Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR089C38938220600.0
KLLA0E21923g37835511691e-160
YDR268W (MSW1)37935911241e-153
Kwal_55.2156337235111121e-151
Sklu_1979.431429210261e-139
Scas_615.1037934510201e-137
CAGL0M08624g33732910131e-137
Scas_659.23396263770.14
KLLA0F15389g397268740.33
YGR185C (TYS1)394231720.55
CAGL0I07579g425276710.76
Scas_543.485744701.1
KLLA0D16324g69775701.3
CAGL0D02838g83444673.0
KLLA0E00770g81444673.3
AFR188W82744664.1
YLR051C21742644.9
Kwal_55.2064481344647.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR089C
         (382 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR089C [1136] [Homologous to ScYDR268W (MSW1) - SH] (518154..51...   798   0.0  
KLLA0E21923g 1947496..1948632 similar to sp|P04803 Saccharomyces...   454   e-160
YDR268W (MSW1) [1101] chr4 (1003996..1005135) Tryptophanyl-tRNA ...   437   e-153
Kwal_55.21563                                                         432   e-151
Sklu_1979.4 YDR268W, Contig c1979 7588-8532 reverse complement        399   e-139
Scas_615.10                                                           397   e-137
CAGL0M08624g complement(859796..860809) highly similar to sp|P04...   394   e-137
Scas_659.23                                                            34   0.14 
KLLA0F15389g complement(1422689..1423882) highly similar to sp|P...    33   0.33 
YGR185C (TYS1) [2136] chr7 complement(866339..867523) Tyrosyl-tR...    32   0.55 
CAGL0I07579g complement(730664..731941) highly similar to sp|Q12...    32   0.76 
Scas_543.4                                                             32   1.1  
KLLA0D16324g complement(1373445..1375538) weakly similar to sgd|...    32   1.3  
CAGL0D02838g complement(296403..298907) highly similar to sp|Q07...    30   3.0  
KLLA0E00770g complement(84426..86870) similar to sp|Q07844 Sacch...    30   3.3  
AFR188W [3380] [Homologous to ScYLL034C - SH] complement(778332....    30   4.1  
YLR051C (YLR051C) [3468] chr12 complement(246325..246978) Protei...    29   4.9  
Kwal_55.20644                                                          29   7.4  

>ACR089C [1136] [Homologous to ScYDR268W (MSW1) - SH]
           (518154..519323) [1170 bp, 389 aa]
          Length = 389

 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/382 (100%), Positives = 382/382 (100%)

Query: 1   MVRYKDLSNLISSSGITMQIKCGSGLRQFVRKASTIQNIDYANRSLKLPDGAVVFSLIQP 60
           MVRYKDLSNLISSSGITMQIKCGSGLRQFVRKASTIQNIDYANRSLKLPDGAVVFSLIQP
Sbjct: 1   MVRYKDLSNLISSSGITMQIKCGSGLRQFVRKASTIQNIDYANRSLKLPDGAVVFSLIQP 60

Query: 61  TGKFHLGNYLGAVRVWTELSEDAPAGGKCIFGTADLHAITIPKPDGNAFRQMRHEAIASL 120
           TGKFHLGNYLGAVRVWTELSEDAPAGGKCIFGTADLHAITIPKPDGNAFRQMRHEAIASL
Sbjct: 61  TGKFHLGNYLGAVRVWTELSEDAPAGGKCIFGTADLHAITIPKPDGNAFRQMRHEAIASL 120

Query: 121 LAVGIDPTKSILFHQSQVPEHAELCWYLSTLTSMGALNRMTQWKTKANIKDTSSEKVGAV 180
           LAVGIDPTKSILFHQSQVPEHAELCWYLSTLTSMGALNRMTQWKTKANIKDTSSEKVGAV
Sbjct: 121 LAVGIDPTKSILFHQSQVPEHAELCWYLSTLTSMGALNRMTQWKTKANIKDTSSEKVGAV 180

Query: 181 KLGLFTYPVLQAADVLLYKSTHIPVGEDQVQQLELTRQLAQAFNSTYKTRYFREPTTLLT 240
           KLGLFTYPVLQAADVLLYKSTHIPVGEDQVQQLELTRQLAQAFNSTYKTRYFREPTTLLT
Sbjct: 181 KLGLFTYPVLQAADVLLYKSTHIPVGEDQVQQLELTRQLAQAFNSTYKTRYFREPTTLLT 240

Query: 241 PTRKVLSLQNPLKKMSKSDANQNSCICVTDEPDAIRRKIRSAVTDSIGHEFKYDPEGRPG 300
           PTRKVLSLQNPLKKMSKSDANQNSCICVTDEPDAIRRKIRSAVTDSIGHEFKYDPEGRPG
Sbjct: 241 PTRKVLSLQNPLKKMSKSDANQNSCICVTDEPDAIRRKIRSAVTDSIGHEFKYDPEGRPG 300

Query: 301 VSNLINIVAGIQKKTIAAVEADIAGFKDHATFKNYVTDILVAELRGPREEFARYMNDKSY 360
           VSNLINIVAGIQKKTIAAVEADIAGFKDHATFKNYVTDILVAELRGPREEFARYMNDKSY
Sbjct: 301 VSNLINIVAGIQKKTIAAVEADIAGFKDHATFKNYVTDILVAELRGPREEFARYMNDKSY 360

Query: 361 IYEVERNGAERAGAIAAKTLAE 382
           IYEVERNGAERAGAIAAKTLAE
Sbjct: 361 IYEVERNGAERAGAIAAKTLAE 382

>KLLA0E21923g 1947496..1948632 similar to sp|P04803 Saccharomyces
           cerevisiae YDR268w MSW1 tryptophanyl-tRNA synthetase,
           mitochondrial singleton, start by similarity
          Length = 378

 Score =  454 bits (1169), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 212/355 (59%), Positives = 268/355 (75%), Gaps = 1/355 (0%)

Query: 29  FVRKASTIQNIDYANRSLKLPDGAVVFSLIQPTGKFHLGNYLGAVRVWTELSEDAPAGGK 88
           F R  S+++   +  R   LP  A +FSLIQPTGKFHLGNYLGAVRVW ++++    G  
Sbjct: 16  FKRFNSSVKTTGFKLRESDLPKNATIFSLIQPTGKFHLGNYLGAVRVWKDITDLKDDGTT 75

Query: 89  CIFGTADLHAITIPKPDGNAFRQMRHEAIASLLAVGIDPTKSILFHQSQVPEHAELCWYL 148
            +FGTADLHAIT+PKP+   FR  R EAIAS+L++GIDP K+I+FHQS+V +H EL W L
Sbjct: 76  LLFGTADLHAITVPKPNAKEFRNYRIEAIASILSIGIDPEKAIVFHQSRVSQHTELHWLL 135

Query: 149 STLTSMGALNRMTQWKTKANIKDTSSEK-VGAVKLGLFTYPVLQAADVLLYKSTHIPVGE 207
           S+L SMG+LNRMTQWK+K+NI D S +  +GA+KLGLF+YPVLQAAD+LLYKSTH+PVG+
Sbjct: 136 SSLASMGSLNRMTQWKSKSNINDQSDDAALGAIKLGLFSYPVLQAADILLYKSTHVPVGD 195

Query: 208 DQVQQLELTRQLAQAFNSTYKTRYFREPTTLLTPTRKVLSLQNPLKKMSKSDANQNSCIC 267
           DQ Q LELTRQL+  FN  YKT+YF  PTT+L PT+K+LSL NP KKMSKSD NQNS I 
Sbjct: 196 DQSQHLELTRQLSNTFNKFYKTKYFPMPTTILAPTKKILSLLNPEKKMSKSDTNQNSVIY 255

Query: 268 VTDEPDAIRRKIRSAVTDSIGHEFKYDPEGRPGVSNLINIVAGIQKKTIAAVEADIAGFK 327
           +TDEP+ I +KI+ AVTDSI   F +DP  RPG+SNLIN ++G+Q+ +I  VE DIA  K
Sbjct: 256 ITDEPEIIAKKIKRAVTDSISDSFYFDPVKRPGISNLINTLSGVQRVSIEDVEKDIAHIK 315

Query: 328 DHATFKNYVTDILVAELRGPREEFARYMNDKSYIYEVERNGAERAGAIAAKTLAE 382
           DH  FK +VTD+LV EL   RE+F RYM +  Y+++V  +GA +A  IAAK + E
Sbjct: 316 DHKDFKQHVTDVLVEELAPSREQFHRYMKNPDYLHKVSEDGASKAREIAAKNITE 370

>YDR268W (MSW1) [1101] chr4 (1003996..1005135) Tryptophanyl-tRNA
           synthetase, mitochondrial, member of class I family of
           aminoacyl-tRNA synthetases [1140 bp, 379 aa]
          Length = 379

 Score =  437 bits (1124), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 206/359 (57%), Positives = 265/359 (73%), Gaps = 7/359 (1%)

Query: 31  RKASTIQNIDYANRSLKLPDGAVVFSLIQPTGKFHLGNYLGAVRVWTELSEDAPAGGKCI 90
           R  ST+Q  D+   S  L   A VFS+IQPTG FHLGNYLGA RVWT+L E    G + I
Sbjct: 14  RWISTVQRADFKLNSEALHSNATVFSMIQPTGCFHLGNYLGATRVWTDLCELKQPGQELI 73

Query: 91  FGTADLHAITIPKPDGNAFRQMRHEAIASLLAVGIDPTKSILFHQSQVPEHAELCWYLST 150
           FG ADLHAIT+PKPDG  FR+ RHEA+AS+LAVG+DP K+ + +QS +P+H+EL W LST
Sbjct: 74  FGVADLHAITVPKPDGEMFRKFRHEAVASILAVGVDPEKASVIYQSAIPQHSELHWLLST 133

Query: 151 LTSMGALNRMTQWKTKANIKDTSS-------EKVGAVKLGLFTYPVLQAADVLLYKSTHI 203
           L SMG LNRMTQWK+K+NIK +++         VG V+LGLF+YPVLQAAD+LLYKSTH+
Sbjct: 134 LASMGLLNRMTQWKSKSNIKQSTNGDYLVNDSDVGKVRLGLFSYPVLQAADILLYKSTHV 193

Query: 204 PVGEDQVQQLELTRQLAQAFNSTYKTRYFREPTTLLTPTRKVLSLQNPLKKMSKSDANQN 263
           PVG+DQ Q LELTR LA+ FN  YK  +F +P T+L  T+KVLSL  P KKMSKSD N +
Sbjct: 194 PVGDDQSQHLELTRHLAEKFNKMYKKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPNHD 253

Query: 264 SCICVTDEPDAIRRKIRSAVTDSIGHEFKYDPEGRPGVSNLINIVAGIQKKTIAAVEADI 323
           S I + DEP AI++KIR A+TDSI   F YDP  RPGVSNLINIV+GIQ+K+I  V  D+
Sbjct: 254 SVIFLNDEPKAIQKKIRKALTDSISDRFYYDPVERPGVSNLINIVSGIQRKSIEDVVEDV 313

Query: 324 AGFKDHATFKNYVTDILVAELRGPREEFARYMNDKSYIYEVERNGAERAGAIAAKTLAE 382
           + F ++  FK+YV+++++ EL+GPR EF +Y+N+ +Y++ V  +G  +A   AAK LA+
Sbjct: 314 SRFNNYRDFKDYVSEVIIEELKGPRTEFEKYINEPTYLHSVVESGMRKAREKAAKNLAD 372

>Kwal_55.21563
          Length = 372

 Score =  432 bits (1112), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 204/351 (58%), Positives = 261/351 (74%), Gaps = 1/351 (0%)

Query: 33  ASTIQNIDYANRSLKLPDGAVVFSLIQPTGKFHLGNYLGAVRVWTELSEDAPAGGKCIFG 92
           + T++  DY   +  LPD AVVFS++QPTGKFHLGNYLGAVRVW +L +      + +FG
Sbjct: 15  SKTVKTTDYKINASDLPDNAVVFSMVQPTGKFHLGNYLGAVRVWKDLCDQKAPSTQLMFG 74

Query: 93  TADLHAITIPKPDGNAFRQMRHEAIASLLAVGIDPTKSILFHQSQVPEHAELCWYLSTLT 152
            ADLHAITIP PDG   RQ R EA+AS+L+VG+DP+K++LF+QS+V +H EL W LSTL 
Sbjct: 75  VADLHAITIPIPDGMKLRQSRREAMASILSVGVDPSKAVLFNQSRVHQHTELHWLLSTLA 134

Query: 153 SMGALNRMTQWKTKANIKDTSSEK-VGAVKLGLFTYPVLQAADVLLYKSTHIPVGEDQVQ 211
            MG LNRMTQWK+K+N+K+ S E+ +G VKLGLF+YPVLQAAD+LLY+STH+PVG+DQ Q
Sbjct: 135 PMGLLNRMTQWKSKSNLKNMSDEQALGTVKLGLFSYPVLQAADILLYRSTHVPVGDDQAQ 194

Query: 212 QLELTRQLAQAFNSTYKTRYFREPTTLLTPTRKVLSLQNPLKKMSKSDANQNSCICVTDE 271
            LELTR LAQ FN  YK      PTT+L PT+++LSL +   KMSKSD NQN+ I + DE
Sbjct: 195 HLELTRTLAQYFNKLYKRPILPLPTTILAPTKRILSLADIDSKMSKSDQNQNATIYLNDE 254

Query: 272 PDAIRRKIRSAVTDSIGHEFKYDPEGRPGVSNLINIVAGIQKKTIAAVEADIAGFKDHAT 331
           PD+I +KIR AVTDS    F YDP  RPGVSNLINIV+G+Q+++I  VE DI+ F  H+ 
Sbjct: 255 PDSIVKKIRKAVTDSNSKAFYYDPSSRPGVSNLINIVSGLQRQSIQQVEKDISRFNSHSE 314

Query: 332 FKNYVTDILVAELRGPREEFARYMNDKSYIYEVERNGAERAGAIAAKTLAE 382
           FK+YV+++LV  L+GPRE F  YM D  Y+ +V  +GAE A   A K++ E
Sbjct: 315 FKSYVSEVLVETLQGPRERFNLYMKDPDYLDKVFESGAENASKHAEKSIKE 365

>Sklu_1979.4 YDR268W, Contig c1979 7588-8532 reverse complement
          Length = 314

 Score =  399 bits (1026), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 189/292 (64%), Positives = 230/292 (78%), Gaps = 2/292 (0%)

Query: 31  RKASTIQNIDYANRSLKLPDGAVVFSLIQPTGKFHLGNYLGAVRVWTELSEDAPAGGKCI 90
           R  +T++  DY   S  +PD + +FSLIQPTGKFHLGNYLGAVRVW +L +      K +
Sbjct: 12  RFLTTVKTTDYTLHSHDIPDKSTIFSLIQPTGKFHLGNYLGAVRVWKDLCDTDLDESKLL 71

Query: 91  FGTADLHAITIPKPDGNAFRQMRHEAIASLLAVGIDPTKSILFHQSQVPEHAELCWYLST 150
           FG ADLHAITIPKP+ + FRQ R EAIAS+L++GIDP K+I+FHQSQV +HAEL W LST
Sbjct: 72  FGVADLHAITIPKPNSSEFRQYRTEAIASILSIGIDPKKAIIFHQSQVHQHAELHWILST 131

Query: 151 LTSMGALNRMTQWKTKANIKDTSS--EKVGAVKLGLFTYPVLQAADVLLYKSTHIPVGED 208
           +  +G LNRMTQWK+K+N++  +S  E +G VKLGLF YPVLQAAD+LLY STH+PVG+D
Sbjct: 132 IAPVGYLNRMTQWKSKSNLRQDASDAEALGNVKLGLFAYPVLQAADILLYHSTHVPVGDD 191

Query: 209 QVQQLELTRQLAQAFNSTYKTRYFREPTTLLTPTRKVLSLQNPLKKMSKSDANQNSCICV 268
           Q Q LELTR LAQ FN  YK  YF  PTT+L PT+K+LSL +P KKMSKSDANQNS I +
Sbjct: 192 QSQHLELTRFLAQQFNKLYKKSYFPLPTTILAPTKKILSLASPGKKMSKSDANQNSVIYL 251

Query: 269 TDEPDAIRRKIRSAVTDSIGHEFKYDPEGRPGVSNLINIVAGIQKKTIAAVE 320
            D+P+ I +KI+ AVTDSI HEFKYDPE RPGVSNLINIV+GIQ+++IA VE
Sbjct: 252 NDDPETISKKIKKAVTDSISHEFKYDPENRPGVSNLINIVSGIQRRSIAEVE 303

>Scas_615.10
          Length = 379

 Score =  397 bits (1020), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 194/345 (56%), Positives = 245/345 (71%), Gaps = 9/345 (2%)

Query: 35  TIQNIDYA--NRSLKLPDGAVVFSLIQPTGKFHLGNYLGAVRVWTELSEDAPAGGKCIFG 92
           T+QN DYA  + S  LP  A +FSLIQPTGKFHLGNYLGA R+W ++S+        IFG
Sbjct: 28  TVQNTDYALQDISQTLPSDATIFSLIQPTGKFHLGNYLGATRIWKQISQSKQPTQTAIFG 87

Query: 93  TADLHAITIPKPDGNAFRQMRHEAIASLLAVGIDPTKSILFHQSQVPEHAELCWYLSTLT 152
            ADLHAIT+PKPD   F Q R EA+AS+L++GIDP  +I+ +QS+VP+H +L W LST T
Sbjct: 88  VADLHAITVPKPDPMEFLQCRREALASILSLGIDPQNAIMMYQSEVPQHTQLHWVLSTFT 147

Query: 153 SMGALNRMTQWKTKANIKDTSSEKVGAVKLGLFTYPVLQAADVLLYKSTHIPVGEDQVQQ 212
           SMG LNRMTQWK KA     S      VKLGLF+YPVLQAAD+LLYK+TH+PVG+DQ Q 
Sbjct: 148 SMGVLNRMTQWKAKAKSNHMS------VKLGLFSYPVLQAADILLYKATHVPVGDDQCQP 201

Query: 213 LELTRQLAQAFNSTY-KTRYFREPTTLLTPTRKVLSLQNPLKKMSKSDANQNSCICVTDE 271
           LEL R +AQ FN  Y    +F  P T+L PT+K+LSL +PLKKMSKSD N++S I V D 
Sbjct: 202 LELCRSIAQQFNQFYGDENFFPIPRTILAPTKKILSLGDPLKKMSKSDPNKDSNIYVNDA 261

Query: 272 PDAIRRKIRSAVTDSIGHEFKYDPEGRPGVSNLINIVAGIQKKTIAAVEADIAGFKDHAT 331
            D I +KIR AVTDS+     +DP  RPGVSNL+N+V+GI ++ ++AVE +++       
Sbjct: 262 ADVIVKKIRKAVTDSVTGPITFDPVNRPGVSNLLNMVSGITQREMSAVEQEVSHLSHLGE 321

Query: 332 FKNYVTDILVAELRGPREEFARYMNDKSYIYEVERNGAERAGAIA 376
           FKNYV +I+V ELRGPRE + + MN+  Y+ +V   GAERA AIA
Sbjct: 322 FKNYVAEIVVEELRGPRERYEQLMNEPEYLKQVGDQGAERARAIA 366

>CAGL0M08624g complement(859796..860809) highly similar to sp|P04803
           Saccharomyces cerevisiae YDR268w MSW1 tryptophanyl-tRNA
           synthetase, mitochondrial, start by similarity
          Length = 337

 Score =  394 bits (1013), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 184/329 (55%), Positives = 244/329 (74%), Gaps = 3/329 (0%)

Query: 57  LIQPTGKFHLGNYLGAVRVWTELSEDAPAGGKCIFGTADLHAITIPKPDGNAFRQMRHEA 116
           ++QPTGKFHLGNYLGA RVW +L +    G + IFG ADLHAITIPKPD   F+Q+R EA
Sbjct: 1   MVQPTGKFHLGNYLGATRVWKDLCDIKQPGQRLIFGVADLHAITIPKPDAAQFKQLRREA 60

Query: 117 IASLLAVGIDPTKSILFHQSQVPEHAELCWYLSTLTSMGALNRMTQWKTKANI---KDTS 173
           IAS+LAVG+DP ++ + +QS +P H++L W LST+  MG LNRMTQWK+K+N+   KD +
Sbjct: 61  IASILAVGVDPARASIMYQSAIPAHSQLYWLLSTVAPMGYLNRMTQWKSKSNLREDKDAT 120

Query: 174 SEKVGAVKLGLFTYPVLQAADVLLYKSTHIPVGEDQVQQLELTRQLAQAFNSTYKTRYFR 233
           ++++G VKLGLF YPVLQAAD+LLYK+TH+PVG+DQVQ LELTR LA+ FN  YK + F 
Sbjct: 121 AKELGEVKLGLFGYPVLQAADILLYKATHVPVGDDQVQHLELTRTLAENFNKLYKKQVFP 180

Query: 234 EPTTLLTPTRKVLSLQNPLKKMSKSDANQNSCICVTDEPDAIRRKIRSAVTDSIGHEFKY 293
            P TLL PT+K+LSL +  KKMSKSD NQ+  I V D P+ I RKI+ A TDSI  +F Y
Sbjct: 181 LPRTLLAPTKKILSLTHDTKKMSKSDPNQDGVIYVNDPPETIIRKIKKARTDSITDKFYY 240

Query: 294 DPEGRPGVSNLINIVAGIQKKTIAAVEADIAGFKDHATFKNYVTDILVAELRGPREEFAR 353
           DP  RPG+SNLINIV+GI K+ + AVE ++  F ++   K +V+++++ ELR PRE+F +
Sbjct: 241 DPVHRPGLSNLINIVSGITKQPVHAVEQELQKFDNYRDLKAHVSEVIIEELRVPREKFHQ 300

Query: 354 YMNDKSYIYEVERNGAERAGAIAAKTLAE 382
           YM D  ++ +  + G +RA  IAA T+ E
Sbjct: 301 YMEDPQFLDDTVQQGTQRASEIAASTMKE 329

>Scas_659.23
          Length = 396

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 71/263 (26%), Positives = 104/263 (39%), Gaps = 38/263 (14%)

Query: 28  QFVRKASTIQNI-DYANRSLKLPDGAVVFSLIQPTGKFHLGNYLGAVRVWTELSEDAPAG 86
           Q V     I+N+ +   R LKL  G        PTGK H G ++      T+L++   AG
Sbjct: 17  QEVLNPQIIKNVLEVEKRPLKLYWGTA------PTGKPHCGYFVP----MTKLADFLKAG 66

Query: 87  GKCIFGTADLHAI--TIPKP-DGNAFRQMRHE----AIASLLAVGIDPTKSILFHQSQVP 139
            +     ADLHA    +  P +   +R   +E    AI   + V I+  K +     Q+ 
Sbjct: 67  CEVTVLLADLHAFLDNMKAPLEVVQYRAKYYELTIKAILRSINVPIEKLKFVTGSSYQLT 126

Query: 140 EHAELCWYLSTLTSMGALNRMTQWKTKANIKDTSSEKVGAVKLGLFTYPVLQAADVLLYK 199
                     TL      N ++Q + K    D   +    +  GL  YP++QA D     
Sbjct: 127 SD-------YTLDIFRMANIVSQNEAKRAGADVVKQVANPLLSGLI-YPLMQALDEHFLD 178

Query: 200 STHIPVGEDQVQQLELTRQLAQAFNSTYKTRYFREPTTLLTPTRKVLSLQNPLKKMSKSD 259
                 G DQ +   L  +  Q+    YK R       L+ P    L       KMS SD
Sbjct: 179 CDAQFGGVDQRKIFVLAEENLQSLG--YKKR-----AHLMNPMVPGLGQGG---KMSASD 228

Query: 260 ANQNSCICVTDEPDAIRRKIRSA 282
            N  S I + +EP  +++KI SA
Sbjct: 229 PN--SKIDLLEEPKIVKKKINSA 249

>KLLA0F15389g complement(1422689..1423882) highly similar to
           sp|P36421 Saccharomyces cerevisiae YGR185c TYS1
           tyrosyl-tRNA synthetase singleton, start by similarity
          Length = 397

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 107/268 (39%), Gaps = 48/268 (17%)

Query: 28  QFVRKASTIQNI-DYANRSLKLPDGAVVFSLIQPTGKFHLGNYLGAVRVWTELSEDAPAG 86
           Q V  A  I+N+ +   R LKL  G        PTG+ H G ++      T+L++   AG
Sbjct: 19  QEVLNAQIIKNVLEVEKRPLKLYWGTA------PTGRPHCGYFVP----MTKLADFLKAG 68

Query: 87  GKCIFGTADLHAI---TIPKPDGNAFRQMRHE----AIASLLAVGIDPTKSILFHQSQVP 139
            +     ADLHA         +  A+R   +E    AI   + V I+  K ++    Q  
Sbjct: 69  CEVTVLLADLHAFLDNMKASLEVVAYRAKYYELVIKAILRSINVPIEKLKFVIGSSYQTS 128

Query: 140 EHAELCWYLSTLTSMGALNRMTQWKTKANIKDTSSEKVGAVKLGLFTYPVLQAADVLLYK 199
                  Y+  +  +   N ++Q   K    D   +    +  GL  YP++QA D     
Sbjct: 129 NE-----YIMDIFKLS--NIVSQNDAKRAGADVVKQVANPLLSGLI-YPLMQALD----- 175

Query: 200 STHIPV-----GEDQVQQLELTRQLAQAFNSTYKTRYFREPTTLLTPTRKVLSLQNPLKK 254
             H+ V     G DQ +   L  +  +     YK R       L+ P    L       K
Sbjct: 176 EEHLGVDVQFGGVDQRKIFVLAEENLEKLG--YKKR-----AHLMNPMVPGLGQGG---K 225

Query: 255 MSKSDANQNSCICVTDEPDAIRRKIRSA 282
           MS SD N  S I + +EP  +++KI SA
Sbjct: 226 MSASDPN--SKIDLLEEPKQVKKKINSA 251

>YGR185C (TYS1) [2136] chr7 complement(866339..867523) Tyrosyl-tRNA
           synthetase, cytoplasmic, charges its cognate tRNAs with
           tyrosine during protein synthesis [1185 bp, 394 aa]
          Length = 394

 Score = 32.3 bits (72), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 93/231 (40%), Gaps = 33/231 (14%)

Query: 60  PTGKFHLGNYLGAVRVWTELSEDAPAGGKCIFGTADLHA----ITIPKPDGN---AFRQM 112
           PTG+ H G ++      T+L++   AG +     ADLHA    +  P    N    + ++
Sbjct: 48  PTGRPHCGYFVP----MTKLADFLKAGCEVTVLLADLHAFLDNMKAPLEVVNYRAKYYEL 103

Query: 113 RHEAIASLLAVGIDPTKSILFHQSQV-PEHAELCWYLSTLTSMGALNRMTQWKTKANIKD 171
             +AI   + V I+  K ++    Q+ P++    + LS + S     R      K     
Sbjct: 104 TIKAILRSINVPIEKLKFVVGSSYQLTPDYTMDIFRLSNIVSQNDAKRAGADVVK----- 158

Query: 172 TSSEKVGAVKLGLFTYPVLQAADVLLYKSTHIPVGEDQVQQLELTRQLAQAFNSTYKTRY 231
               +V    L    YP++QA D           G DQ +   L  +   +    YK R 
Sbjct: 159 ----QVANPLLSGLIYPLMQALDEQFLDVDCQFGGVDQRKIFVLAEENLPSLG--YKKR- 211

Query: 232 FREPTTLLTPTRKVLSLQNPLKKMSKSDANQNSCICVTDEPDAIRRKIRSA 282
                 L+ P    L+      KMS SD N  S I + +EP  +++KI SA
Sbjct: 212 ----AHLMNPMVPGLAQGG---KMSASDPN--SKIDLLEEPKQVKKKINSA 253

>CAGL0I07579g complement(730664..731941) highly similar to sp|Q12109
           Saccharomyces cerevisiae YOL097c WRS1 tryptophan--tRNA
           ligase, hypothetical start
          Length = 425

 Score = 32.0 bits (71), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 66/276 (23%), Positives = 103/276 (37%), Gaps = 48/276 (17%)

Query: 23  GSGLRQFVRKASTIQNIDYANRSLKLPDGAVVFSLIQ----PTGKFHLGNYLGAVRVWTE 78
           G     F+RK       D+ N+ L L +    F L       +G  H+G+ +  +  +T+
Sbjct: 68  GQKPHHFLRKGLFFSERDF-NKILDLYEQGKPFFLYTGRGPSSGSMHMGHLVPFM--FTK 124

Query: 79  LSEDAPAGGKCIFGTADLHAITIPKPDGNAFRQMRHEAIASLLAVGIDPTKSILFHQSQV 138
             +D       I  T D   +  PK   +  +    E    ++AVG +P  + +F     
Sbjct: 125 WLQDVFDCALVIELTDDEKFLFKPKLTIDDVKGFARENARDIIAVGFNPENTFIF----- 179

Query: 139 PEHAELCWYLSTLTSMGALNRMTQWKTKANIKDTSSEKVGAVK----LGLFTYPVLQAA- 193
                     S L  MG        +    I  ++++ V        +G F +  +Q A 
Sbjct: 180 ----------SDLEYMGGAFYENVVRVSRQITGSTAKAVFGFTDSDCIGKFHFASIQIAT 229

Query: 194 -------DVL-LYKSTH--IPVGEDQVQQLELTRQLAQAFNSTYKTRYFREPTTLLTPTR 243
                  DVL L   T   IP   DQ     + R +A       K +Y +     L  +R
Sbjct: 230 AFPSSFPDVLGLPPKTPCLIPCAIDQDPYFRVCRDVAD------KLKYSK---PALIHSR 280

Query: 244 KVLSLQNPLKKMSKSDANQNSCICVTDEPDAIRRKI 279
              +LQ    KMS SD    S I +TD P  I++KI
Sbjct: 281 FFPALQGSTTKMSASD--DTSAIFMTDTPKQIQKKI 314

>Scas_543.4
          Length = 857

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 78  ELSEDAPAGGKCIFGTADLHAITIPKPDGNAFRQMRHEAIASLL 121
           EL E+A +   C+    ++ AIT PK DG A R+M    +A LL
Sbjct: 292 ELFEEAKSLAPCLMFFDEIDAIT-PKRDGGAQREMERRIVAQLL 334

>KLLA0D16324g complement(1373445..1375538) weakly similar to
           sgd|S0004117 Saccharomyces cerevisiae YLR127c APC2
           component of the anaphase promoting complex,
           hypothetical start
          Length = 697

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 17/75 (22%)

Query: 280 RSAVTDSIG---------HEFKYDPEGRPGVSNLINIVAGIQKKTIAAVEADIAGFKDHA 330
           R+ V D +G          E+  DPE +  +  ++N + G +K T+ + EAD+    D  
Sbjct: 454 RTLVDDLLGVVSGKFIESEEYSLDPEWQRIMDIILNHLEGTRKGTVTSEEADLTHLND-- 511

Query: 331 TFKNYVTDILVAELR 345
                  DI++ +LR
Sbjct: 512 ------VDIMLEDLR 520

>CAGL0D02838g complement(296403..298907) highly similar to sp|Q07844
           Saccharomyces cerevisiae YLL034c, start by similarity
          Length = 834

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 78  ELSEDAPAGGKCIFGTADLHAITIPKPDGNAFRQMRHEAIASLL 121
           EL ++A +   C+    ++ AIT PK DG A R+M    +A LL
Sbjct: 282 ELFDEAKSLAPCLMFFDEIDAIT-PKRDGGAQREMERRIVAQLL 324

>KLLA0E00770g complement(84426..86870) similar to sp|Q07844
           Saccharomyces cerevisiae YLL034c, start by similarity
          Length = 814

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 78  ELSEDAPAGGKCIFGTADLHAITIPKPDGNAFRQMRHEAIASLL 121
           EL ++A +   C+    ++ AIT PK DG A R+M    +A LL
Sbjct: 283 ELFDEAKSLAPCLVFFDEIDAIT-PKRDGGAQREMERRIVAQLL 325

>AFR188W [3380] [Homologous to ScYLL034C - SH]
           complement(778332..780815) [2484 bp, 827 aa]
          Length = 827

 Score = 30.0 bits (66), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 78  ELSEDAPAGGKCIFGTADLHAITIPKPDGNAFRQMRHEAIASLL 121
           +L E+A +   C+    ++ AIT PK DG A R+M    +A LL
Sbjct: 289 DLFEEAKSLAPCLVFFDEIDAIT-PKRDGGAQREMERRIVAQLL 331

>YLR051C (YLR051C) [3468] chr12 complement(246325..246978) Protein
           of unknown function, has high similarity to
           uncharacterized C. albicans Orf6.5396p [654 bp, 217 aa]
          Length = 217

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 22/42 (52%)

Query: 99  ITIPKPDGNAFRQMRHEAIASLLAVGIDPTKSILFHQSQVPE 140
            T+PKPD N  R+++ + +       +DP +     + +VPE
Sbjct: 104 FTLPKPDDNMRREVQRDLLLIKHRAALDPKRHYKKQRWEVPE 145

>Kwal_55.20644
          Length = 813

 Score = 29.3 bits (64), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 78  ELSEDAPAGGKCIFGTADLHAITIPKPDGNAFRQMRHEAIASLL 121
           +L E+A     C+    ++ AIT PK DG A R+M    +A LL
Sbjct: 286 DLFEEAKNLAPCLVFFDEIDAIT-PKRDGGAQREMERRIVAQLL 328

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.132    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,758,341
Number of extensions: 480377
Number of successful extensions: 1252
Number of sequences better than 10.0: 22
Number of HSP's gapped: 1266
Number of HSP's successfully gapped: 22
Length of query: 382
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 279
Effective length of database: 13,030,455
Effective search space: 3635496945
Effective search space used: 3635496945
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)