDN---AAFQLLRTLSSHEHIVSQS 217

Query: 111 AWSHDGA--YLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASS 168
            +   G+   LATCSRD +V +W+    ++   C    Q H+Q V+ +  H   ++  S+
Sbjct: 218 CFLRSGSDLLLATCSRDLTVKVWD----TKSGWCIKSFQPHNQWVRTLELHGDYVITGSN 273

Query: 169 SYDDTVRI 176
             D T+R+
Sbjct: 274 --DATIRL 279

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 163 LLLASSSYDDTVRIWAEQDDD-WECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVR 221
           LL++++S D   +IW+  D+  ++    LS H   V  S F R+ + + L + S D TV+
Sbjct: 179 LLISTTSKDLQCKIWSFTDNAAFQLLRTLSSHEHIVSQSCFLRSGSDLLLATCSRDLTVK 238

Query: 222 IW 223
           +W
Sbjct: 239 VW 240

 Score = 31.6 bits (70), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 88/216 (40%), Gaps = 34/216 (15%)

Query: 34  RKIKLVDVRNFKLVEELD---DTAHKKAVRSVA---WRPHCNV---LAAGSFDT------ 78
           RKI  ++ +  +L EEL+     A+ KA R V+   W P  N    L  G+  T      
Sbjct: 71  RKILDLEQKCQQLTEELEAVPTEAYGKAGRGVSHVLWTPRSNPTFQLDVGASVTDIKLHP 130

Query: 79  --TVSIWGRDDD-----DYSGETELLAVIEGHENEVKSVAW--SHDGAYL-ATCSRDKSV 128
              ++    D       D    +  L   + H   V S+A   + +G+ L +T S+D   
Sbjct: 131 SLPIAFLATDQGKVVAYDLFNRSMPLHSTQAHMKGVTSLAVMEAENGSLLISTTSKDLQC 190

Query: 129 WIWEADELSEEFECNSVLQEHSQDVKH--IVWHASRLLLASSSYDDTVRIWAEQDDDWEC 186
            IW   + +  F+    L  H   V     +   S LLLA+ S D TV++W +    W C
Sbjct: 191 KIWSFTD-NAAFQLLRTLSSHEHIVSQSCFLRSGSDLLLATCSRDLTVKVW-DTKSGW-C 247

Query: 187 AAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRI 222
                 H    W    E    G  + +GS+D T+R+
Sbjct: 248 IKSFQPHNQ--WVRTLELH--GDYVITGSNDATIRL 279

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 107/251 (42%), Gaps = 48/251 (19%)

Query: 39  VDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLA 98
           V V++FK         H   V+      +     +GS+D T+ +W    D  +GET    
Sbjct: 56  VPVKSFK--------GHSHIVQDCTLTENGAYALSGSWDKTLRLW----DVATGET--FQ 101

Query: 99  VIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVW 158
              GH+ +V SVA     + + + SRDKS+ +W     S + +C + L  H+       W
Sbjct: 102 TFVGHKGDVMSVAIDKKASMIISGSRDKSIKVW-----SIKGDCLATLIGHND------W 150

Query: 159 HASRLLLASSSYDDTVRIWAEQDDD-----WECAAVLSGH----GGTVWCSDFERAETGI 209
            +   +  SS  DD V + +  +D      W  AA +  +    G  V+   F  +    
Sbjct: 151 VSQVRIANSSDDDDKVTVISAGNDKMVKVLWNSAAKVPMYTLSAGDEVYALSF--SPNRY 208

Query: 210 RLCSGSDDTTVRIW----RCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASV 265
            LC+ +  + ++I+    +CL DD       + Q     AV      S++WS+DG     
Sbjct: 209 WLCAAT-ASGIKIFSLDPQCLLDDLKPEFAGYTQSAEPHAV------SLAWSSDGQTLFA 261

Query: 266 G-SDGVLAVYK 275
           G +D V+ V++
Sbjct: 262 GYTDNVIRVWQ 272

>YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in
           mitochondrial division and mitochondrial fission,
           contains WD (WD-40) repeats [2145 bp, 714 aa]
          Length = 714

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 68/155 (43%), Gaps = 32/155 (20%)

Query: 2   PNLHL----VRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELD------ 51
           P  H+    V + + H D   ++ +    L +GS DR I+  D+R+ K ++ +D      
Sbjct: 486 PTNHIDSPCVHTFEAHTDEVTALSLDPSFLVSGSQDRTIRQWDLRSGKCLQTIDLSFANV 545

Query: 52  -------DTAHKKAVRSVAWRPHCN-------VLAAGSFDTTVSIWGRDDDDYSGETELL 97
                  D +    +     RP           LA G+ D  V +W    D  SG  +++
Sbjct: 546 LTTSTNVDLSKSTLLTQRNERPSIGALQSFDAALATGTKDGVVRLW----DLRSG--KVI 599

Query: 98  AVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWE 132
             ++GH + + S+ +  D A L T S D++V IW+
Sbjct: 600 RTLKGHTDAITSLKF--DSACLVTGSYDRTVRIWD 632

 Score = 31.6 bits (70), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 90/242 (37%), Gaps = 48/242 (19%)

Query: 17  CWSVDISKGLLAT-GSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGS 75
           C   D   G L T G  D  +K+ D+     + EL    H   +  +        L  G 
Sbjct: 403 CLDFDAPFGTLCTAGYLDHTVKIWDLSKQNKIGEL--AGHLATINCMQINRDYGTLVTGG 460

Query: 76  FDTTVSIWGRD-DDDYSGETELLA------------VIEGHENEVKSVAWSHDGAYLATC 122
            D  + +W  +       ET+ L               E H +EV   A S D ++L + 
Sbjct: 461 RDAALKLWNLNLAQQLYQETQNLTSPTNHIDSPCVHTFEAHTDEV--TALSLDPSFLVSG 518

Query: 123 SRDKSVWIWE--------------ADELSE----EFECNSVLQEHSQDVKHIVWHASRLL 164
           S+D+++  W+              A+ L+     +   +++L + ++        +    
Sbjct: 519 SQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNVDLSKSTLLTQRNERPSIGALQSFDAA 578

Query: 165 LASSSYDDTVRIWAEQDDDWECAAV---LSGHGGTVWCSDFERAETGIRLCSGSDDTTVR 221
           LA+ + D  VR+W     D     V   L GH   +    F+ A     L +GS D TVR
Sbjct: 579 LATGTKDGVVRLW-----DLRSGKVIRTLKGHTDAITSLKFDSA----CLVTGSYDRTVR 629

Query: 222 IW 223
           IW
Sbjct: 630 IW 631

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 6   LVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVR 42
           ++R+LK H D   S+      L TGS DR +++ D+R
Sbjct: 598 VIRTLKGHTDAITSLKFDSACLVTGSYDRTVRIWDLR 634

>YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the
           trimeric G protein that mediates signal transduction by
           pheromones, member of the WD (WD-40) repeat family [1272
           bp, 423 aa]
          Length = 423

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/231 (22%), Positives = 101/231 (43%), Gaps = 28/231 (12%)

Query: 99  VIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVW 158
           V++GH N++    WS D   + + S+D  + IW++   +   + N++  + SQ V     
Sbjct: 87  VLKGHNNKISDFRWSRDSKRILSASQDGFMLIWDS---ASGLKQNAIPLD-SQWVLSCAI 142

Query: 159 HASRLLLASSSYDDTVRIWAEQDDD---WECAAVLSGHGGTVWCSDFERAETGIRLCSGS 215
             S  L+AS+  ++   I+    ++      A++  GH  T + SD E  +    + + S
Sbjct: 143 SPSSTLVASAGLNNNCTIYRVSKENRVAQNVASIFKGH--TCYISDIEFTDNA-HILTAS 199

Query: 216 DDTTVRIWRCLTDDADVFDKEWIQETV--LPAVHTRAVY--SVSWSADGLIASVGSDGVL 271
            D T  +W       D+   + ++E    L  V   A+     S ++    AS GSDG  
Sbjct: 200 GDMTCALW-------DIPKAKRVREYSDHLGDVLALAIPEEPNSENSSNTFASCGSDGYT 252

Query: 272 AVYKEVQAGRWEVVARVDCAHTVYEINVVKWLALDGRVLLVTGGDDGCVNV 322
            ++        +     D      +IN +++   DG + +V G D+G +N+
Sbjct: 253 YIWDSRSPSAVQSFYVNDS-----DINALRFFK-DG-MSIVAGSDNGAINM 296

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 185 ECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           E    L GHGG V  +    +  G+ +C+GS D+T++IW
Sbjct: 382 EIVGKLEGHGGRV--TGVRSSPDGLAVCTGSWDSTMKIW 418

>AEL250C [2256] [Homologous to ScYBR195C (MSI1) - SH]
           (168010..169263) [1254 bp, 417 aa]
          Length = 417

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 49/111 (44%), Gaps = 8/111 (7%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCN--VLAAGSFDTTVSIW 83
           LL    ++  I L D R F   + L    H  +V ++ W P+    V  AG  D  + IW
Sbjct: 304 LLCAADSNGGIALWDCRAFS--KPLSVFNHGDSVSALQWNPNLPTIVATAGQGDGLIKIW 361

Query: 84  GRDDDDYSGETELLAVIEGHENEVKSVAWS-HDGAYLATCSRDKSVWIWEA 133
              D     E  LL V  GH   V  +AW+ HD   + + + D SV +W+ 
Sbjct: 362 ---DTSREPEDSLLFVHGGHMLGVNDIAWNYHDPWLMCSVANDNSVHVWKP 409

>YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal
           biogenesis protein (peroxin) that serves as import
           receptor for proteins containing peroxisomal targeting
           signal 2 (PTS2), member of WD (WD-40) repeat family
           [1128 bp, 375 aa]
          Length = 375

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 58/140 (41%), Gaps = 33/140 (23%)

Query: 26  LLATGSADRKIKLVDVR-------------------NFKLVEELDDTAHKKAVRSVAWRP 66
           ++ATG  D  I++ D+R                   N   + E+ + AH  A+R V W P
Sbjct: 235 VVATGGVDNAIRIWDIRMLNKNESATIKRTVPGQLHNSSCINEIPN-AHGLAIRKVTWSP 293

Query: 67  H-CNVLAAGSFDTTVSIWGRDDDDYSGETEL----------LAVIEGHENEVKSVAWSHD 115
           H  N+L + S+D T  IW    +D + ET            +     H   V    WS  
Sbjct: 294 HHSNILMSASYDMTCRIWRDLSNDGAKETYKTNSTDATKGSIFNFTQHSEFVFGADWSLW 353

Query: 116 G--AYLATCSRDKSVWIWEA 133
           G   Y+A+ + D ++++W  
Sbjct: 354 GKPGYVASTAWDGNLFVWNG 373

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 3/43 (6%)

Query: 143 NSVLQEHSQDVKHIVW--HASRLLLASSSYDDTVRIWAEQDDD 183
           N +   H   ++ + W  H S +L+ S+SYD T RIW +  +D
Sbjct: 276 NEIPNAHGLAIRKVTWSPHHSNILM-SASYDMTCRIWRDLSND 317

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 54/125 (43%), Gaps = 8/125 (6%)

Query: 100 IEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWH 159
            EGH   V S+++  D  ++ + S D ++ +W+    S +        +H   V  +V H
Sbjct: 71  FEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRN-----YKHHAPVNEVVIH 125

Query: 160 ASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTT 219
            ++  L S   D  +RIW   ++  +C   L+    T   S    A  G  L +G++   
Sbjct: 126 PNQGELISCDQDGNIRIWDLGEN--QCTHQLTPEDDTPLQS-LSIASDGSMLVAGNNKGN 182

Query: 220 VRIWR 224
             +W+
Sbjct: 183 CYVWQ 187

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/161 (21%), Positives = 69/161 (42%), Gaps = 10/161 (6%)

Query: 20  VDISKGLLATGSADRKIKLVDVRNFKLVEEL---DDTAHKKAVRSVAWRPHCNVLAAGSF 76
           +  ++G L +   D  I++ D+   +   +L   DDT     ++S++     ++L AG+ 
Sbjct: 124 IHPNQGELISCDQDGNIRIWDLGENQCTHQLTPEDDTP----LQSLSIASDGSMLVAGNN 179

Query: 77  DTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADEL 136
                +W   +   +   + +     H   +  V  S D  +LATCS D +  +W    +
Sbjct: 180 KGNCYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVW---SI 236

Query: 137 SEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
            + F+  + L  H + V    + A    L ++  D  VR+W
Sbjct: 237 EDNFKLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLW 277

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 41/94 (43%), Gaps = 7/94 (7%)

Query: 39  VDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLA 98
            D  N K V +    +H K +  V        LA  S D T  +W  +D+      +L  
Sbjct: 192 TDAANLKPVTKF--RSHTKYITRVLLSSDVKHLATCSADHTARVWSIEDN-----FKLET 244

Query: 99  VIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWE 132
            ++GH+  V   A+S D AYL T   D  V +W+
Sbjct: 245 TLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWD 278

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 66/156 (42%), Gaps = 20/156 (12%)

Query: 71  LAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWI 130
            A GS D T+ IW           +L   ++ H+  V+ +A S+   Y+ + S DK+V  
Sbjct: 131 FATGSNDKTIKIWNL------ASGKLKVTLKAHDMTVRDLAISNRHPYMFSVSEDKTVKC 184

Query: 131 WEADELSEEFECNSVLQE---HSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECA 187
           W       + E N+ ++    H   V  +  H +  ++ ++  D  V++W  +       
Sbjct: 185 W-------DLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVWDIRTR--LPV 235

Query: 188 AVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
             L GH G +  +         ++ S S D ++R+W
Sbjct: 236 MTLPGHKGPI--TKVRCLPVDPQVISSSVDASIRLW 269

 Score = 32.3 bits (72), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 53/133 (39%), Gaps = 9/133 (6%)

Query: 96  LLAVIEGHENEVKSVAWSH-DGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVK 154
           L  VI GH   V+ +A    D  + AT S DK++ IW         +    L+ H   V+
Sbjct: 107 LTRVIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNL----ASGKLKVTLKAHDMTVR 162

Query: 155 HIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSG 214
            +        + S S D TV+ W    D  +  A+ + HG        +   T   + + 
Sbjct: 163 DLAISNRHPYMFSVSEDKTVKCW----DLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTA 218

Query: 215 SDDTTVRIWRCLT 227
             D+ V++W   T
Sbjct: 219 GRDSVVKVWDIRT 231

>Scas_693.22
          Length = 1145

 Score = 39.7 bits (91), Expect = 0.003,   Method: Composition-based stats.
 Identities = 33/130 (25%), Positives = 56/130 (43%), Gaps = 14/130 (10%)

Query: 99  VIEGHENEVKSVAWSHDGA-YLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIV 157
           V+ GH   +  + ++ +    LATCS D  V  W+       F   S  +  +  VK   
Sbjct: 112 VLHGHSRAITDINFNPENPDILATCSVDTYVHAWDMRSPHRPFYTTSAWRSGASQVK--- 168

Query: 158 WHASRLLLASSSYDDTVRIWAEQDDDWECAAV----LSGHGGTVWCSDFERAETGIRLCS 213
           W+     + +S++ + + IW     D    +     L GH  +V   DF R ++   + S
Sbjct: 169 WNYKDSNILASAHSNDIYIW-----DLRMGSTPLHKLVGHDSSVNSIDFNRFKSS-EIMS 222

Query: 214 GSDDTTVRIW 223
            S+D TV+ W
Sbjct: 223 SSNDGTVKFW 232

 Score = 29.6 bits (65), Expect = 4.2,   Method: Composition-based stats.
 Identities = 30/142 (21%), Positives = 54/142 (38%), Gaps = 14/142 (9%)

Query: 54  AHKKAVRSVAWRP-HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAW 112
            H +A+  + + P + ++LA  S DT V  W     D               +    V W
Sbjct: 115 GHSRAITDINFNPENPDILATCSVDTYVHAW-----DMRSPHRPFYTTSAWRSGASQVKW 169

Query: 113 SHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWH---ASRLLLASSS 169
           ++  + +   +    ++IW+    S        L  H   V  I ++   +S ++  SSS
Sbjct: 170 NYKDSNILASAHSNDIYIWDLRMGSTPLH---KLVGHDSSVNSIDFNRFKSSEIM--SSS 224

Query: 170 YDDTVRIWAEQDDDWECAAVLS 191
            D TV+ W        C + +S
Sbjct: 225 NDGTVKFWDISKGSDNCTSTVS 246

>AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH]
           complement(1256750..1258087) [1338 bp, 445 aa]
          Length = 445

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 47/104 (45%), Gaps = 10/104 (9%)

Query: 165 LASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWR 224
           + S SYD  VR W   +   +     SGH G V    F    +  RL SG +D T+R+W+
Sbjct: 116 IVSGSYDGVVRTW---NLSGKIEKQYSGHTGAVRAVKFI---SSTRLVSGGNDRTLRLWK 169

Query: 225 CLTDDADVFDK-EWIQETVLPAV---HTRAVYSVSWSADGLIAS 264
              DD    D+ E  +E    A+   H   V SV    D ++++
Sbjct: 170 TKNDDVKHVDELEGTEEAHTLAILEGHQAPVVSVDVQGDRILSA 213

 Score = 36.6 bits (83), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 65/307 (21%), Positives = 116/307 (37%), Gaps = 72/307 (23%)

Query: 22  ISKGLLATGSADRKIKLVDVRN--FKLVEELDDT--AHKKAVRSVAWRPHCNV------L 71
           IS   L +G  DR ++L   +N   K V+EL+ T  AH  A+      P  +V      +
Sbjct: 151 ISSTRLVSGGNDRTLRLWKTKNDDVKHVDELEGTEEAHTLAILEGHQAPVVSVDVQGDRI 210

Query: 72  AAGSFDTTVSIWGRDDDDYSGETEL-----------------------------LAVIEG 102
            + S+D ++  W  +  D +    +                             L+++E 
Sbjct: 211 LSASYDNSIGFWSTNHKDMTAVDPMDSLGDKASSAAKKRRKLTMKDGSVRRRAPLSLLES 270

Query: 103 HENEVKSVAW-SHDGAYLATCSRDKSVWIWE------ADELSEEFECNSVLQEHS----- 150
           H+  V+ V + S+D     + S+D ++  W+       D  S  +   S+++        
Sbjct: 271 HKAPVEQVIFASNDSTVAYSVSQDHTIKTWDLVTSRCVDTKSTSYSLLSMVELPKLRLLA 330

Query: 151 --QDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETG 208
                +HI  H  R        D + +I  +Q         L GH   V   D    E  
Sbjct: 331 CGSSARHITLHDPRA-------DSSAKITQQQ---------LLGHKNFVVALD-TCPENE 373

Query: 209 IRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSD 268
             LCS S D TV++W  +   + ++      ++V   ++ + V++V W+    I S G D
Sbjct: 374 YMLCSASHDGTVKVWD-IRSSSSIYTITREDQSVEKGINDK-VFAVKWAKGVGIISGGQD 431

Query: 269 GVLAVYK 275
             +   K
Sbjct: 432 KKIQFNK 438

 Score = 35.4 bits (80), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 11/90 (12%)

Query: 53  TAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETEL--------LAVIEGHE 104
           + H  AVR+V +     +++ G+ D T+ +W   +DD     EL        LA++EGH+
Sbjct: 139 SGHTGAVRAVKFISSTRLVSGGN-DRTLRLWKTKNDDVKHVDELEGTEEAHTLAILEGHQ 197

Query: 105 NEVKSVAWSHDGAYLATCSRDKSVWIWEAD 134
             V SV     G  + + S D S+  W  +
Sbjct: 198 APVVSVDV--QGDRILSASYDNSIGFWSTN 225

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 56/124 (45%), Gaps = 20/124 (16%)

Query: 71  LAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWI 130
           + +GS+D  V  W     + SG+ E      GH   V++V +      L +   D+++ +
Sbjct: 116 IVSGSYDGVVRTW-----NLSGKIE--KQYSGHTGAVRAVKFI-SSTRLVSGGNDRTLRL 167

Query: 131 WEA--------DEL--SEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQ 180
           W+         DEL  +EE    ++L+ H   V  +     R+L  S+SYD+++  W+  
Sbjct: 168 WKTKNDDVKHVDELEGTEEAHTLAILEGHQAPVVSVDVQGDRIL--SASYDNSIGFWSTN 225

Query: 181 DDDW 184
             D 
Sbjct: 226 HKDM 229

>Sklu_2317.3 YDR142C, Contig c2317 5804-6910
          Length = 368

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 57/129 (44%), Gaps = 21/129 (16%)

Query: 26  LLATGSADRKIKLVDVRNF-KLVEELDDT-------AHKKAVRSVAWRP-HCNVLAAGSF 76
           ++ATG  D+ +K+ D+R   K    L           H+ A+R V+W P H N++ + S+
Sbjct: 237 IVATGGVDKLVKIWDLRMVRKFSNPLQQPMSINEIPGHELAIRKVSWSPHHSNLVLSTSY 296

Query: 77  DTTVSIWGRDDDD---YSGETELLAVIEG-------HENEVKSVAWS--HDGAYLATCSR 124
           D T  +W    D     +G+T  +   +G       H   V    WS      Y+A+ + 
Sbjct: 297 DMTCRVWDDLSDSNGRPTGKTNSIDPTKGCRFIFPHHTEFVFGADWSLWGQPGYVASTAW 356

Query: 125 DKSVWIWEA 133
           D +V IW  
Sbjct: 357 DGNVCIWHT 365

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 11/73 (15%)

Query: 119 LATCSRDKSVWIWE-------ADELSEEFECNSVLQEHSQDVKHIVW--HASRLLLASSS 169
           +AT   DK V IW+       ++ L +    N +   H   ++ + W  H S L+L S+S
Sbjct: 238 VATGGVDKLVKIWDLRMVRKFSNPLQQPMSINEI-PGHELAIRKVSWSPHHSNLVL-STS 295

Query: 170 YDDTVRIWAEQDD 182
           YD T R+W +  D
Sbjct: 296 YDMTCRVWDDLSD 308

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 144 SVLQEHSQDVKHIVWH-ASRLLLASSSYDDTVRIWAE 179
           S+ QEH ++V    W+  ++    SSS+D TV+IW+ 
Sbjct: 98  SIFQEHQKEVFSCNWNLVNKQTFVSSSWDGTVKIWSP 134

>KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces
           cerevisiae YMR049c singleton, start by similarity
          Length = 791

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 13/97 (13%)

Query: 186 CAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPA 245
           C+ V  GH G +     +   TG+ L +GSDD TVR+W  LT       +E  Q T+L A
Sbjct: 418 CSTVYVGHKGKIRTMSID--PTGLWLATGSDDGTVRVWEILT------GREVYQVTILNA 469

Query: 246 VHTR--AVYSVSWSAD---GLIASVGSDGVLAVYKEV 277
                  +  V W+ D   G++A    + +  +   +
Sbjct: 470 EENNDDHIDVVEWNPDSTTGILAVTAGENIFLLVPPI 506

>Kwal_56.23685
          Length = 1102

 Score = 39.3 bits (90), Expect = 0.004,   Method: Composition-based stats.
 Identities = 48/186 (25%), Positives = 76/186 (40%), Gaps = 26/186 (13%)

Query: 59  VRSVAWRPHCN----VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAW-- 112
           V  V W PH +    V++  +    +    R+  D      +  V+ GH   +  + +  
Sbjct: 70  VADVQWSPHPSKPSWVISTSNQKALLWNLSRNSSD-----AIEHVLHGHSRAITDINFHP 124

Query: 113 SHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDD 172
           +H    LATCS D  V  W+       +   SV    +  VK   W+     + +S++ +
Sbjct: 125 THP-EILATCSIDAYVHAWDMRSPRRAYYSASVWSAGASQVK---WNYKNSNVMASAHSN 180

Query: 173 TVRIWAEQDDDWECAA--VLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDA 230
            V IW   D    C    VL GH  +V   DF + +    + S S+D TV+ W     D 
Sbjct: 181 DVYIW---DLRKGCTPLHVLQGHVNSVNSIDFSKFDE-TEIMSSSNDGTVKFW-----DY 231

Query: 231 DVFDKE 236
            + DKE
Sbjct: 232 SLSDKE 237

>CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein, start by similarity
          Length = 457

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 61/144 (42%), Gaps = 29/144 (20%)

Query: 150 SQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGI 209
           S D +HI          S SYD  VR W   +   +     SGH G V    +    +  
Sbjct: 112 SDDFRHIY---------SGSYDGVVRTW---NMSGKVEKQYSGHTGAVKAVKYI---SNT 156

Query: 210 RLCSGSDDTTVRIWRCLTDDADVF-------DKEWIQETVLPAV---HTRAVYSVSWSAD 259
           R+ S  +D ++R+W+   DD  V        D+E I++    A+   H   V S+  +++
Sbjct: 157 RIVSAGNDRSLRLWKTKNDDGSVSNNTGDENDEENIEDGKTLAILEGHKAPVVSLDVASN 216

Query: 260 GLIASVGSDGVLA----VYKEVQA 279
             I S   D  +A    +YKE+ A
Sbjct: 217 SRILSASYDNTVALWSTIYKEMTA 240

 Score = 35.0 bits (79), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 86/191 (45%), Gaps = 31/191 (16%)

Query: 53  TAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYS----------------GETEL 96
           + H  AV++V +  +  +++AG+ D ++ +W   +DD S                G+T  
Sbjct: 141 SGHTGAVKAVKYISNTRIVSAGN-DRSLRLWKTKNDDGSVSNNTGDENDEENIEDGKT-- 197

Query: 97  LAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHI 156
           LA++EGH+  V S+  + +   L+  S D +V +W    + +E      L+E  Q+  + 
Sbjct: 198 LAILEGHKAPVVSLDVASNSRILS-ASYDNTVALWST--IYKEMTAIDHLEE-IQNPNNK 253

Query: 157 VWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSD 216
           +  A++     +  D T+R  A         ++L  H G V    F+  +  +   S S 
Sbjct: 254 ISTAAKKRRKLTLKDGTIRRRAP-------LSLLESHTGPVEQVIFDHGDNTVGY-SVSQ 305

Query: 217 DTTVRIWRCLT 227
           D T++ W  +T
Sbjct: 306 DHTIKTWDLVT 316

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 82/197 (41%), Gaps = 41/197 (20%)

Query: 97  LAVIEGHENEVKSVAWSH-DGAYLATCSRDKSVWIWE------ADELSEEFECNSVLQEH 149
           L+++E H   V+ V + H D     + S+D ++  W+       D  +  +   S+ Q  
Sbjct: 277 LSLLESHTGPVEQVIFDHGDNTVGYSVSQDHTIKTWDLVTARCIDTKTTSYPLLSIAQMP 336

Query: 150 SQD-------VKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTV----W 198
           + +       V+HI  H  R+   SSS     +I  +Q         L GH   V     
Sbjct: 337 TLNLLACGSSVRHITLHDPRV---SSS----AKITQKQ---------LVGHKNFVVGLDT 380

Query: 199 CSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSA 258
           CS+ E       LCS S D TV++W   +  + ++       TV   V+ + V++V W+ 
Sbjct: 381 CSENEYL-----LCSASHDGTVKVWDVRS-TSPMYTITRQDPTVEKGVNDK-VFAVKWAK 433

Query: 259 DGLIASVGSDGVLAVYK 275
              I S G D  + + K
Sbjct: 434 SIGIISGGQDKKIQINK 450

 Score = 28.5 bits (62), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 40/103 (38%), Gaps = 22/103 (21%)

Query: 157 VWHASRLLLASSSYDDTVRIWAEQDDDWECA------------------AVLSGHGGTVW 198
           V + S   + S+  D ++R+W  ++DD   +                  A+L GH   V 
Sbjct: 150 VKYISNTRIVSAGNDRSLRLWKTKNDDGSVSNNTGDENDEENIEDGKTLAILEGHKAPVV 209

Query: 199 CSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDK-EWIQE 240
             D     +  R+ S S D TV +W  +  +    D  E IQ 
Sbjct: 210 SLD---VASNSRILSASYDNTVALWSTIYKEMTAIDHLEEIQN 249

>AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH]
           complement(341382..342494) [1113 bp, 370 aa]
          Length = 370

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 51/131 (38%), Gaps = 23/131 (17%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTA---------HKKAVRSVAWRP-HCNVLAAGS 75
           ++ATG  D+ +K+ D+R  +       TA         H  AVR V W P H N+L + S
Sbjct: 237 VIATGGVDKMVKVWDLRMVRQTLTTSRTAPVSINEMQGHSLAVRKVVWSPHHSNILLSTS 296

Query: 76  FDTTVSIWGRDDD----DYSGETE-------LLAVIEGHENEVKSVAWS--HDGAYLATC 122
           +D T   W    D     +SG T           V   H   V    WS      Y+AT 
Sbjct: 297 YDMTCRAWHDLADGPGGQHSGRTNNSDPQRGCSYVFSKHSEFVFGADWSLWGQPGYVATT 356

Query: 123 SRDKSVWIWEA 133
             D  V  W A
Sbjct: 357 GWDGQVCAWYA 367

 Score = 32.7 bits (73), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 45/107 (42%), Gaps = 25/107 (23%)

Query: 119 LATCSRDKSVWIWEADELSEEFECNSV-------LQEHSQDVKHIVW--HASRLLLASSS 169
           +AT   DK V +W+   + +    +         +Q HS  V+ +VW  H S +LL S+S
Sbjct: 238 IATGGVDKMVKVWDLRMVRQTLTTSRTAPVSINEMQGHSLAVRKVVWSPHHSNILL-STS 296

Query: 170 YDDTVRIWAE---------------QDDDWECAAVLSGHGGTVWCSD 201
           YD T R W +                D    C+ V S H   V+ +D
Sbjct: 297 YDMTCRAWHDLADGPGGQHSGRTNNSDPQRGCSYVFSKHSEFVFGAD 343

>CAGL0J06512g complement(620516..622153) similar to sp|Q04199
           Saccharomyces cerevisiae YML102w CAC2, start by
           similarity
          Length = 545

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 75/192 (39%), Gaps = 46/192 (23%)

Query: 24  KGLLATGSADRKIKL--------------VDVRNFKLVEELDDTAHKKAVRSVAWRPHCN 69
           KG L T   D K++L              VD  +F     L    H++AV  + +    N
Sbjct: 38  KGELFTAGGDNKVRLWRLNCEETGKGTCKVDTIDFLSGLSL----HEQAVNVIRFDHRGN 93

Query: 70  VLAAGSFDTTVSIWGRDDDDYSGETELLA------------------------VIEGHEN 105
           VLA+   D  V +W   +++   + + +                         +  G  +
Sbjct: 94  VLASAGDDGQVLLWKLTNEETRKKQQRMGDEPVEGDGWAVWKRLRGTANDLDNMPGGGAS 153

Query: 106 EVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLL 165
           E+  ++WS D  YL T S D S+ ++  D  +    C +  ++H+  V+ + W      +
Sbjct: 154 EIYDLSWSPDDKYLVTASMDNSLKVFNVDTGN----CVAFAKDHNHYVQGVTWDPLNQYI 209

Query: 166 ASSSYDDTVRIW 177
            S S D ++ I+
Sbjct: 210 ISQSVDRSINIY 221

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 33/71 (46%), Gaps = 6/71 (8%)

Query: 62  VAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLAT 121
           ++W P    L   S D ++ ++  D  +       +A  + H + V+ V W     Y+ +
Sbjct: 158 LSWSPDDKYLVTASMDNSLKVFNVDTGN------CVAFAKDHNHYVQGVTWDPLNQYIIS 211

Query: 122 CSRDKSVWIWE 132
            S D+S+ I+E
Sbjct: 212 QSVDRSINIYE 222

>CAGL0A02772g complement(289274..290599) similar to sp|P40968
           Saccharomyces cerevisiae YDR364c CDC40, hypothetical
           start
          Length = 441

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 88/204 (43%), Gaps = 25/204 (12%)

Query: 69  NVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSV 128
           +++ +G  D TV +W     D+  + + L    GH   +K++ ++ D +   + S D+ V
Sbjct: 162 HLILSGGNDNTVKLW-----DFYHDRKCLRDFVGHSKPIKTLDFTSDSSQFLSGSYDQQV 216

Query: 129 WIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSS---YDDTVRIWAEQDDDWE 185
            IW+ +        N+    +S + +    +   + L+SS    YD  V   +E+D    
Sbjct: 217 KIWDTETGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSSSKIKHYDTRV---SEKDG--- 270

Query: 186 CAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETV--- 242
              V   H  ++    +     G +  S S+D T+RIW    +  ++  K+ I +T    
Sbjct: 271 LVQVYDHHLSSILAIKY--FPDGSKFISSSEDKTLRIW---NNQVNIPIKQ-ISDTTQHS 324

Query: 243 LP--AVHTRAVYSVSWSADGLIAS 264
           +P   +H    Y  + S D +I S
Sbjct: 325 MPYIGIHPEHNYFSTQSMDSVIYS 348

 Score = 32.7 bits (73), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 42/238 (17%), Positives = 86/238 (36%), Gaps = 44/238 (18%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGR 85
           L+ +G  D  +KL D  + +     D   H K ++++ +    +   +GS+D  V IW  
Sbjct: 163 LILSGGNDNTVKLWDFYHDRKCLR-DFVGHSKPIKTLDFTSDSSQFLSGSYDQQVKIWDT 221

Query: 86  D---------------------------------------DDDYSGETELLAVIEGHENE 106
           +                                       D   S +  L+ V + H + 
Sbjct: 222 ETGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSSSKIKHYDTRVSEKDGLVQVYDHHLSS 281

Query: 107 VKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLA 166
           + ++ +  DG+   + S DK++ IW  ++++   +  S   +HS  + +I  H      +
Sbjct: 282 ILAIKYFPDGSKFISSSEDKTLRIWN-NQVNIPIKQISDTTQHS--MPYIGIHPEHNYFS 338

Query: 167 SSSYDDTVRIWAEQDD-DWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           + S D  +  ++ +            GH    +      +  G  LCSG     + +W
Sbjct: 339 TQSMDSVIYSYSMKPKYKMHPNKKFKGHNSAGYGIGLTFSPDGRFLCSGDARGQLFLW 396

>CAGL0J03344g complement(322226..323857) highly similar to sp|P40055
           Saccharomyces cerevisiae YER082c, hypothetical start
          Length = 543

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 50/113 (44%), Gaps = 8/113 (7%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGR 85
           LLAT      +K  DV   ++V EL          S+   P   V+  G  + TV++W  
Sbjct: 193 LLATAGQTGWLKYHDVSTGQMVSELRTKL--GPTTSMTHNPWNAVMHLGHSNGTVTLWSP 250

Query: 86  DDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSE 138
                S    L+ ++ G    + SVA    G Y+AT S+DKS+ IW+     E
Sbjct: 251 -----SMPEPLVKLLSG-RGPINSVAVDRSGYYMATVSQDKSLKIWDIRNFKE 297

>Kwal_55.21144
          Length = 570

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 69/153 (45%), Gaps = 19/153 (12%)

Query: 101 EGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHA 160
           EGH +E+ ++A S DG Y+ T  RD+ + IW  + L+      +  ++   +V  +V+  
Sbjct: 230 EGHYDEILTLAASPDGKYVITGGRDRKLIIWSTESLAPVKVIPT--KDRRGEVLSLVFRK 287

Query: 161 SRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLC--SGSDDT 218
           +   L ++  D  +R ++   + +    +L GH   V       +  G+  C   GS D 
Sbjct: 288 NSDQLYAACADYKIRTYS--INQFSQLEILYGHQDLVVGI----SALGMERCVTVGSRDR 341

Query: 219 TVRIWRC-----LT----DDADVFDKEWIQETV 242
           T  +W+      LT    DD +   K WI++  
Sbjct: 342 TAMLWKIADETRLTFRGGDDPERLLKRWIKQNT 374

>AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH]
           (526057..527832) [1776 bp, 591 aa]
          Length = 591

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%)

Query: 92  GETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELS 137
           G        EGH +E+ +VA S DG Y+ T  RDK + +W  + L+
Sbjct: 243 GNQGFQNTTEGHYDEILTVAASPDGKYVVTGGRDKKLIVWSTESLA 288

>KLLA0D00814g complement(76687..77913) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2 subunit of the
           major yeast histone acetyltransferase, start by
           similarity
          Length = 408

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 57/122 (46%), Gaps = 13/122 (10%)

Query: 23  SKGLLATGSADRKIKLVDVRNFKLVEELDDTA-HKKAVRSVAWRPHCN-VLAAGSFDTTV 80
           S+ LLA    D  + L D+R  +L + L   A H+ +V S+ + PH + +L +   D  +
Sbjct: 269 SENLLAAAGTDSNVYLYDLR--RLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRI 326

Query: 81  SIW--------GRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVW-IW 131
            +W         + DD Y G  EL  +  GH + V   + + +  +L     +++V  IW
Sbjct: 327 IMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIW 386

Query: 132 EA 133
           + 
Sbjct: 387 KP 388

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 85/353 (24%), Positives = 138/353 (39%), Gaps = 73/353 (20%)

Query: 13  HGDRCWSVDISK--GLLATGS-ADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAW-RPHC 68
           HG+   ++D     G L + S  DR +K+ D+ +   V EL    H   V  +   + + 
Sbjct: 334 HGNSITALDFDTPWGTLCSSSYQDRIVKVWDLNHGIQVGEL--PGHLATVNCMQIDKKNY 391

Query: 69  NVLAAGSFDTTVSIWG--------RDDDDYSGETELLAV-----IEGHENEVKSVAWSHD 115
           N+L  GS D T+ +W          D      +TE +        E H++E+   A S D
Sbjct: 392 NMLITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEI--TALSFD 449

Query: 116 GAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASR---LL-------- 164
              L + SRDK ++ W+        + + +      D+K      +    LL        
Sbjct: 450 SEALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNGACLLGTEAPMIG 509

Query: 165 --------LASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSD 216
                   LA+ + D  VR+W  +    +   +L GH   +    F+      +L +GS 
Sbjct: 510 ALQCYNSALATGTKDGIVRLWDLR--VGKPVRLLEGHTDGITSLKFDSE----KLVTGSM 563

Query: 217 DTTVRIWRCLTD---DADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSD-GVLA 272
           D +VRIW   T    D   +D        LP          S   DG + +VG++ G + 
Sbjct: 564 DNSVRIWDLRTSSILDVIAYD--------LPV--------SSLDFDGKLITVGANEGGVN 607

Query: 273 VYKEVQAGRW---EVVARVDCAHTVYEINVVKWLALDGRVLLVTGGDDGCVNV 322
           V+   +   W   E    +D       I +VK+   DG   L+ G +DG +NV
Sbjct: 608 VFNMERDEHWMTPEPPHSLDGDELSRRIAIVKY--KDG--FLINGHNDGDINV 656

 Score = 36.2 bits (82), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 65/147 (44%), Gaps = 29/147 (19%)

Query: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELD---DTAH---KKAVR 60
           + + +LH D   ++      L +GS D+KI   D+   K +++LD      H   K   R
Sbjct: 433 IHNFELHKDEITALSFDSEALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPAR 492

Query: 61  SV---------------AWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHEN 105
           S+               A + + + LA G+ D  V +W    D   G+   + ++EGH +
Sbjct: 493 SLNNGACLLGTEAPMIGALQCYNSALATGTKDGIVRLW----DLRVGKP--VRLLEGHTD 546

Query: 106 EVKSVAWSHDGAYLATCSRDKSVWIWE 132
            + S+ +  D   L T S D SV IW+
Sbjct: 547 GITSLKF--DSEKLVTGSMDNSVRIWD 571

>Scas_693.36
          Length = 375

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 63/147 (42%), Gaps = 30/147 (20%)

Query: 14  GDRCWSVDISK---GLLATGSADRKIKLVDVRNFKL------VEELDDTAHKKAVRSVAW 64
           G    S D +K    +LAT   D  I++ D R          + E+ + AH  AVR V W
Sbjct: 229 GMEVLSADFNKYRPNVLATAGVDNSIRIWDFRMLVARDAAICINEIVN-AHDLAVRKVVW 287

Query: 65  RP-HCNVLAAGSFDTTVSIWGRDDDDY-------SGETELL--------AVIEGHENEVK 108
            P H ++L + S+D +  IW  +D  Y       +G+T  L         ++  H   V 
Sbjct: 288 SPHHSDILLSTSYDMSCKIW--NDLSYDPIQQRKTGKTNSLDFTGNGCRFIMNQHTEFVF 345

Query: 109 SVAWSHDG--AYLATCSRDKSVWIWEA 133
              WS  G   Y+A+   D +V+IW  
Sbjct: 346 GADWSMWGQPGYVASTGWDGNVFIWNG 372

 Score = 32.3 bits (72), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 59/135 (43%), Gaps = 20/135 (14%)

Query: 56  KKAVRSVAWRPH-CNVLAAGSFDTTVSIWGRDDDDYSGETELLA-----VIEGHENEVKS 109
           K  +    + PH  N+L   S D+  +I+   D  Y+ +   L+     V+    N+ + 
Sbjct: 184 KDCIYQSQFSPHDPNLLICCSGDSYTTIFDLRDP-YNTQRNFLSHAGMEVLSADFNKYRP 242

Query: 110 VAWSHDGAYLATCSRDKSVWIWEADELSEE---FECNSVLQEHSQDVKHIVW--HASRLL 164
                    LAT   D S+ IW+   L         N ++  H   V+ +VW  H S +L
Sbjct: 243 NV-------LATAGVDNSIRIWDFRMLVARDAAICINEIVNAHDLAVRKVVWSPHHSDIL 295

Query: 165 LASSSYDDTVRIWAE 179
           L S+SYD + +IW +
Sbjct: 296 L-STSYDMSCKIWND 309

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 144 SVLQEHSQDVKHIVWH-ASRLLLASSSYDDTVRIWAE 179
           ++  EH ++V    W+  ++ +  SSS+D TV+IW+ 
Sbjct: 98  AIFNEHKKEVMSCNWNLINKTMFTSSSWDGTVKIWSP 134

>CAGL0K00275g complement(25300..27447) similar to sp|P36037
           Saccharomyces cerevisiae YKL213c DOA1, hypothetical
           start
          Length = 715

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 88/216 (40%), Gaps = 35/216 (16%)

Query: 65  RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEV-KSVAWSHDGAYLATCS 123
           R    +L + S+D T  IW  +   Y         +  HE  V  S   S D   + T S
Sbjct: 109 RFQNGLLLSSSWDKTAKIWDNNKLKYD--------LRNHEASVWDSTMVSDD--IILTAS 158

Query: 124 RDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDD 183
            DKS+ +W   +L ++         H   ++H+ +  S  + AS S D T+++    + +
Sbjct: 159 ADKSIGVWMEGKLIKKLS-----NIHDDVIRHLEY-ISNDIFASCSNDGTIKLL---NLE 209

Query: 184 WECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVL 243
            E   V  GH   V+C           L S  +D+TVRIW          +    Q   +
Sbjct: 210 GEIKNVFEGHESFVYCV----KHMNNTLFSCGEDSTVRIWSI--------NGSTKQVIRI 257

Query: 244 PAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQA 279
           PAV   +V+++    +G      SD  + ++ E Q+
Sbjct: 258 PAV---SVWNLDLLPNGDFVICCSDNTIRIFTEDQS 290

 Score = 28.5 bits (62), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 43/222 (19%), Positives = 82/222 (36%), Gaps = 62/222 (27%)

Query: 95  ELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWE---------------------- 132
           +L A + GH  +VK +   +D   +A+ SRD S+ +W                       
Sbjct: 3   QLSATLRGHSQDVKDITAVNDNK-IASVSRDGSLRVWTRSSSGDWEDVLVYQSDKFLNAV 61

Query: 133 -------------ADELSEEFECNSVLQEHSQDVKHIVWHASRL--------LLASSSYD 171
                         D L        V+   +  +  +V H   +        LL SSS+D
Sbjct: 62  CYDKTSQTVYYGGQDTLINGSHIEDVIGSSADPMYTLVGHTGNVCGLRFQNGLLLSSSWD 121

Query: 172 DTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDAD 231
            T +IW    D+ +    L  H  +VW S     +    + + S D ++ +W        
Sbjct: 122 KTAKIW----DNNKLKYDLRNHEASVWDSTMVSDDI---ILTASADKSIGVW-------- 166

Query: 232 VFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAV 273
             + + I++  L  +H   +  + + ++ + AS  +DG + +
Sbjct: 167 -MEGKLIKK--LSNIHDDVIRHLEYISNDIFASCSNDGTIKL 205

>YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of the
           COPII coat of secretory pathway vesicles involved in
           endoplasmic reticulum to Golgi transport, associated
           with Sec13p, member of WD (WD-40) repeat family [3822
           bp, 1273 aa]
          Length = 1273

 Score = 38.5 bits (88), Expect = 0.008,   Method: Composition-based stats.
 Identities = 43/181 (23%), Positives = 80/181 (44%), Gaps = 14/181 (7%)

Query: 55  HKKAVRSVAWRP-HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHE----NEVKS 109
           H  +V++V +     NVLA+G  +  + IW  +    S  +    +  G      +EV S
Sbjct: 107 HSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKCTES-PSNYTPLTPGQSMSSVDEVIS 165

Query: 110 VAWSHDGAYL---ATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWH---ASRL 163
           +AW+   A++   A  S   S+W  +A +        S      Q +  + WH   ++R+
Sbjct: 166 LAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRV 225

Query: 164 LLASSSYDD-TVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRI 222
             A+ S +D ++ IW  ++ +     +  GH   +   D+   +  + L SG D+ TV +
Sbjct: 226 ATATGSDNDPSILIWDLRNANTPLQTLNQGHQKGILSLDWCHQDEHLLLSSGRDN-TVLL 284

Query: 223 W 223
           W
Sbjct: 285 W 285

 Score = 36.2 bits (82), Expect = 0.034,   Method: Composition-based stats.
 Identities = 34/133 (25%), Positives = 61/133 (45%), Gaps = 17/133 (12%)

Query: 18  WSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRS----VAWRPHCNV--- 70
           W+  ++    + GS++    + D++  K V  L  T+    ++     V W P  +    
Sbjct: 168 WNQSLAHVFASAGSSNFA-SIWDLKAKKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVA 226

Query: 71  LAAGS-FDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSH-DGAYLATCSRDKSV 128
            A GS  D ++ IW    D  +  T L  + +GH+  + S+ W H D   L +  RD +V
Sbjct: 227 TATGSDNDPSILIW----DLRNANTPLQTLNQGHQKGILSLDWCHQDEHLLLSSGRDNTV 282

Query: 129 WIW---EADELSE 138
            +W    A++LS+
Sbjct: 283 LLWNPESAEQLSQ 295

 Score = 30.8 bits (68), Expect = 2.0,   Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 46/104 (44%), Gaps = 5/104 (4%)

Query: 75  SFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEAD 134
           S D+++ +W     D       L V    +++   + WSH+   +A    + S+ ++  +
Sbjct: 37  STDSSLELWSLLAADSEKPIASLQV----DSKFNDLDWSHNNKIIAGALDNGSLELYSTN 92

Query: 135 ELSEEFECNSVLQEHSQDVKHIVWHASR-LLLASSSYDDTVRIW 177
           E +      +    HS  VK + ++A +  +LAS   +  + IW
Sbjct: 93  EANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIW 136

>YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein
           containing three WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           weak similarity to a region of S. pombe Cwf1p, which is
           a putative spliceosomal subunit and component of a 40S
           snRNP-containing complex [1254 bp, 417 aa]
          Length = 417

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 39/81 (48%), Gaps = 4/81 (4%)

Query: 147 QEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAE 206
           Q H  ++  + +  S   L SSS D  ++IW+ +  D      L GH  TV  +D    +
Sbjct: 133 QAHVSEITKLKFFPSGEALISSSQDMQLKIWSVK--DGSNPRTLIGHRATV--TDIAIID 188

Query: 207 TGIRLCSGSDDTTVRIWRCLT 227
            G  + S S D T+R+W C T
Sbjct: 189 RGRNVLSASLDGTIRLWECGT 209

 Score = 35.8 bits (81), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 46/103 (44%), Gaps = 8/103 (7%)

Query: 30  GSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDD 89
           G+ +  IK++D  NF L  E+D  AH   +  + + P    L + S D  + IW   D  
Sbjct: 112 GTTEGDIKVLD-SNFNLQREIDQ-AHVSEITKLKFFPSGEALISSSQDMQLKIWSVKDG- 168

Query: 90  YSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWE 132
            S    L+    GH   V  +A    G  + + S D ++ +WE
Sbjct: 169 -SNPRTLI----GHRATVTDIAIIDRGRNVLSASLDGTIRLWE 206

>YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component of
           U3 snoRNP (also called small subunit processome) which
           is required for 18S rRNA biogenesis, required for
           pre-rRNA processing [1722 bp, 573 aa]
          Length = 573

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (64%)

Query: 101 EGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELS 137
           EGH +E+ +VA S DG Y+ T  RD+ + +W  + LS
Sbjct: 233 EGHYDEILTVAASPDGKYVVTGGRDRKLIVWSTESLS 269

>Kwal_27.11126
          Length = 996

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 97/229 (42%), Gaps = 21/229 (9%)

Query: 103 HENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASR 162
           HE  +  V  S +G Y A+CS D+S+ +W+     +  +  S    H+  + ++++  + 
Sbjct: 180 HEGAIFFVTASKNGKYAASCSDDRSIKLWDL----KSGQLLSTAWGHTARIWNLLFFDND 235

Query: 163 LLLASSSYDDTVRIW-AEQDDDWECAAVLSGH-GGTVWCSDFERAETGIRLCSGSDD--- 217
             + S S D T R+W   +D+    A+V  GH   +VW  D +  E  I   SG+D    
Sbjct: 236 SKVISVSEDCTCRVWDISEDNTLSQASVHEGHLLKSVWGLDVDN-ERMIAATSGNDGRIK 294

Query: 218 -TTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKE 276
            T ++    + D+      E I+   +       +    W   GLIA      VL    E
Sbjct: 295 LTDLKAKSRVGDETMSSSLEDIEAAGVAMKPKEIIKGFHWFKFGLIAMTSEGQVLKF--E 352

Query: 277 VQAGRWEVVARVDCAHTVY-------EINVVKWLALDGRVLLVTGGDDG 318
             + +W  +   D   + Y       E+N++ + +    +L++   DDG
Sbjct: 353 QSSKKWSSILN-DSTFSNYSITAGLQELNLIVFCSSQCDLLVIKFNDDG 400

>Sklu_2435.13 YPR137W, Contig c2435 18346-20073
          Length = 575

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 90  YSGET--ELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELS 137
           ++ ET  E     EGH +E+ +VA S DG Y+ T  RD+ + +W  + LS
Sbjct: 222 FNPETTNEYENTTEGHYDEILTVAASPDGKYVVTGGRDRKLIVWSTESLS 271

>CAGL0L02761g complement(320826..322085) similar to sp|P18851
           Saccharomyces cerevisiae YOR212w STE4, hypothetical
           start
          Length = 419

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 96/236 (40%), Gaps = 36/236 (15%)

Query: 97  LAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHI 156
           + +++GH N++    WS D   + + S+D  + +W++    +     S +   SQ V   
Sbjct: 78  VGILKGHTNKIADFRWSRDSKLILSASQDGFMIVWDSLTGLKR----SAIPLDSQWVLTC 133

Query: 157 VWHASRLLLASSSYDDTVRIWAEQDD---DWECAAVLSGHGGTVWCSDFERAETGIRLCS 213
               S  L AS+  ++   I+             ++  GH G +   +F       R+ +
Sbjct: 134 ALSPSGALAASAGLNNNCTIYRMPRGSAVQQNVTSIFKGHTGYISGVEFVSES---RVVT 190

Query: 214 GSDDTTVRIWRCLTDDADVFDKEWIQETV--LPAVHTRAVYSVSWSADGLIASVGSDGVL 271
            S D T  +W       D+   + ++E    L  V   ++   + S + + AS GSDG  
Sbjct: 191 SSGDMTCALW-------DIPKAKRVREYSDHLGDVLAISIPVTNLSKNNMFASCGSDGYT 243

Query: 272 AVYKEVQAGRWEVVARVDCAHTVYEI-----NVVKWLALDGRVLLVTGGDDGCVNV 322
            +        W+V  R   A   + I     N +K+   DG  + V G DDG +++
Sbjct: 244 FI--------WDV--RSPSAVQQFSIGSCDSNCLKFFP-DGNSVAV-GNDDGTISL 287

>CAGL0G00704g 65805..67127 similar to sp|P39706 Saccharomyces
           cerevisiae YAR003w, hypothetical start
          Length = 440

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 47/97 (48%), Gaps = 5/97 (5%)

Query: 45  KLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHE 104
           KLV  L++  + + +    + P  + LA G  +  V I+  D D     T L + + GH 
Sbjct: 18  KLVHTLENPLNTECLE---FSPGGDYLALGCSNGAVIIY--DMDTLKPITMLGSKLGGHV 72

Query: 105 NEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFE 141
             V SV+WS  G YL T SRD  + +W+  +  E  +
Sbjct: 73  QAVNSVSWSGCGRYLITTSRDWFIKLWDLAKPGEPLK 109

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 56/118 (47%), Gaps = 15/118 (12%)

Query: 27  LATGSADRKIKLVDVR------NFKLVEELD-DTAHKKAVRSVAWRPHCNVLAAGSFDTT 79
           LAT SADR I+   ++      N  L  EL+ +  ++  +  + W  +C   +  S +  
Sbjct: 232 LATSSADRTIRQFSMKIGYSEDNENLSIELEQECKYQDVINKLQW--NCIFFSNNSAEYL 289

Query: 80  V-SIWGRDDDDY----SGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDK-SVWIW 131
           V S  G    +     +G   L+ V+EG E E+ +++W+ +   +A    +  S++IW
Sbjct: 290 VASAHGSSAHELYIWETGAGTLVRVLEGAEEELMNISWNFNNMCIACNGFETGSIYIW 347

 Score = 28.5 bits (62), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 31/68 (45%)

Query: 110 VAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSS 169
           + +S  G YLA    + +V I++ D L       S L  H Q V  + W      L ++S
Sbjct: 32  LEFSPGGDYLALGCSNGAVIIYDMDTLKPITMLGSKLGGHVQAVNSVSWSGCGRYLITTS 91

Query: 170 YDDTVRIW 177
            D  +++W
Sbjct: 92  RDWFIKLW 99

>YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing
           five WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has a region of low
           similarity to a region of S. cerevisiae Sec27p, which a
           coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles [3447 bp, 1148 aa]
          Length = 1148

 Score = 37.7 bits (86), Expect = 0.012,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 54/126 (42%), Gaps = 6/126 (4%)

Query: 99  VIEGHENEVKSVAWS-HDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIV 157
           V+ GH   +  + ++      LATCS D  V  W+       F   S  +  +  VK   
Sbjct: 109 VLHGHSRAITDINFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVK--- 165

Query: 158 WHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDD 217
           W+     + +SS+ + + +W  +       + L GH  +V   DF R +    + S S+D
Sbjct: 166 WNYKDPNVLASSHGNDIFVWDLRKGSTPLCS-LKGHVSSVNSIDFNRFKYS-EIMSSSND 223

Query: 218 TTVRIW 223
            TV+ W
Sbjct: 224 GTVKFW 229

>CAGL0L09647g 1032740..1034029 highly similar to sp|P35184
           Saccharomyces cerevisiae YIR012w SQT1, start by
           similarity
          Length = 429

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 51/243 (20%), Positives = 99/243 (40%), Gaps = 41/243 (16%)

Query: 55  HKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSH 114
           H  +V  VA  P   ++A+G  D  + +W      +S   +    + GH   V +  ++ 
Sbjct: 63  HTDSVFVVAHHPSLPLVASGGADNVIHLW----TSHSQPPKFAGTLSGHTESVIAAHFTP 118

Query: 115 DGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVW---HAS-RLLLASSSY 170
           DG +L +      + +  + +   +++  S LQE    V+ I+W   H       A  + 
Sbjct: 119 DGKFLVSADMTGKLLVHASVKGGAQWKLVSELQE----VEEIIWLKVHPKVSGAFALGAT 174

Query: 171 DDTVRIWAEQDDDWECAA----VLSGHGGTVWCS-----DFERAET--GIRLCSGSDDTT 219
           D +V  W  Q +    +A    ++SG      C+     + E++E    + L + S D++
Sbjct: 175 DGSV--WCYQINGEGASATVEQLMSGFSHQSECTMGEFINIEKSEELGTLDLVTCSLDSS 232

Query: 220 VRIWRCLTDDADV---------FDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGV 270
           +  W C T   +           +  WI  +V P   T+          G++A   ++GV
Sbjct: 233 IVSWNCYTGQVNFKIAQPELKGMECPWISLSVAPVEMTKG-------NGGILACGSNNGV 285

Query: 271 LAV 273
           +A+
Sbjct: 286 IAI 288

 Score = 33.5 bits (75), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 6/77 (7%)

Query: 132 EADELSEEFECN------SVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWE 185
           E  E+ E  E +      +   +H+  V  +  H S  L+AS   D+ + +W       +
Sbjct: 40  EGGEVEETIEVDLSNNSRTYFDKHTDSVFVVAHHPSLPLVASGGADNVIHLWTSHSQPPK 99

Query: 186 CAAVLSGHGGTVWCSDF 202
            A  LSGH  +V  + F
Sbjct: 100 FAGTLSGHTESVIAAHF 116

>Scas_649.10
          Length = 806

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 2/42 (4%)

Query: 186 CAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLT 227
           C+ + +GH G +     +   +G+ L +GSDD TVR+W  LT
Sbjct: 429 CSTIFAGHKGKIRTLSID--PSGLWLATGSDDGTVRVWEILT 468

>Kwal_55.21450
          Length = 503

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 55/258 (21%), Positives = 101/258 (39%), Gaps = 50/258 (19%)

Query: 26  LLATGSADRKIKLVDV-RNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIW- 83
           L  +   D ++K+ D+ R+ +L+   D   H KAVR +++    +   + SFD  + IW 
Sbjct: 225 LCLSAGNDNQVKIWDLYRDRELLR--DYRGHSKAVRGISFNSEGSEFLSVSFDQQIKIWD 282

Query: 84  ---GRDDDDYS-----------------------------------GETELLAVIEGHEN 105
              G+    YS                                    +  L+ V + H +
Sbjct: 283 TETGKVRHQYSYSCIPNCAEFRPSNSNEFIVGLSNSEIRHYDLRTSHKNGLVQVYDHHLS 342

Query: 106 EVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLL 165
            + ++ +  DG+   + S DKS+ IWE ++++   +  S   ++S  + +I  H  +   
Sbjct: 343 SIIALKYFPDGSKFVSSSEDKSMRIWE-NQINIPIKQISDTSQYS--MPYIGIHPEQNYF 399

Query: 166 ASSSYDDTVRIWAEQDD-DWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW- 223
           A+ S D+ +  ++ +           SGH    +   F  +  G  + SG     V IW 
Sbjct: 400 AAQSMDNAIYAFSMKPKYKRHPKKHFSGHKCAGFGIGFGFSPDGQYIASGDTRGRVYIWD 459

Query: 224 ---RCLTDDADVFDKEWI 238
                L    DV DK+ I
Sbjct: 460 WKTTHLLKHFDVPDKKTI 477

 Score = 35.4 bits (80), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 8/84 (9%)

Query: 53  TAHKKAVRSVAWRPHCN--VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSV 110
             HK    S+   P      L+AG+ D  V IW     D   + ELL    GH   V+ +
Sbjct: 207 PGHKNGTNSILLLPKSGHLCLSAGN-DNQVKIW-----DLYRDRELLRDYRGHSKAVRGI 260

Query: 111 AWSHDGAYLATCSRDKSVWIWEAD 134
           +++ +G+   + S D+ + IW+ +
Sbjct: 261 SFNSEGSEFLSVSFDQQIKIWDTE 284

 Score = 28.5 bits (62), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 38/84 (45%), Gaps = 4/84 (4%)

Query: 95  ELLAVIEGHENEVKSVAWSHDGAYLA-TCSRDKSVWIWEADELSEEFECNSVLQEHSQDV 153
           +L+    GH+N   S+       +L  +   D  V IW+   L  + E     + HS+ V
Sbjct: 201 KLIHTYPGHKNGTNSILLLPKSGHLCLSAGNDNQVKIWD---LYRDRELLRDYRGHSKAV 257

Query: 154 KHIVWHASRLLLASSSYDDTVRIW 177
           + I +++      S S+D  ++IW
Sbjct: 258 RGISFNSEGSEFLSVSFDQQIKIW 281

>Scas_692.25
          Length = 488

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 58/126 (46%), Gaps = 23/126 (18%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDT-AHKKAVRSV-----------AWRPHCNVLAA 73
           ++  G+ + K+   D+ N+ L   LD T AH K + S+              P   ++A 
Sbjct: 150 IIFIGTDNGKLYAYDIFNYSL--PLDSTQAHIKGITSIDAIMEFKNNNKTEEPSA-IIAT 206

Query: 74  GSFDTTVSI--WGRDDDDYSGETELLAVIEGHENEVKSVAWSH--DGAYLATCSRDKSVW 129
            S D ++ +  W   ++ +     L  V+  HE+ V  V      +  YLA+CSRD S+ 
Sbjct: 207 SSKDLSIKLFRWSAKENKFL----LFRVLMNHEHIVSEVKLFRKLNNIYLASCSRDTSIR 262

Query: 130 IWEADE 135
           IW A++
Sbjct: 263 IWTAED 268

 Score = 35.0 bits (79), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 57/135 (42%), Gaps = 16/135 (11%)

Query: 92  GETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQ 151
           G T + A++E   N           A +AT S+D S+ ++       +F    VL  H  
Sbjct: 181 GITSIDAIMEFKNNN----KTEEPSAIIATSSKDLSIKLFRWSAKENKFLLFRVLMNHEH 236

Query: 152 DVKHI--VWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVW--CSDFERAET 207
            V  +      + + LAS S D ++RIW  +D       + S H    W  C D     +
Sbjct: 237 IVSEVKLFRKLNNIYLASCSRDTSIRIWTAEDG----MILNSFHPHNEWVRCLDV----S 288

Query: 208 GIRLCSGSDDTTVRI 222
           G  + SGS D ++R+
Sbjct: 289 GDFVLSGSQDASLRL 303

 Score = 32.3 bits (72), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 164 LLASSSYDDTVRI--WAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVR 221
           ++A+SS D ++++  W+ +++ +    VL  H   V      R    I L S S DT++R
Sbjct: 203 IIATSSKDLSIKLFRWSAKENKFLLFRVLMNHEHIVSEVKLFRKLNNIYLASCSRDTSIR 262

Query: 222 IW 223
           IW
Sbjct: 263 IW 264

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 43/100 (43%), Gaps = 18/100 (18%)

Query: 118 YLATCSRDKSVWIWE-------------ADELSEEFECNSVLQEHSQDVKHIVWHASRLL 164
           Y A+ SRD+ + IWE              +  +  F+C   L+ H+  VK +    + L 
Sbjct: 361 YCASASRDRLIKIWEIPTPRFVMHRPPVPNSSNSNFKCIMTLKGHASWVKDLRIRGNYLF 420

Query: 165 LASSSYDDTVRIWAEQDDDWECAAVLSG-HGGTVWCSDFE 203
             S S D T+R W  ++   EC    +  H G V C D +
Sbjct: 421 --SCSDDKTIRCWNLENG--ECVKQWTDLHSGFVTCLDMD 456

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 93/244 (38%), Gaps = 59/244 (24%)

Query: 25  GLLATGSADRKIKLV----DVRNFKLVEELDDTAHKKAVRSVA-WRPHCNV-LAAGSFDT 78
            ++AT S D  IKL         F L   L +  H+  V  V  +R   N+ LA+ S DT
Sbjct: 202 AIIATSSKDLSIKLFRWSAKENKFLLFRVLMN--HEHIVSEVKLFRKLNNIYLASCSRDT 259

Query: 79  TVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWI--WEADE- 135
           ++ IW  +D        +L     H   V+ +  S  G ++ + S+D S+ +  W +   
Sbjct: 260 SIRIWTAEDG------MILNSFHPHNEWVRCLDVS--GDFVLSGSQDASLRLTHWPSGNG 311

Query: 136 ----LSEEFECNSV-----LQEHSQDVKHIVWHASRLLL------------ASSSYDDTV 174
               +  EF   SV     L  + +    I +    L +            AS+S D  +
Sbjct: 312 LSIGIGHEFPIESVKFILPLSTNEKASPTINYLRKPLEIDSDYEKMSFKYCASASRDRLI 371

Query: 175 RIWA---------------EQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTT 219
           +IW                  + +++C   L GH    W  D      G  L S SDD T
Sbjct: 372 KIWEIPTPRFVMHRPPVPNSSNSNFKCIMTLKGHAS--WVKDLRIR--GNYLFSCSDDKT 427

Query: 220 VRIW 223
           +R W
Sbjct: 428 IRCW 431

>Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement
          Length = 263

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 68/167 (40%), Gaps = 24/167 (14%)

Query: 12  LHGDRCWSVDISKGLLATGSAD-RKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNV 70
           L    CW  DI  G L+    D      VD ++ KL E             + + P  N+
Sbjct: 42  LENVNCW--DIKTGELSKILTDGLPPGAVDAKSTKLAES----------TYLQYHPETNL 89

Query: 71  LAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWI 130
           LA G  D  + IW     D   +T L+    GH++ +  + +   G  L + S+D  + I
Sbjct: 90  LAVGYADGVIKIW-----DLISKTVLIN-FNGHKSAITVLRFDPTGTRLISGSKDSDIII 143

Query: 131 WEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIW 177
           W   +L  E      L+ H   +  I W  +   L S+S D  ++IW
Sbjct: 144 W---DLVGEVGLYK-LRSHKDSITGI-WCENEDWLISTSKDGLIKIW 185

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 10/72 (13%)

Query: 155 HIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVL---SGHGGTVWCSDFERAETGIRL 211
           ++ +H    LLA    D  ++IW     D     VL   +GH   +    F+   TG RL
Sbjct: 80  YLQYHPETNLLAVGYADGVIKIW-----DLISKTVLINFNGHKSAITVLRFD--PTGTRL 132

Query: 212 CSGSDDTTVRIW 223
            SGS D+ + IW
Sbjct: 133 ISGSKDSDIIIW 144

>Scas_680.11
          Length = 347

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 6/86 (6%)

Query: 145 VLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFER 204
           VL  H + +  + ++    LL S S D+   +W   +   E    L+GH GT+W  D ++
Sbjct: 5   VLMGHERPLTQVKYNREGDLLFSCSKDNFASVWYSVNG--ERLGTLNGHAGTIWSIDVDK 62

Query: 205 AETGIRLC-SGSDDTTVRIWRCLTDD 229
                  C +GS D ++++W+  T +
Sbjct: 63  F---TEYCVTGSADYSIKMWKVETGE 85

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 6/81 (7%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
            H++ +  V +    ++L + S D   S+W      YS   E L  + GH   + S+   
Sbjct: 8   GHERPLTQVKYNREGDLLFSCSKDNFASVW------YSVNGERLGTLNGHAGTIWSIDVD 61

Query: 114 HDGAYLATCSRDKSVWIWEAD 134
               Y  T S D S+ +W+ +
Sbjct: 62  KFTEYCVTGSADYSIKMWKVE 82

>Scas_652.7
          Length = 380

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 50/114 (43%), Gaps = 11/114 (9%)

Query: 210 RLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDG 269
           R+ + S D    +W  L+D +        + T++     RA  SVSW+ +G   +VGS  
Sbjct: 76  RIVTCSQDRNAYVWEPLSDGS-------YKPTLVLLRINRAATSVSWAPNGYKFAVGSSA 128

Query: 270 -VLAVYKEVQAGRWEVVARVDCAHTVYEINVVKWLALDGRVLLVTGGDDGCVNV 322
            ++AV    Q   W V   +        IN + W   +  VLL  GG DG + V
Sbjct: 129 RIIAVCYYEQENNWWVSKHIK-KPIKSTINCLSW--HENGVLLAAGGTDGFIRV 179

>Scas_657.13
          Length = 411

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 66/294 (22%), Positives = 130/294 (44%), Gaps = 39/294 (13%)

Query: 3   NLHLVRSLKLHGD--RCWSVDISKGLLATGSADRKIKLVDVRNFK---LVEELDDTAHKK 57
           N+ +++  K   +  R   +  +  L+AT +   K+ L D    K   LV   +   HK+
Sbjct: 116 NIKIIKKFKHEEEITRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFE--YHKE 173

Query: 58  AVRSVAWRPHCN---VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSH 114
               +++  +CN    L +GS D T+++W  ++   S  + +      H + V    WS+
Sbjct: 174 NGYGLSF--NCNDAGKLLSGSDDGTIALWNVNN---SNSSPIYVWSSVHSDIVNDCKWSN 228

Query: 115 -DGAYLATCSRDKSVWIW---EADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSY 170
            D     + S D ++ +    E D  + +F+ ++     +   KH     S+ L A++  
Sbjct: 229 FDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFS-KH-----SQYLFAAAGT 282

Query: 171 DDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW------- 223
           D  V ++  +D      + ++GH G V   +F   + GI + SG D   + IW       
Sbjct: 283 DSHVYLFDRRDISRPLHS-MAGHDGAVTNMEFSPDQDGILMTSGEDRRAI-IWDICDIGV 340

Query: 224 RCLTDDADVFDKEWIQETVLPAVHTRAV--YSVSWSADGLIASVGSDGVLAVYK 275
             + DDA+    E +   ++ A H  A+  +S++ +   L+AS   + ++ V+K
Sbjct: 341 EQIPDDAEDGAPEVL---MIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWK 391

 Score = 28.5 bits (62), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 42/103 (40%), Gaps = 15/103 (14%)

Query: 191 SGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRA 250
           +G+G +  C+D        +L SGSDD T+ +W     ++           V  +VH+  
Sbjct: 174 NGYGLSFNCND------AGKLLSGSDDGTIALWNVNNSNSSPI-------YVWSSVHSDI 220

Query: 251 VYSVSWSADGL--IASVGSDGVLAVYKEVQAGRWEVVARVDCA 291
           V    WS   L    SV  D  L ++ + +   +    +VD  
Sbjct: 221 VNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAP 263

>Scas_705.2
          Length = 571

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%)

Query: 101 EGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELS 137
           EGH +E+ +VA S DG Y+ T  RD+ + +W  + L+
Sbjct: 231 EGHYDEILTVAASPDGKYVVTGGRDRKLIVWSTESLA 267

>ACL034W [1015] [Homologous to ScYER082C (KRE31) - SH]
           complement(302396..304048) [1653 bp, 550 aa]
          Length = 550

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 46/113 (40%), Gaps = 8/113 (7%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGR 85
           LLAT      +K  DV   +LV EL          S+A  P   V+  G  + TV++W  
Sbjct: 202 LLATAGQTGFLKYQDVSTGQLVAELRTKL--GPTSSMAQNPWNAVMHLGHNNGTVTLWAP 259

Query: 86  DDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSE 138
           +          LA I      V  VA    G Y+AT   DKS+ +W+     E
Sbjct: 260 N------MPTPLARILTARGPVTGVAVDRQGYYMATTGADKSMRLWDIRNFKE 306

>ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH]
           (567357..569840) [2484 bp, 827 aa]
          Length = 827

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 2/42 (4%)

Query: 186 CAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLT 227
           C+ V +GH G +     +   +G+ L +GSDD TVR+W  LT
Sbjct: 455 CSTVYAGHKGKIRTLSID--PSGLWLATGSDDGTVRVWEILT 494

 Score = 28.9 bits (63), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 37/67 (55%), Gaps = 2/67 (2%)

Query: 98  AVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQD--VKH 155
            V  GH+ ++++++    G +LAT S D +V +WE     E ++   V  +++QD  ++ 
Sbjct: 457 TVYAGHKGKIRTLSIDPSGLWLATGSDDGTVRVWEILTGREVYKATIVDIKNNQDDHIET 516

Query: 156 IVWHASR 162
           + W+  +
Sbjct: 517 VEWNPDK 523

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 37.0 bits (84), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 90/220 (40%), Gaps = 59/220 (26%)

Query: 95  ELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADE---------LSEEF----- 140
           +L A ++GHE +VKSV   +D + +A+CSRD +V +W  ++          SE+F     
Sbjct: 3   KLSADLKGHEQDVKSVVAIND-SQVASCSRDGTVRVWSNNDGVWNGVIAHNSEKFINSLC 61

Query: 141 --ECNSVLQEHSQD----------------VKHIVWHASRL--------LLASSSYDDTV 174
             + + +L    QD                V  ++ H   +         + SSS+D T 
Sbjct: 62  YDKSSQLLFYGGQDTLVGGISPLATTDEDPVYMLIGHKGNVCSLSSKNNFVISSSWDKTA 121

Query: 175 RIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFD 234
           ++W      ++    L GH  +VW + F   +      + S D T+++W           
Sbjct: 122 KVWHNGSAIYD----LVGHSASVWDAKFLPEKD--FFLTASADCTIKLWH---------G 166

Query: 235 KEWIQETVLPAVHTRAVYSVSWSADG-LIASVGSDGVLAV 273
            + I+      +H   +  +  S DG   AS  +DG + +
Sbjct: 167 NKLIK--TFSGIHKDVIRHLDISPDGETFASCSNDGTVKI 204

 Score = 32.0 bits (71), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 72/177 (40%), Gaps = 27/177 (15%)

Query: 51  DDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEG-HENEVKS 109
           D   H  +V    + P  +     S D T+ +W  +        +L+    G H++ ++ 
Sbjct: 132 DLVGHSASVWDAKFLPEKDFFLTASADCTIKLWHGN--------KLIKTFSGIHKDVIRH 183

Query: 110 VAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLL---LA 166
           +  S DG   A+CS D +V I + D         ++L+  +   +  V+    L    L 
Sbjct: 184 LDISPDGETFASCSNDGTVKINDMD--------GNILKTFTGH-ESFVYSVKFLPNGDLV 234

Query: 167 SSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           S   D +VR+W++         VL     ++W  D +    G  L  GS D  VRI+
Sbjct: 235 SCGEDRSVRVWSKTG---AVKQVLRLPAVSIW--DLDILPNGDILV-GSSDNMVRIF 285

 Score = 29.6 bits (65), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 140 FECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWE 185
           ++ ++ L+ H QDVK +V   +   +AS S D TVR+W+  D  W 
Sbjct: 2   YKLSADLKGHEQDVKSVV-AINDSQVASCSRDGTVRVWSNNDGVWN 46

>KLLA0F21406g complement(1996260..1998377) similar to sp|P47025
           Saccharomyces cerevisiae YJL112w MDV1, start by
           similarity
          Length = 705

 Score = 36.6 bits (83), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 93/233 (39%), Gaps = 44/233 (18%)

Query: 13  HGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCN--- 69
           H D   ++      L +GS DR ++  D+ + K  + +D +     +RS    P  N   
Sbjct: 493 HVDEITAISFDGDNLVSGSQDRTVRQWDLNSGKCTQTIDISFATGPMRSQRNIPLRNSVL 552

Query: 70  ----------------VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWS 113
                            LA G+ D  V +W    D  SG  +++ ++EGH + + S+ + 
Sbjct: 553 LTKEPPAIGALQCFDAALATGTKDGIVRLW----DLRSG--KVVRMLEGHTDAITSLQF- 605

Query: 114 HDGAYLATCSRDKSVWIWEADE--LSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYD 171
            D   L T + D+S+ IW+     LS+ F     +     D+  IV          S+ +
Sbjct: 606 -DSVNLVTGAMDRSIRIWDLRTGILSDVFAYEQPITSLHFDLDKIVI---------SNNE 655

Query: 172 DTVRIWAEQD-DDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
            TV+I+  +D + W C       G      DF R + G  L  G  +  +  W
Sbjct: 656 PTVKIYNRKDGNHWFCGEDDPEQGNV----DFVRYKHGY-LVEGRSNGDINTW 703

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 53/123 (43%), Gaps = 22/123 (17%)

Query: 66  PHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAY--LATCS 123
           P   + +AGS D +V +W     D S + + +A + GH   + S++      Y  L T  
Sbjct: 408 PFGTMCSAGSLDHSVKVW-----DLSKKKQ-IATLHGH---LASISCMQIDQYSTLITGG 458

Query: 124 RDKSVWIWE-----ADELSEEFE----CNSVLQEHSQDVKHIVWHASRLLLASSSYDDTV 174
           RD  + +W+     ADE S   E    C      H  ++  I +    L+  S S D TV
Sbjct: 459 RDAVLKLWDIDKAMADEASNSSEDNDACLYTFDSHVDEITAISFDGDNLV--SGSQDRTV 516

Query: 175 RIW 177
           R W
Sbjct: 517 RQW 519

 Score = 28.9 bits (63), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 5/85 (5%)

Query: 6   LVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWR 65
           +VR L+ H D   S+      L TG+ DR I++ D+R   L    D  A+++ + S+ + 
Sbjct: 589 VVRMLEGHTDAITSLQFDSVNLVTGAMDRSIRIWDLRTGILS---DVFAYEQPITSLHF- 644

Query: 66  PHCNVLAAGSFDTTVSIWGRDDDDY 90
              + +   + + TV I+ R D ++
Sbjct: 645 -DLDKIVISNNEPTVKIYNRKDGNH 668

>Kwal_26.7655
          Length = 743

 Score = 36.6 bits (83), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 44/90 (48%), Gaps = 6/90 (6%)

Query: 145 VLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFER 204
           + QEH+QD+  + W  +  +L ++S D T R+W     D   A  +  H   V C+ F  
Sbjct: 267 IYQEHTQDILDLDWSKNGFIL-TTSMDKTARLW---HCDRPKALKVFTHPDFVTCAKFHP 322

Query: 205 AETGIRLCSGSDDTTVRIWRCLTDDADVFD 234
            +      SG  D T+R+W  L D++  FD
Sbjct: 323 NDDRF-FISGCLDHTLRLWSIL-DNSVSFD 350

>CAGL0K03377g complement(306529..309465) similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 978

 Score = 36.6 bits (83), Expect = 0.024,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 244 PAVHTRAVYSVSWSADGLIASVGS-DGVLAVYK--EVQAGRWEVVARVDCAH 292
           PA +T+A++S  +S DG   + GS DGVL ++K       RW + + +D AH
Sbjct: 300 PAKNTKAIWSTKFSIDGKYMATGSRDGVLRLWKVLSTPVERWGLDSSIDSAH 351

>Kwal_27.12667
          Length = 721

 Score = 36.6 bits (83), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 85/208 (40%), Gaps = 44/208 (21%)

Query: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAV-----RS 61
           V +   H D   ++      L +GS DR I+  D+   K ++ +D     +       + 
Sbjct: 495 VHTFDAHVDEITALHFEGNSLVSGSQDRTIRQWDLTTGKCLQTIDINFANRGTSGGFSKI 554

Query: 62  VAWRPHCNVL-------------------AAGSFDTTVSIWGRDDDDYSGETELLAVIEG 102
            +  P  ++L                   A G+ D  V +W    D  SG+  ++  +EG
Sbjct: 555 SSNNPRSSILLTHNDPPVIGALQCYDAAMATGTKDGLVRLW----DLRSGQ--VIRTLEG 608

Query: 103 HENEVKSVAWSHDGAYLATCSRDKSVWIWEADE--LSEEFECNSVLQEHSQDVKHIVWHA 160
           H + V  + +  D   L T S D+S+ IW+     L++ F  NS +     D++HI+   
Sbjct: 609 HTDAVTGLQF--DSVNLVTGSLDRSIRIWDLRTGLLADAFAYNSPISSLQFDLEHILV-- 664

Query: 161 SRLLLASSSYDDTVRIWAEQDDD-WECA 187
                  S+ +  V+++  ++D  W C 
Sbjct: 665 -------SNNESVVQVYNRKEDQHWTCG 685

>KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces
           cerevisiae YML102w CAC2 chromatin assembly complex,
           subunit p60, start by similarity
          Length = 493

 Score = 36.6 bits (83), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 43/99 (43%), Gaps = 10/99 (10%)

Query: 53  TAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAW 112
           +A    +  ++W P    +A  S D TV ++  D     G       I  H + V+ + W
Sbjct: 132 SASNAEIYDISWNPQGTCIAIASLDNTVRVFNVDQGKVVGH------ITEHNHYVQGIVW 185

Query: 113 SHDGAYLATCSRDKSV----WIWEADELSEEFECNSVLQ 147
              G ++ + S D+S+     I+E +E+      N +L+
Sbjct: 186 DPQGEFIVSQSADRSLAICKMIYEDNEVKGLQLVNKILK 224

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 74/184 (40%), Gaps = 39/184 (21%)

Query: 77  DTTVSIWGRDDDDYSGETE---LLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEA 133
           D  + +W  ++ +  G+ E    L+ +  HE  V    ++  G  LAT   D  + +W+ 
Sbjct: 41  DNKIRVWQLNESENDGKIETIDFLSSLTQHEQAVNVCRFNKQGDTLATAGDDGLLLLWKK 100

Query: 134 DE-LSEEFECNSVLQEHSQDVKH--------------------IVWHASRLLLASSSYDD 172
           +E + +EF    V  +  QD K                     I W+     +A +S D+
Sbjct: 101 NETMVKEF---GVDDDEFQDFKESWAVWKRLRSGSASNAEIYDISWNPQGTCIAIASLDN 157

Query: 173 TVRIWAEQDDDWECAAVLSGHG----GTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTD 228
           TVR++    D  +    ++ H     G VW         G  + S S D ++ I + + +
Sbjct: 158 TVRVF--NVDQGKVVGHITEHNHYVQGIVW------DPQGEFIVSQSADRSLAICKMIYE 209

Query: 229 DADV 232
           D +V
Sbjct: 210 DNEV 213

>Scas_692.29
          Length = 456

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 17/89 (19%)

Query: 150 SQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGI 209
           SQD K I+         ++SYD  +R W   +   +     SGH G +    F    +  
Sbjct: 112 SQDKKAII---------TASYDGVIRTW---NLSGKVQKQYSGHSGPIRAVKFI---SDT 156

Query: 210 RLCSGSDDTTVRIWRCLTDDADV--FDKE 236
           RL S  +D T+R+W+   +D+ V  FD+E
Sbjct: 157 RLVSAGNDRTLRLWKTKNNDSVVQHFDEE 185

 Score = 28.9 bits (63), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 58/124 (46%), Gaps = 26/124 (20%)

Query: 71  LAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWI 130
           +   S+D  +  W     + SG+ +      GH   +++V +  D   L +   D+++ +
Sbjct: 118 IITASYDGVIRTW-----NLSGKVQ--KQYSGHSGPIRAVKFISD-TRLVSAGNDRTLRL 169

Query: 131 WEA---DELSEEF-----ECN-------SVLQEHSQDVKHI-VWHASRLLLASSSYDDTV 174
           W+    D + + F     E N       ++L+ H   V  + V + SR+L  SSSYD+++
Sbjct: 170 WKTKNNDSVVQHFDEEDEEANIEDGKTLAILEGHKAPVVSLDVSNTSRIL--SSSYDNSI 227

Query: 175 RIWA 178
            +W+
Sbjct: 228 GLWS 231

>KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces
           cerevisiae YDL195w SEC31 component of the COPII coat of
           ER-golgi vesicles, start by similarity
          Length = 1231

 Score = 36.6 bits (83), Expect = 0.027,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 95/223 (42%), Gaps = 24/223 (10%)

Query: 15  DRCWSVD--ISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRP-HCNVL 71
           D  WS D  I  G L  G     ++  D +  K V ++    H+  V+++ +     NVL
Sbjct: 67  DLDWSGDDKIIAGALENGV----VEFFDPKALKSVAKIHK--HQGPVKTLKFNAKQNNVL 120

Query: 72  AAGSFDTTVSIWGRDDDDYSGETELLAVIEGHEN----EVKSVAWSHDGAYL---ATCSR 124
            +G     + +W   D +  G ++      G  N    EV S++W+   A++   A+ S 
Sbjct: 121 VSGGTQGEIFVW---DSNKIGSSDYSPFSAGISNTPIDEVSSLSWNQSLAHVFASASSSG 177

Query: 125 DKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWH-ASRLLLASSSYDDT---VRIWAEQ 180
             SVW  +A +       +S        +  + WH  S  ++A++S  DT   V  W  +
Sbjct: 178 YASVWDLKAKKQVLHLNHSSSTTGIKVPLTVVDWHPTSSTIIATASSSDTEPLVLTWDLR 237

Query: 181 DDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
           +       +  GH   V   D+ + +  + L SG D+T+V +W
Sbjct: 238 NAHVPLKVLSQGHSKGVLSLDWCKQDENLLLSSGRDNTSV-LW 279

>AGR242C [4553] [Homologous to ScYIR012W (SQT1) - SH]
           (1203152..1204411) [1260 bp, 419 aa]
          Length = 419

 Score = 36.2 bits (82), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 70/180 (38%), Gaps = 23/180 (12%)

Query: 55  HKKAVRSVAWRPHCNVLAAGSFDTTVSIWG--RDDDDYSGETELLAVIEGHENEVKSVAW 112
           H  +V +VA  P   ++ +G  D    +W   R+    +G  E       H   V   A+
Sbjct: 59  HTDSVFTVAAHPKLPLVVSGGGDNKAHLWTTHREPPREAGSVE-------HSESVIGAAF 111

Query: 113 SHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVW---HASRL-LLASS 168
           + DG YL T   +  V +  A    +E+   + LQE    V  + W   H  R  + A  
Sbjct: 112 TADGRYLVTADMNGQVRVQVAARQGQEWRPAAELQE----VDEVTWLKVHPHRAGIFAIG 167

Query: 169 SYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTD 228
           + D +V  W  + D      VL   G     +  +    G+ L + +DD  V +  C  D
Sbjct: 168 AVDGSV--WCYEMDTQNNTPVLLMTG----VAHAQDCTMGVFLETAADDENVILVTCSLD 221

>CAGL0B00748g 65727..68165 similar to sp|P25569 Saccharomyces
           cerevisiae YCL039w, hypothetical start
          Length = 812

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 43/80 (53%), Gaps = 7/80 (8%)

Query: 103 HENEVKSVAWSHDGAYLATCS----RDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVW 158
           H +EV  + +S DG YLA+ S     D+ ++I+   ++  +F+   +L  +SQ + ++ +
Sbjct: 353 HSDEVWYLQFSPDGRYLASVSADATTDRKIYIY---DVQNDFQVYKILSGNSQCILYLSF 409

Query: 159 HASRLLLASSSYDDTVRIWA 178
                LL S  ++  V I++
Sbjct: 410 SPDSKLLVSCPFNAIVNIYS 429

>YER082C (UTP7) [1514] chr5 complement(324268..325932) Component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, has one WD (WD-40)
           domain [1665 bp, 554 aa]
          Length = 554

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 42/97 (43%), Gaps = 8/97 (8%)

Query: 36  IKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETE 95
           +K  DV   +LV EL   A      ++A  P   V+  G  + TVS+W           E
Sbjct: 214 LKYHDVSTGQLVSELRTKA--GPTMAMAQNPWNAVMHLGHSNGTVSLWS------PSMPE 265

Query: 96  LLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWE 132
            L  +      V S+A    G Y+AT   D+S+ IW+
Sbjct: 266 PLVKLLSARGPVNSIAIDRSGYYMATTGADRSMKIWD 302

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 1   MPNLHLVRSLKLHGD-RCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELD 51
           MP   LV+ L   G     ++D S   +AT  ADR +K+ D+RNFK +  ++
Sbjct: 263 MPEP-LVKLLSARGPVNSIAIDRSGYYMATTGADRSMKIWDIRNFKQLHSVE 313

>Kwal_56.22345
          Length = 396

 Score = 35.8 bits (81), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 57/122 (46%), Gaps = 13/122 (10%)

Query: 23  SKGLLATGSADRKIKLVDVRNFKLVEELDD-TAHKKAVRSVAWRPHCN-VLAAGSFDTTV 80
           S  L A    D  + L D R  K  E L   + H++AV S+ +  H + +L +G  D  V
Sbjct: 258 SSNLFAAAGTDAMVYLFDSR--KPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRV 315

Query: 81  SIW--------GRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYL-ATCSRDKSVWIW 131
            +W         +++D   G  ELL +  GH++ +   ++S +  +L A+   +  V IW
Sbjct: 316 LLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIW 375

Query: 132 EA 133
           + 
Sbjct: 376 KP 377

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 87/209 (41%), Gaps = 23/209 (11%)

Query: 77  DTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSH-DGAYLATCSRDKSVWIWEADE 135
           D +++IW    D  SG+T   +V   H + V    W   D     + S D  + I   D+
Sbjct: 181 DGSIAIW----DIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMI--HDK 234

Query: 136 LSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGG 195
            SE+     +LQ+   +      H+S L  A+ +  D +    +     E    +SGH  
Sbjct: 235 RSEK-PLQKLLQKEPFNTIAFSKHSSNLFAAAGT--DAMVYLFDSRKPTEALHSMSGHQE 291

Query: 196 TVWCSDFERAETGIRLCSGSDDTTVRIWRCLT-------DDADVFDKEWIQETVLPAVHT 248
            V   +F   + GI    GS D  V +W           +DAD    E +   ++ A H 
Sbjct: 292 AVTSLEFAHHKDGILCSGGS-DRRVLLWDLFQIGTEQQEEDADDGGPELL---MMHAGHK 347

Query: 249 RAVYSVSWSADG--LIASVGSDGVLAVYK 275
            A+   S+S +   L+ASV  + ++ ++K
Sbjct: 348 SAINDFSFSPNVPWLMASVEEENIVQIWK 376

>CAGL0C01441g complement(156930..159947) similar to tr|Q08924
           Saccharomyces cerevisiae YPL183c, start by similarity
          Length = 1005

 Score = 36.2 bits (82), Expect = 0.036,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 4/83 (4%)

Query: 95  ELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVK 154
           EL+  + GHE  +  +  S     +A+CS D+S+ +W+  E  +E    S+   H+  + 
Sbjct: 170 ELIHNLTGHEGSIFYIQSSEHNKLIASCSDDRSIRLWDR-ETGKEL---SIGWSHTARIW 225

Query: 155 HIVWHASRLLLASSSYDDTVRIW 177
           ++ +  +   L S S D T R+W
Sbjct: 226 NLKFFNNDENLVSVSEDCTCRVW 248

 Score = 32.3 bits (72), Expect = 0.64,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 57/132 (43%), Gaps = 13/132 (9%)

Query: 146 LQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLS---GHGGTVWCSDF 202
           L  H   + +I       L+AS S D ++R+W     D E    LS    H   +W   F
Sbjct: 175 LTGHEGSIFYIQSSEHNKLIASCSDDRSIRLW-----DRETGKELSIGWSHTARIWNLKF 229

Query: 203 ERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADG-L 261
              +    L S S+D T R+W  + +D   ++ +     +      + V+ V  + +  +
Sbjct: 230 FNNDEN--LVSVSEDCTCRVWNIIPNDISGYELQI--SNIFEGHLLKNVWGVDVNDEKRI 285

Query: 262 IASVGSDGVLAV 273
           IA+ G+DG + V
Sbjct: 286 IATSGNDGRINV 297

 Score = 29.3 bits (64), Expect = 5.2,   Method: Composition-based stats.
 Identities = 32/137 (23%), Positives = 64/137 (46%), Gaps = 18/137 (13%)

Query: 190 LSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTR 249
           L+GH G+++    + +E    + S SDD ++R+W          D+E  +E  +   HT 
Sbjct: 175 LTGHEGSIFY--IQSSEHNKLIASCSDDRSIRLW----------DRETGKELSIGWSHTA 222

Query: 250 AVYSVSW-SADGLIASVGSDGVLAVYKEVQ---AGRWEVVARVDCAHTVYEINVVKWLAL 305
            ++++ + + D  + SV  D    V+  +    +G    ++ +   H +   NV      
Sbjct: 223 RIWNLKFFNNDENLVSVSEDCTCRVWNIIPNDISGYELQISNIFEGHLLK--NVWGVDVN 280

Query: 306 DGRVLLVTGGDDGCVNV 322
           D + ++ T G+DG +NV
Sbjct: 281 DEKRIIATSGNDGRINV 297

>Kwal_26.8975
          Length = 445

 Score = 35.8 bits (81), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 47/105 (44%), Gaps = 12/105 (11%)

Query: 165 LASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWR 224
           + S SYD  VR W   +   +     +GH G V    +    +  RL SG++D T+R+W+
Sbjct: 115 IVSGSYDGIVRTW---NLSGKVEKQYAGHSGAVRAVKYI---SSTRLVSGANDRTLRLWK 168

Query: 225 CLTDD------ADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIA 263
              D+      A+  D E  +   +   H   V +V  S D +I+
Sbjct: 169 TKNDELKNNLAAEEDDVEEGKTLAILEAHKAPVVTVDVSGDRIIS 213

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 54/115 (46%), Gaps = 5/115 (4%)

Query: 26  LLATGSADRKIKLVDVR--NFKLVEELDDTAHKKAVRSVAWRPHCN-VLAAGSFDTTVSI 82
           LLA GS+ R I L D R  +   + +     HK  V ++   P    +L +GS D TV +
Sbjct: 329 LLACGSSARHITLHDPRVGSSTKITQQQLNGHKNFVVALDTCPEMEYMLCSGSHDGTVKV 388

Query: 83  WG-RDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADEL 136
           W  R        T    V++G  ++V  V W+  G  + +  +DK + I + D++
Sbjct: 389 WDVRSSAPMYTITREAEVVKGINDKVFDVKWAK-GLGIISGGQDKKIQINKGDDI 442

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 73/184 (39%), Gaps = 27/184 (14%)

Query: 54  AHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSG----------ETELLAVIEGH 103
            H  AVR+V +      L +G+ D T+ +W   +D+             E + LA++E H
Sbjct: 139 GHSGAVRAVKYISSTR-LVSGANDRTLRLWKTKNDELKNNLAAEEDDVEEGKTLAILEAH 197

Query: 104 ENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRL 163
           +  V +V  S  G  + + S D S+  W  +   +E      +     +V        RL
Sbjct: 198 KAPVVTVDVS--GDRIISGSYDNSIGFWSTNH--KEMTAVDPMDALGSNVSSAAKKRRRL 253

Query: 164 LLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223
            L     D +VR  +         A+L  H   V    F+ A+  +   S S D T++ W
Sbjct: 254 ALK----DGSVRRRSP-------LALLESHTAPVEEVLFDFADKTVGY-SVSQDHTIKTW 301

Query: 224 RCLT 227
             +T
Sbjct: 302 DLVT 305

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 55/257 (21%), Positives = 92/257 (35%), Gaps = 72/257 (28%)

Query: 22  ISKGLLATGSADRKIKLVDVRNFKLVEEL----DDTAHKK--AVRSVAWRPHCNV----- 70
           IS   L +G+ DR ++L   +N +L   L    DD    K  A+      P   V     
Sbjct: 150 ISSTRLVSGANDRTLRLWKTKNDELKNNLAAEEDDVEEGKTLAILEAHKAPVVTVDVSGD 209

Query: 71  -LAAGSFDTTVSIWGRDDDDYSGETEL-----------------------------LAVI 100
            + +GS+D ++  W  +  + +    +                             LA++
Sbjct: 210 RIISGSYDNSIGFWSTNHKEMTAVDPMDALGSNVSSAAKKRRRLALKDGSVRRRSPLALL 269

Query: 101 EGHENEVKSVAWSH-DGAYLATCSRDKSVWIWE------ADELSEEFECNSVLQEHSQDV 153
           E H   V+ V +   D     + S+D ++  W+       D  S  +   S+ Q    ++
Sbjct: 270 ESHTAPVEEVLFDFADKTVGYSVSQDHTIKTWDLVTARCVDTKSTSYSLLSLAQLPQLNL 329

Query: 154 -------KHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAE 206
                  +HI  H  R+         + +I  +Q         L+GH   V   D    E
Sbjct: 330 LACGSSARHITLHDPRV-------GSSTKITQQQ---------LNGHKNFVVALD-TCPE 372

Query: 207 TGIRLCSGSDDTTVRIW 223
               LCSGS D TV++W
Sbjct: 373 MEYMLCSGSHDGTVKVW 389

>Sklu_2092.4 YMR131C, Contig c2092 3964-5526
          Length = 520

 Score = 35.8 bits (81), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 81/194 (41%), Gaps = 21/194 (10%)

Query: 7   VRSLKLHGD-----RCWSVDISKGLLATGSADRKIKLVDVRNFKLV--EELDDTAHKKAV 59
           + ++K HG+       WS  I  G L TG    ++ L      K +  +E    A+ ++V
Sbjct: 274 IHTIKSHGNVEGYALDWSPLIKTGALLTGDCSGQVYLTQRHTSKWISDKEPFTVANNQSV 333

Query: 60  RSVAW-RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAY 118
             + W R    V A+   D  + +W    D  S + +    ++    +V  ++WS    Y
Sbjct: 334 EDIQWSRTESTVFASCGCDGYIRVW----DTRSKKHKPAISVKASNTDVNVISWSEKIGY 389

Query: 119 LATCSRDKSVW-IWEADELSEEFECNS--VLQE--HSQDVKHIVWHA-SRLLLASSSYDD 172
           L     D   W +W+  + S     N+  V Q   H   +  I ++     ++A +S D+
Sbjct: 390 LLASGDDNGTWGVWDLRQFSPSNSNNTSPVAQYDFHKGAITSISFNPLDESIVAVASEDN 449

Query: 173 TVRIW---AEQDDD 183
           TV +W    E DD+
Sbjct: 450 TVTLWDLSVEADDE 463

>Sklu_2438.4 YER082C, Contig c2438 8089-9810 reverse complement
          Length = 573

 Score = 35.8 bits (81), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 49/113 (43%), Gaps = 8/113 (7%)

Query: 26  LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGR 85
           LLAT      +K  DV   +LV EL          ++A  P   V+  G  + TV++W  
Sbjct: 224 LLATAGQTGWLKYQDVSTGQLVAELRTKL--GPTTAMAQNPWNAVMHLGHSNGTVTLWAP 281

Query: 86  DDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVWIWEADELSE 138
           +       T L+ ++      + SVA    G Y+AT   DKS+ IW+     E
Sbjct: 282 N-----MPTPLVRLLSA-RGPITSVAIDRQGYYMATTGADKSMKIWDIRNFRE 328

>Sklu_2167.5 YGL213C, Contig c2167 8275-9186
          Length = 303

 Score = 35.0 bits (79), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 55/131 (41%), Gaps = 17/131 (12%)

Query: 19  SVDIS-KGLLATGSADRKIKLVDVRNFKLVEELDDTA------HKKAVRSVAWRPHCNVL 71
           SVD+S  GL+ATG +D  + +  +R  + +   +         +   VR V + P   +L
Sbjct: 95  SVDVSSNGLIATGFSDGSVVVAQLRTLRPIYNFEGFGIQGIEENSSTVRDVKFSPLGGLL 154

Query: 72  AAGSFDTTVSIWGRDDDDYSGETELLAVIE----------GHENEVKSVAWSHDGAYLAT 121
           A  +   +       + +Y      L V             H+  V S++++  G +LA+
Sbjct: 155 AVANDSGSYGCVTLYETEYGERVGNLTVPTHSAQTSVGSFAHDGWVFSLSFNSTGEFLAS 214

Query: 122 CSRDKSVWIWE 132
           C  D  V +W+
Sbjct: 215 CGYDSKVRVWD 225

>KLLA0E24354g complement(2163651..2164829) similar to sgd|S0006021
           Saccharomyces cerevisiae YPL100w, start by similarity
          Length = 392

 Score = 35.4 bits (80), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 46/94 (48%), Gaps = 16/94 (17%)

Query: 200 SDFERAET----GIRLCSGSDDTTVRIWRCLT---------DDADVFDK-EWIQETVLPA 245
           S F  +E     G+R+   +D+ ++  +   +         +D  VFD  + IQ  VLPA
Sbjct: 140 SKFRNSEAVGDIGVRVSLSTDNNSILCYSSYSKSDKENAPLNDIVVFDALKCIQINVLPA 199

Query: 246 VHTRAVYSVSWSADGLIASVGSDG--VLAVYKEV 277
           VH   +  ++ S DG++ +  S+   ++ V+K +
Sbjct: 200 VHQSNIVCIACSPDGMLMATASEKGTIIRVFKTI 233

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,233,852
Number of extensions: 470563
Number of successful extensions: 4018
Number of sequences better than 10.0: 422
Number of HSP's gapped: 2681
Number of HSP's successfully gapped: 1087
Length of query: 322
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 220
Effective length of database: 13,065,073
Effective search space: 2874316060
Effective search space used: 2874316060
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)