Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR090C36635918280.0
YOR037W (CYC2)3663727761e-101
KLLA0E21901g3573197751e-101
Kwal_55.215613493037691e-100
Scas_699.413183025978e-75
CAGL0I00990g3432945553e-68
KLLA0D04488g2962731063e-05
CAGL0E06424g2982481002e-04
YML087C312116810.036
ACR054C306275770.11
KLLA0F27621g281231760.16
Sklu_2184.2310133740.33
KLLA0C16918g310107730.34
Sklu_2260.235062720.57
YIL043C (CBR1)32268710.79
AFR439C31039700.90
Kwal_47.18159287138691.0
Scas_692.631439691.3
ADL087W28762663.1
YKL150W (MCR1)302363653.7
CAGL0B02519g31233627.7
Kwal_33.1426030839629.3
Scas_700.9262786110.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR090C
         (359 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR090C [1137] [Homologous to ScYOR037W (CYC2) - SH] (519431..52...   708   0.0  
YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c mitoch...   303   e-101
KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces...   303   e-101
Kwal_55.21561                                                         300   e-100
Scas_699.41                                                           234   8e-75
CAGL0I00990g complement(81437..82468) similar to sp|P38909 Sacch...   218   3e-68
KLLA0D04488g complement(381861..382751) similar to sp|P36060 Sac...    45   3e-05
CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces c...    43   2e-04
YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein ...    36   0.036
ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH] (454023..45...    34   0.11 
KLLA0F27621g complement(2560055..2560900) similar to sp|P38626 S...    34   0.16 
Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement         33   0.33 
KLLA0C16918g 1478540..1479472 similar to sp|Q12746 Saccharomyces...    33   0.34 
Sklu_2260.2 YIL043C, Contig c2260 2185-3237                            32   0.57 
YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome...    32   0.79 
AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH] (1...    32   0.90 
Kwal_47.18159                                                          31   1.0  
Scas_692.6                                                             31   1.3  
ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH] complement(...    30   3.1  
YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5 ...    30   3.7  
CAGL0B02519g 240486..241424 highly similar to sp|Q12746 Saccharo...    28   7.7  
Kwal_33.14260                                                          28   9.3  
Scas_700.9                                                             28   10.0 

>ACR090C [1137] [Homologous to ScYOR037W (CYC2) - SH]
           (519431..520531) [1101 bp, 366 aa]
          Length = 366

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/359 (96%), Positives = 345/359 (96%)

Query: 1   MLWKSNGSFVIQRTISSMLWKRFYNSCSKANVQRRAPGRLPLVLCGVTALGAGCAAAEYH 60
           MLWKSNGSFVIQRTISSMLWKRFYNSCSKANVQRRAPGRLPLVLCGVTALGAGCAAAEYH
Sbjct: 1   MLWKSNGSFVIQRTISSMLWKRFYNSCSKANVQRRAPGRLPLVLCGVTALGAGCAAAEYH 60

Query: 61  RRNYHAELSQEYFTKYKISYRKDIDIDHYLLELTPLKQQRNNIWALFGARNLWAVEIKQP 120
           RRNYHAELSQEYFTKYKISYRKDIDIDHYLLELTPLKQQRNNIWALFGARNLWAVEIKQP
Sbjct: 61  RRNYHAELSQEYFTKYKISYRKDIDIDHYLLELTPLKQQRNNIWALFGARNLWAVEIKQP 120

Query: 121 EIMVVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPKGHIV 180
           EIMVVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPKGHIV
Sbjct: 121 EIMVVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPKGHIV 180

Query: 181 EVRGPYPEFEFPELDADTKRDREFSXXXXXXXXXXXXXXPFDIALFAAGTGIVTALQLLT 240
           EVRGPYPEFEFPELDADTKRDREFS              PFDIALFAAGTGIVTALQLLT
Sbjct: 181 EVRGPYPEFEFPELDADTKRDREFSGRGRACVAAAARAGPFDIALFAAGTGIVTALQLLT 240

Query: 241 TEDPFKGKIQLFYSCKSWGQLGPLGDLLRRCAQHDRVDLHVFESEKGESLRLGLSKISDL 300
           TEDPFKGKIQLFYSCKSWGQLGPLGDLLRRCAQHDRVDLHVFESEKGESLRLGLSKISDL
Sbjct: 241 TEDPFKGKIQLFYSCKSWGQLGPLGDLLRRCAQHDRVDLHVFESEKGESLRLGLSKISDL 300

Query: 301 VSGPFPFSENAPFEQRPKAEPVLSLVCGPDDYIAFIAGPRHGLSQGPVTGLLGTKGWDN 359
           VSGPFPFSENAPFEQRPKAEPVLSLVCGPDDYIAFIAGPRHGLSQGPVTGLLGTKGWDN
Sbjct: 301 VSGPFPFSENAPFEQRPKAEPVLSLVCGPDDYIAFIAGPRHGLSQGPVTGLLGTKGWDN 359

>YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c
           mitochondrial import factor, primarily involved in
           import of Cyc1p and also involved in import of Cyc7p
           [1101 bp, 366 aa]
          Length = 366

 Score =  303 bits (776), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 163/372 (43%), Positives = 230/372 (61%), Gaps = 26/372 (6%)

Query: 1   MLWKSNGSFVIQRTISSMLWKRFYNSCSKANVQRRAPGRLPLVLCGVTALGAGCAAAEY- 59
           MLWK+   +V+    SS + +R + S  K++  +        +   +  +GA  +   Y 
Sbjct: 1   MLWKN---YVLS---SSRITRRLHKSPRKSSFSKNF-----FITGCLLTVGAVSSYLTYR 49

Query: 60  ---HRRNYHAELSQEYFTKYKISYRKDIDIDHYLLELTPLKQQRNNIWALFGARNLWAVE 116
               R N H ELS  YF KYKIS+++DID  H+LLE+TPL +Q+ NIW+L  A NLW+VE
Sbjct: 50  YTSERENKH-ELSPSYFVKYKISHKRDIDSSHFLLEVTPLFKQKVNIWSLMTAENLWSVE 108

Query: 117 IKQPEIMVVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPK 176
           IKQPE+MVVR YTPLPL  +   +++  L+DGDN  GKL  YIK+Y +GEVARWL  LPK
Sbjct: 109 IKQPEVMVVRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPK 168

Query: 177 GHIVEVRGPYPEFEFPELDADTKRDREF-------SXXXXXXXXXXXXXXPFDIALFAAG 229
           GHI+E+RGP+ ++EFP L  + KR R+                       P+DI +F AG
Sbjct: 169 GHIIEIRGPFIDYEFPHLPNELKRSRDCLYMDNRNERGNNVRENSQFIYQPYDIMMFTAG 228

Query: 230 TGIVTALQLLTTEDPFKGKIQLFYSCKSWGQLGPLGDLLRRCAQHDRVDLHVFESEKGES 289
           TGIVTALQLL TE PF+G I+LF++ K+  QLGPL  +L R    +RV L +FE+++ ++
Sbjct: 229 TGIVTALQLLLTESPFRGTIKLFHTDKNIKQLGPLYPILLRLQASNRVQLKIFETDR-QT 287

Query: 290 LRLGLSKISDLVSGPFPFSENAPFE--QRPKAEPVLSLVCGPDDYIAFIAGPRHGLSQGP 347
            +  L  I   ++ P+P+    PF         PVL+LVCGP+ YI+ I+G ++ L+QGP
Sbjct: 288 KQDVLKSIQKSITKPYPYKGLLPFSNVNNKNIMPVLALVCGPESYISSISGRKYDLNQGP 347

Query: 348 VTGLLGTKGWDN 359
           V GLL  +GW++
Sbjct: 348 VGGLLSKEGWNS 359

>KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces
           cerevisiae YOR037w CYC2 cytochrome-c mitochondrial
           import factor singleton, hypothetical start
          Length = 357

 Score =  303 bits (775), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 201/319 (63%), Gaps = 4/319 (1%)

Query: 42  LVLCGVTALGAGCAAAEYHRRNYHAELSQEYFTKYKISYRKDIDIDHYLLELTPLKQQRN 101
           L+L G  A+GA  +   Y    Y  ELS++YF+KYKIS +  ID DHYL+ELTPLK Q+ 
Sbjct: 35  LLLSGSVAIGA-LSWNYYKESLYQRELSRDYFSKYKISKKYSIDQDHYLIELTPLKAQKV 93

Query: 102 NIWALFGARNLWAVEIKQPEIMVVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKE 161
           N+W    +  LW+VE+KQPEIMVVR YTPLPL  +E+G  +  LRD +N  G L  YIK+
Sbjct: 94  NLWKEMNSSKLWSVEVKQPEIMVVRSYTPLPLTIEENG-AVEVLRDEENASGALTFYIKQ 152

Query: 162 YGSGEVARWLRKLPKGHIVEVRGPYPEFEFPELDADTKRDREFSXXXXXXXXXXXXXXPF 221
           Y  GEVARW+  LP GH++E+RGP+ E+EFP+   +  RDR F               PF
Sbjct: 153 YKQGEVARWINHLPLGHVLELRGPFVEYEFPDTADEITRDRSFLWGNEDCVKDNYKYQPF 212

Query: 222 DIALFAAGTGIVTALQLLTTEDPFKGKIQLFYSCKSWGQLGPLGDLLRRCAQHDRVDLHV 281
           DI  F  GTGIV  LQ+  TE PF+GKI  ++SCKS  +LGPL  +L +   +DR++LH 
Sbjct: 213 DILFFTGGTGIVPLLQMTLTESPFRGKIGAYHSCKSLTELGPLNSILTKLQDNDRIELHT 272

Query: 282 FESEKGESLRLGLSKISDLVSGPFPFSENAPFEQ-RPKAEPVLSLVCGPDDYIAFIAGPR 340
            ES +  S+ L      + +  P+P+  N PF     K  PVLSLVCGP  +I+ ++GP+
Sbjct: 273 HESNR-ISIPLQSDPAMEGIPSPYPYGGNEPFTSLDSKVRPVLSLVCGPGGFISTVSGPK 331

Query: 341 HGLSQGPVTGLLGTKGWDN 359
           + L QGP+ G+L  +GWDN
Sbjct: 332 YDLVQGPIKGILAARGWDN 350

>Kwal_55.21561
          Length = 349

 Score =  300 bits (769), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 149/303 (49%), Positives = 203/303 (66%), Gaps = 4/303 (1%)

Query: 59  YHRRNYHA--ELSQEYFTKYKISYRKDIDIDHYLLELTPLKQQRNNIWALFGARNLWAVE 116
           ++ + YH+  ELSQEYFT+Y+ISY + ID +H++LELTP++ Q  N+WAL  +  LW+V+
Sbjct: 42  WYYKKYHSNVELSQEYFTQYRISYNQKIDSEHFILELTPIRPQSTNMWALMKSDKLWSVQ 101

Query: 117 IKQPEIMVVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPK 176
           +KQPEIMVVR YTPLPL     GE  + L DGDNG GKL  Y+K+Y  GEVARWL +LP+
Sbjct: 102 VKQPEIMVVRNYTPLPLQHVGSGE-FKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPE 160

Query: 177 GHIVEVRGPYPEFEFPELDADTKRDREFSXXXXXXXXXXXXXXPFDIALFAAGTGIVTAL 236
           GHI+E+RGPY ++EFP +D   K DR F               PFDI+ F AGTGI   +
Sbjct: 161 GHILELRGPYIDYEFPSMDNGEKLDRSF-LWGAKPSSDKLMIQPFDISAFTAGTGIAPIM 219

Query: 237 QLLTTEDPFKGKIQLFYSCKSWGQLGPLGDLLRRCAQHDRVDLHVFESEKGESLRLGLSK 296
           QLL TE PF+G+I LF+SC+   +LGPLG +L    +++RV+L+ FES KG  +R   ++
Sbjct: 220 QLLLTEFPFRGRIHLFHSCRQKSELGPLGPILDVLRENNRVELNFFESSKGRDIRQISNE 279

Query: 297 ISDLVSGPFPFSENAPFEQRPKAEPVLSLVCGPDDYIAFIAGPRHGLSQGPVTGLLGTKG 356
           + +L+  P  + +          +PVLSL+CGPD YI  I+GP++   QGP+ GLLG KG
Sbjct: 280 VLNLIDSPSQYLKRPFTGFEGPIKPVLSLICGPDSYITTISGPKYDHFQGPIEGLLGQKG 339

Query: 357 WDN 359
           W N
Sbjct: 340 WSN 342

>Scas_699.41
          Length = 318

 Score =  234 bits (597), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 131/302 (43%), Positives = 177/302 (58%), Gaps = 35/302 (11%)

Query: 61  RRNYHAELSQEYFTKYKISYRKDIDIDHYLLELTPLKQQRNNIWALFGARNLWAVEIKQP 120
           R     ELS  +FT YKISYR+DID  HYLLELTP   Q+ NIW       +W+VEIKQP
Sbjct: 38  RTPSRTELSPTHFTPYKISYRQDIDASHYLLELTPSNPQKTNIWEQIPRNVIWSVEIKQP 97

Query: 121 EIMVVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPKGHIV 180
           EIMVVR YTP+PL   +D   L  + D  N  GKL+ Y+K+Y +GEVARWL +LP    V
Sbjct: 98  EIMVVRNYTPVPLSFVQDHNDLIPMTD-KNDTGKLVFYLKQYSNGEVARWLHRLPVNSTV 156

Query: 181 EVRGPYPEFEFPELDADTKRDREFSXXXXXXXXXXXXXXPFDIALFAAGTGIVTALQLL- 239
           E+RGP+ +++F E D +TK                     FD+++F AG G+VTA QLL 
Sbjct: 157 EIRGPFIDYKFQETD-NTK---------------------FDVSMFTAGAGVVTAFQLLL 194

Query: 240 --TTEDPFKGKIQLFYSCKSWGQLGPLGDLLRRCAQHDR--VDLHVFESEKGESLRLGLS 295
             ++++ F+G ++LF+SC S  +LGPL  ++    QHD   +D+  FESEKG+ +R  L 
Sbjct: 195 SPSSKNDFRGSVRLFHSCGSLNELGPLKKIMFSL-QHDNGPIDMKFFESEKGDDIRTQLK 253

Query: 296 KISDLVSGPFPFSENAPFEQRPKAEPVLSLVCGPDDYIAFIAGPRHGLSQGPVTGLLGTK 355
            +S L      F +  P +        L+LVCGP+ +I  +AG    L QGPV G+L   
Sbjct: 254 SVSQL------FPQFKPSQLGRSNLRQLALVCGPEGFIDTVAGASVDLEQGPVGGILKQN 307

Query: 356 GW 357
           GW
Sbjct: 308 GW 309

>CAGL0I00990g complement(81437..82468) similar to sp|P38909
           Saccharomyces cerevisiae YOR037w CYC2, hypothetical
           start
          Length = 343

 Score =  218 bits (555), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 123/294 (41%), Positives = 168/294 (57%), Gaps = 21/294 (7%)

Query: 67  ELSQEYFTKYKISYRKDIDIDHYLLELTPLKQQRNNIWALFGARNLWAVEIKQPEIMVVR 126
           ELS   FT+YKI+ R DID  HYL+ELTPLK+Q  N+W       LW++E+KQPEIMVVR
Sbjct: 63  ELSPNDFTEYKITRRHDIDNCHYLIELTPLKRQNVNLWKELERNILWSIEVKQPEIMVVR 122

Query: 127 QYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPKGHIVEVRGPY 186
            YTPLPL    +G  +    +      KL+ YIK Y +GEVARW++ LP G  +E+RGP+
Sbjct: 123 NYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELRGPF 182

Query: 187 PEFEFPELDADTKRDREFSXXXXXXXXXXXXXXPFDIALFAAGTGIVTALQ-LLTTEDPF 245
            +++F    +   RD   S                ++  FA GTGIVTALQ +L     F
Sbjct: 183 IDYKFRNDLSKHHRDANGSTLINKTQLS-------NVPFFAGGTGIVTALQPILNPYGQF 235

Query: 246 KGKIQLFYSCKSWGQLGPLGDLLRRCAQHDRVDLHVFESEKGESLRLGLSKISDLVSGPF 305
              + LF+SCKS  +LG L  L+   AQ +++  H+FE+ KG++    +     L+ G  
Sbjct: 236 NYNMTLFHSCKSIQELGCLYHLVNGLAQQNKITYHLFETSKGDN----IIDFKQLIPG-- 289

Query: 306 PFSENAPFEQRPKAEPVLSLVCGPDDYIAFIAGPRHGLSQGPVTGLLGTKGWDN 359
           P + NA            S+VCGP+ YI  +AG ++  SQGP+ GLLG KGWDN
Sbjct: 290 PNTSNA-------GNLDTSIVCGPEGYITTVAGAKYDTSQGPIEGLLGEKGWDN 336

>KLLA0D04488g complement(381861..382751) similar to sp|P36060
           Saccharomyces cerevisiae YKL150w MCR1 cytochrome-b5
           reductase, start by similarity
          Length = 296

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 102/273 (37%), Gaps = 71/273 (26%)

Query: 99  QRNNIWALFGARNLWAVEIKQPEIMVVRQYTPLPLVADEDGEQLRALRDGDNGG-GKLML 157
           +++ +  L  A  + A  +      V+R YTP+                 DNG  GK+ L
Sbjct: 73  KKDQVSGLITASCILAKFVTPKGSNVIRPYTPV----------------SDNGTKGKMEL 116

Query: 158 YIKEYGSGEVARWLRKLPKGHIVEVRGPYPEFEFPELDADTKRDREFSXXXXXXXXXXXX 217
            +K Y +G+    L  L +   V  +GP  ++E+     D+                   
Sbjct: 117 VVKHYENGKFTSHLFGLKENDTVSFKGPITKWEWKPNSYDS------------------- 157

Query: 218 XXPFDIALFAAGTGIVTALQLL--TTEDPFKG-KIQLFYSCKSWGQL---GPLGDLLRRC 271
                I L  AGTGI    QL+    E+P    KI L+Y  K+   +     L +L ++ 
Sbjct: 158 -----ITLLGAGTGINPLYQLVHHIAENPEDNTKIHLYYGNKTPEDILLKSELDNLQKKY 212

Query: 272 AQHDRVDLHV------FESEKGESLRLGLSKISDLVSGPFPFSENAPFEQRPKAEPVLSL 325
               ++   V      FE E G   +  LS        P P  +N  F            
Sbjct: 213 PDQVKITYFVDKAEGNFEGETGFITKDYLSH-----QAPKPSEKNQVF------------ 255

Query: 326 VCGPDDYIAFIAGPRHG-LSQGPVTGLLGTKGW 357
           VCGP  ++   +GP+     QG +TG+L   G+
Sbjct: 256 VCGPPPFMKAYSGPKVSPQDQGELTGILAELGY 288

>CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces
           cerevisiae YKL150w MCR1 cytochrome-b5 reductase, start
           by similarity
          Length = 298

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 94/248 (37%), Gaps = 70/248 (28%)

Query: 124 VVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPKGHIVEVR 183
           V+R YTP+  ++++               G +   IK Y  G++   L +L     +  +
Sbjct: 99  VIRPYTPVSDLSEK---------------GYIEFVIKHYEGGKMTDHLFQLKPKDTLAFQ 143

Query: 184 GPYPEFEFPELDADTKRDREFSXXXXXXXXXXXXXXPFDIALFAAGTGIVTALQL---LT 240
           GP P++++     DT                        I L   GTGI    QL   +T
Sbjct: 144 GPIPKWQWKPNSFDT------------------------ITLLGGGTGITPLYQLVHHIT 179

Query: 241 TEDPFKGKIQLFYSCKSWGQL---GPLGDLLRRCAQH-------DRVDLHVFESEKGESL 290
                K KI LFY  K+   +     L DL ++  +        D+ D   F+  KG   
Sbjct: 180 QNKEDKTKINLFYGSKTPSDILLKKELDDLQKKYPEQLNIQYFVDKDDTGKFDGNKGFIT 239

Query: 291 RLGLSKISDLVSGPFPFSENAPFEQRPKAEPVLSLVCGPDDYIAFIAGPRHG-LSQGPVT 349
           +  L+K             NAP    PK E     VCGP  ++  ++G +   + QG +T
Sbjct: 240 KDFLAK-------------NAP---GPK-EKTQVFVCGPPPFMDSLSGQKKSPMEQGDLT 282

Query: 350 GLLGTKGW 357
           G L   G+
Sbjct: 283 GALKDLGY 290

>YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein
           containing an oxidoreductase FAD-binding domain and an
           oxidoreductase FAD or NAD-binding domain, has moderate
           similarity to cytochrome b5 reductase (S. cerevisiae
           Cbr1p), which converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+) [939 bp, 312 aa]
          Length = 312

 Score = 35.8 bits (81), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 45/116 (38%), Gaps = 39/116 (33%)

Query: 124 VVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPKGHIVEVR 183
           +VR YTP+               +  N  G L L +K Y  G V+++  KL     VE +
Sbjct: 120 LVRYYTPV---------------NVPNTEGHLELVVKTYKHGVVSKYFDKLKIRQYVEFK 164

Query: 184 GPYPEFEFPELDADTKRDREFSXXXXXXXXXXXXXXPFDIALFAAGTGIVTALQLL 239
           GP  E E+   D DT                       ++ + A G+GI   LQ+L
Sbjct: 165 GPLGELEY---DQDTAT---------------------ELGIIAGGSGITPVLQVL 196

>ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH]
           (454023..454943) [921 bp, 306 aa]
          Length = 306

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 102/275 (37%), Gaps = 77/275 (28%)

Query: 100 RNNIWALFGARNLWAVEIKQPEIMVVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYI 159
           ++++  L  A  L A  +      V+R YTP   V+D                G   L I
Sbjct: 84  QDHVTGLTTASALLAKYVTPKGSNVIRPYTP---VSDNMAR------------GMFQLVI 128

Query: 160 KEYGSGEVARWLRKLPKGHIVEVRGPYPEFEF-PELDADTKRDREFSXXXXXXXXXXXXX 218
           K Y  G+    L  L +   VE +GP  ++ + P +                        
Sbjct: 129 KHYDGGKFTTHLFGLKENDTVEFKGPIQKWRWDPNM------------------------ 164

Query: 219 XPFD-IALFAAGTGIVTALQLL--TTEDPFKG-KIQLFYSCKSWGQLGPLGDLLRRCAQH 274
             FD I L  AGTGI    Q++    E+P    K+ L Y  K+     P   LLR+  + 
Sbjct: 165 --FDSIVLMGAGTGITPLFQMMHHIAENPTDNTKVHLLYGNKT-----PQDILLRKELEE 217

Query: 275 ------DRVDLHVFESE-----KGESLRLGLSKISDLVSGPFPFSENAPFEQRPKAEPVL 323
                 D+V +  F  +     KGE            ++  F   +N P    P +   +
Sbjct: 218 LASKYPDQVKVTYFVDKPEGDYKGE---------KGFITKDF-LKQNLP---TPGSNSHI 264

Query: 324 SLVCGPDDYIAFIAGPRHGLS-QGPVTGLLGTKGW 357
             VCGP  ++   +G +   S QG VTG+L   G+
Sbjct: 265 -FVCGPPPFMDAFSGNKVSPSDQGQVTGVLSELGY 298

>KLLA0F27621g complement(2560055..2560900) similar to sp|P38626
           Saccharomyces cerevisiae YIL043c CBR1 cytochrome-b5
           reductase, hypothetical start
          Length = 281

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 51/231 (22%), Positives = 89/231 (38%), Gaps = 61/231 (26%)

Query: 124 VVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPKGHIVEVR 183
           ++R YTP  L +D                G   L IK Y  G +++   +L  G  ++VR
Sbjct: 87  ILRSYTPTSLDSD--------------AVGHFELLIKSYEKGNISKHFAQLNIGDKIKVR 132

Query: 184 GPYPEFEF-PELDADTKRDREFSXXXXXXXXXXXXXXPFDIALFAAGTGIVTALQLLTT- 241
           GP   + + P ++                          +I + A GTGI    Q++ + 
Sbjct: 133 GPKGFYHYQPNMNE-------------------------EIGMIAGGTGIAPMYQIMKSI 167

Query: 242 --EDPFKGKIQLFYSCKSWGQLGPLGDLLRRCAQHDRVDLHVFESEKGESLRLG--LSKI 297
              D  K K+ L Y  ++   +     LL++       +L  F   K +  ++   L K 
Sbjct: 168 FANDSDKTKVSLVYGNQTEEDI-----LLKK-------ELDAFVERKPDQFKVYYLLDKA 215

Query: 298 SDLVSGPFPFSENAPFEQR--PKAEPVLSLVCGPDDYIAFIAGPRHGLSQG 346
            +  +G   +      ++R    AE V  LVCGP   ++ I   R+ ++ G
Sbjct: 216 PEAWTGGVGYITVDTMKERLPAPAEGVQLLVCGPPPMVSSIK--RNAVTLG 264

>Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement
          Length = 310

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 51/133 (38%), Gaps = 31/133 (23%)

Query: 153 GKLMLYIKEYGSGEVARWLRKLPKGHIVEVRGPYPEFEFPELDADTKRDREFSXXXXXXX 212
           G   + +K Y  G+V+++   L  G +VE +GP   F +    +                
Sbjct: 132 GHFDIIVKSYTDGKVSKYFASLKPGQLVEFQGPVGRFNYATNSSKA-------------- 177

Query: 213 XXXXXXXPFDIALFAAGTGIVTALQLL-----TTEDPFKGKIQLFYSCKSWGQLGPLGDL 267
                     I + A G+GI   LQ+L     T ED    K+ L Y+ ++   +    +L
Sbjct: 178 ----------IGMIAGGSGITPMLQVLSQIVTTPED--TTKVSLIYANETENDILLKDEL 225

Query: 268 LRRCAQHDRVDLH 280
                ++   ++H
Sbjct: 226 DEMADKYPNFEVH 238

>KLLA0C16918g 1478540..1479472 similar to sp|Q12746 Saccharomyces
           cerevisiae YML125c, start by similarity
          Length = 310

 Score = 32.7 bits (73), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 44/107 (41%), Gaps = 26/107 (24%)

Query: 137 EDGEQLRALRDGDNG--GGKLMLYIKEYGSGEVARWLRKLPKGHIVEVRGPYPEFEFPEL 194
           ED +++R      N    G   + +K Y  G+V+++   L  G  V+ +GP   F +   
Sbjct: 114 EDKDEIRYYTPISNKFETGHFDIMVKSYADGQVSKYFASLRPGQTVDFKGPVGRFAY--- 170

Query: 195 DADTKRDREFSXXXXXXXXXXXXXXPFDIALFAAGTGIVTALQLLTT 241
           +A++ +                      I + A G+G+   LQ+L T
Sbjct: 171 EANSSK---------------------HIGMIAGGSGLTPMLQVLNT 196

>Sklu_2260.2 YIL043C, Contig c2260 2185-3237
          Length = 350

 Score = 32.3 bits (72), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 14/62 (22%)

Query: 124 VVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPKGHIVEVR 183
           +VR YTP  L +D  G                 L IK Y  G +++ + +L  G  ++VR
Sbjct: 91  IVRSYTPTSLDSDATGH--------------FELLIKSYEKGNISKMIGELKIGDRIKVR 136

Query: 184 GP 185
           GP
Sbjct: 137 GP 138

>YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome b5
           reductase, converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+), uses FAD cofactor [969 bp,
           322 aa]
          Length = 322

 Score = 32.0 bits (71), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 14/68 (20%)

Query: 124 VVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPKGHIVEVR 183
           + R YTP  L             DGD  G    L +K Y +G V++ + +L  G  ++++
Sbjct: 126 ITRSYTPTSL-------------DGDTKGN-FELLVKSYPTGNVSKMIGELKIGDSIQIK 171

Query: 184 GPYPEFEF 191
           GP   + +
Sbjct: 172 GPRGNYHY 179

>AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH]
           (1228716..1229648) [933 bp, 310 aa]
          Length = 310

 Score = 31.6 bits (70), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 20/39 (51%)

Query: 153 GKLMLYIKEYGSGEVARWLRKLPKGHIVEVRGPYPEFEF 191
           G   + +K Y  G+V++W   L  G  VE +GP   F +
Sbjct: 132 GHFDIIVKSYVDGKVSKWFAGLQPGQTVEFKGPVGRFSY 170

>Kwal_47.18159
          Length = 287

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 55/138 (39%), Gaps = 43/138 (31%)

Query: 124 VVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPKGHIVEVR 183
           ++R YTP  L +D  G                 L IK Y  G V++ + +L  G  ++VR
Sbjct: 92  IMRSYTPTSLDSDSVGF--------------FELLIKSYEQGNVSKMIGELQIGDKIKVR 137

Query: 184 GPYPEFEF-PELDADTKRDREFSXXXXXXXXXXXXXXPFDIALFAAGTGIVTALQLLTT- 241
           GP   + + P +++                         +I + A GTGI    Q++ + 
Sbjct: 138 GPKGFYTYTPNMNS-------------------------EIGMIAGGTGIAPMYQIIKSI 172

Query: 242 -EDPF-KGKIQLFYSCKS 257
             DP  + K+ + Y  ++
Sbjct: 173 HSDPKDRTKVSIIYGSQT 190

>Scas_692.6
          Length = 314

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 20/39 (51%)

Query: 153 GKLMLYIKEYGSGEVARWLRKLPKGHIVEVRGPYPEFEF 191
           G   L IK Y  G+V+++   L  G  VE +GP  E  +
Sbjct: 136 GHFDLLIKSYADGKVSKYFAGLKPGDTVEFKGPIGELHY 174

>ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH]
           complement(532195..533058) [864 bp, 287 aa]
          Length = 287

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 14/62 (22%)

Query: 124 VVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPKGHIVEVR 183
           ++R YTP  L +D                G   L +K Y  G +++ L +L  G  ++VR
Sbjct: 91  MLRSYTPTSLDSD--------------ATGYFELLVKSYEKGNISKMLAELAIGDRIKVR 136

Query: 184 GP 185
           GP
Sbjct: 137 GP 138

>YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5
           reductase, mitochondrial protein that may be involved in
           the response to oxidative damage [909 bp, 302 aa]
          Length = 302

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 80/363 (22%), Positives = 125/363 (34%), Gaps = 93/363 (25%)

Query: 19  LWKRFYNSCSKANVQRRAPGRLPLVLCGVTALGAGCAAAEYHRRNYHAELSQEYFTKYK- 77
           ++ R   S SKA         LP+ L G  A+ A  A   +  RN H+ +  E    +K 
Sbjct: 1   MFSRLSRSHSKA---------LPIAL-GTVAIAAATAFY-FANRNQHSFVFNESNKVFKG 49

Query: 78  ------ISYRKDIDIDHYLLELTPLKQQRNNIWALFGARNLWAVEIKQPEIMVVRQYTPL 131
                 +   K  +  H     T      ++   L  A  L+A  +      VVR YTP+
Sbjct: 50  DDKWIDLPISKIEEESHDTRRFTFKLPTEDSEMGLVLASALFAKFVTPKGSNVVRPYTPV 109

Query: 132 PLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPKGHIVEVRGPYPEFEF 191
             ++ +               G   L +K Y  G++   L  L     V  +GP  ++++
Sbjct: 110 SDLSQK---------------GHFQLVVKHYEGGKMTSHLFGLKPNDTVSFKGPIMKWKW 154

Query: 192 PELDADTKRDREFSXXXXXXXXXXXXXXPFDIALFAAGTGIVTALQLL--TTEDPF-KGK 248
                   +  +F                  I L  AGTGI    QL     E+P  K K
Sbjct: 155 --------QPNQFK----------------SITLLGAGTGINPLYQLAHHIVENPNDKTK 190

Query: 249 IQLFYSCKSWGQLGPLGDLLRRCAQH------DRVDLHVF-------ESEKGESLRLGLS 295
           + L Y  K+     P   LLR+          D+ ++  F       +   GE   +   
Sbjct: 191 VNLLYGNKT-----PQDILLRKELDALKEKYPDKFNVTYFVDDKQDDQDFDGEISFISKD 245

Query: 296 KISDLVSGPFPFSENAPFEQRPKAEPVLSLVCGPDDYIAFIAGPRHG-LSQGPVTGLLGT 354
            I + V GP               E     VCGP  ++   +G +     QG + G+L  
Sbjct: 246 FIQEHVPGP--------------KESTHLFVCGPPPFMNAYSGEKKSPKDQGELIGILNN 291

Query: 355 KGW 357
            G+
Sbjct: 292 LGY 294

>CAGL0B02519g 240486..241424 highly similar to sp|Q12746
           Saccharomyces cerevisiae YML125c, start by similarity
          Length = 312

 Score = 28.5 bits (62), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 19/33 (57%)

Query: 153 GKLMLYIKEYGSGEVARWLRKLPKGHIVEVRGP 185
           G + L +K Y  G+V+++   +  G  V+ RGP
Sbjct: 134 GHIDLLVKSYKDGKVSKYFASMKPGETVDFRGP 166

>Kwal_33.14260
          Length = 308

 Score = 28.5 bits (62), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 20/39 (51%)

Query: 153 GKLMLYIKEYGSGEVARWLRKLPKGHIVEVRGPYPEFEF 191
           G   + +K Y  G+V+++   L  G  V+ +GP   F +
Sbjct: 130 GYFDIIVKSYADGQVSKYFAGLKAGSAVDFKGPVGRFNY 168

>Scas_700.9
          Length = 262

 Score = 28.1 bits (61), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 37/78 (47%), Gaps = 13/78 (16%)

Query: 126 RQYTPLP--LVADEDGEQLRALRDGDN-----------GGGKLMLYIKEYGSGEVARWLR 172
           ++ TPLP  ++  +D  +LRAL   +N           G G + +YIK +   E  +  +
Sbjct: 181 KRTTPLPKSVIEAKDKHRLRALTKEENKRFQEIEDDKEGWGSVPVYIKAFAQFESMQRQK 240

Query: 173 KLPKGHIVEVRGPYPEFE 190
           KL K  + + +  + + +
Sbjct: 241 KLKKAQLSKEKKAFSKIQ 258

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.140    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,747,510
Number of extensions: 485938
Number of successful extensions: 927
Number of sequences better than 10.0: 23
Number of HSP's gapped: 922
Number of HSP's successfully gapped: 23
Length of query: 359
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 256
Effective length of database: 13,030,455
Effective search space: 3335796480
Effective search space used: 3335796480
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)