Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR088W85083541490.0
Sklu_1979.384784724670.0
Kwal_55.2156687384422750.0
KLLA0E21945g84785220550.0
YOR038C (HIR2)87587419180.0
Scas_699.4288579117620.0
CAGL0I00968g99747112861e-163
AGR168W8256382242e-18
Scas_702.168163322161e-17
YBL008W (HIR1)8402121893e-14
KLLA0A04928g8612391777e-13
Kwal_47.174658002351704e-12
CAGL0E02805g8402011571e-10
KLLA0E11143g4931041176e-06
Kwal_27.10385536981123e-05
YML102W (CAC2)46875900.011
Sklu_2406.1142684860.031
Scas_512.3534107860.041
AER280C51090860.041
Scas_605.1842469820.11
KLLA0F26653g791168770.52
ADR242C52159750.87
CAGL0B03575g41966721.8
CAGL0J06512g54590712.3
Scas_658.144273712.4
Scas_657.1341154702.9
Kwal_27.1223931695693.3
Scas_615.8d58185694.1
Scas_701.45127664685.4
Sklu_2167.530375675.8
Kwal_33.1484356777677.3
Sklu_2173.2515120669.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR088W
         (835 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR088W [1135] [Homologous to ScYOR038C (HIR2) - SH] complement(...  1602   0.0  
Sklu_1979.3 YOR038C, Contig c1979 4836-7379                           954   0.0  
Kwal_55.21566                                                         880   0.0  
KLLA0E21945g complement(1948687..1951230) similar to sp|P32480 S...   796   0.0  
YOR038C (HIR2) [4850] chr15 complement(402760..405387) Histone t...   743   0.0  
Scas_699.42                                                           683   0.0  
CAGL0I00968g 78375..81368 similar to sp|P32480 Saccharomyces cer...   499   e-163
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    91   2e-18
Scas_702.16                                                            88   1e-17
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    77   3e-14
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    73   7e-13
Kwal_47.17465                                                          70   4e-12
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    65   1e-10
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    50   6e-06
Kwal_27.10385                                                          48   3e-05
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    39   0.011
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      38   0.031
Scas_512.3                                                             38   0.041
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    38   0.041
Scas_605.18                                                            36   0.11 
KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces...    34   0.52 
ADR242C [1983] [Homologous to ScYMR131C (RRB1) - SH] (1126443..1...    33   0.87 
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    32   1.8  
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    32   2.3  
Scas_658.1                                                             32   2.4  
Scas_657.13                                                            32   2.9  
Kwal_27.12239                                                          31   3.3  
Scas_615.8d                                                            31   4.1  
Scas_701.45                                                            31   5.4  
Sklu_2167.5 YGL213C, Contig c2167 8275-9186                            30   5.8  
Kwal_33.14843                                                          30   7.3  
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            30   9.1  

>ACR088W [1135] [Homologous to ScYOR038C (HIR2) - SH]
           complement(515561..518113) [2553 bp, 850 aa]
          Length = 850

 Score = 1602 bits (4149), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 782/835 (93%), Positives = 782/835 (93%)

Query: 1   MKLLKYPRQLHDXXXXXXXXXXXXXXXXXRDRISAYDCGKLQAAARGELAVREVSAEVEL 60
           MKLLKYPRQLHD                 RDRISAYDCGKLQAAARGELAVREVSAEVEL
Sbjct: 1   MKLLKYPRQLHDGQLLAGCVVGGLLVVVGRDRISAYDCGKLQAAARGELAVREVSAEVEL 60

Query: 61  QVEVGEDALRYXXXXXXXXXXXXDRQIWAAGADWRSAGRGTRFLTVAQLAGGACVTDVKA 120
           QVEVGEDALRY            DRQIWAAGADWRSAGRGTRFLTVAQLAGGACVTDVKA
Sbjct: 61  QVEVGEDALRYVAGGEGELVVAGDRQIWAAGADWRSAGRGTRFLTVAQLAGGACVTDVKA 120

Query: 121 DGAGLVFVSVSGKDEVWLYATGAWERVGVVTLAAKPVTLVVDPLGELLTVVLQNRSVAVY 180
           DGAGLVFVSVSGKDEVWLYATGAWERVGVVTLAAKPVTLVVDPLGELLTVVLQNRSVAVY
Sbjct: 121 DGAGLVFVSVSGKDEVWLYATGAWERVGVVTLAAKPVTLVVDPLGELLTVVLQNRSVAVY 180

Query: 181 QYNRQGAVRMHQQLPQYVQTNPLRYSITMSPQGDLLPLVNSIKNGLPSAQLLDRTAGFSV 240
           QYNRQGAVRMHQQLPQYVQTNPLRYSITMSPQGDLLPLVNSIKNGLPSAQLLDRTAGFSV
Sbjct: 181 QYNRQGAVRMHQQLPQYVQTNPLRYSITMSPQGDLLPLVNSIKNGLPSAQLLDRTAGFSV 240

Query: 241 QSTLVGYVDKCKILRFSPRLYEKPNKDKPPTQYNLLASSGNEDGSVIVWNTKRTKPLLNA 300
           QSTLVGYVDKCKILRFSPRLYEKPNKDKPPTQYNLLASSGNEDGSVIVWNTKRTKPLLNA
Sbjct: 241 QSTLVGYVDKCKILRFSPRLYEKPNKDKPPTQYNLLASSGNEDGSVIVWNTKRTKPLLNA 300

Query: 301 AKVTDTFINDVQWSRDGTGLFAISNDGYLFIFAFHEVELGRLLDDAELEKLRQSVXXXXX 360
           AKVTDTFINDVQWSRDGTGLFAISNDGYLFIFAFHEVELGRLLDDAELEKLRQSV     
Sbjct: 301 AKVTDTFINDVQWSRDGTGLFAISNDGYLFIFAFHEVELGRLLDDAELEKLRQSVPRLEP 360

Query: 361 XXXXXXXXXAKSEAKPQQDTKPDAKSSANSVSAKTGKKKIAPTVITSTSMEFNEPSYTVP 420
                    AKSEAKPQQDTKPDAKSSANSVSAKTGKKKIAPTVITSTSMEFNEPSYTVP
Sbjct: 361 LPPPTPKSLAKSEAKPQQDTKPDAKSSANSVSAKTGKKKIAPTVITSTSMEFNEPSYTVP 420

Query: 421 KDLKRRPKQETQRTGPPTKRPKRDVEPMDFLDTNLLIPNISFSKARLATPKVRMNFQYCN 480
           KDLKRRPKQETQRTGPPTKRPKRDVEPMDFLDTNLLIPNISFSKARLATPKVRMNFQYCN
Sbjct: 421 KDLKRRPKQETQRTGPPTKRPKRDVEPMDFLDTNLLIPNISFSKARLATPKVRMNFQYCN 480

Query: 481 TLQQNLVMEVKNGTGSEQKPTSITLTLKDKEKDMVLFQDFTPRFVTICTCGHSFWACCTE 540
           TLQQNLVMEVKNGTGSEQKPTSITLTLKDKEKDMVLFQDFTPRFVTICTCGHSFWACCTE
Sbjct: 481 TLQQNLVMEVKNGTGSEQKPTSITLTLKDKEKDMVLFQDFTPRFVTICTCGHSFWACCTE 540

Query: 541 EGIVYVYSNTGKKLLPPMIMGVPVSFLEGCGDYLLCVTSMGQLFCWNVKEGKLKFPVNTI 600
           EGIVYVYSNTGKKLLPPMIMGVPVSFLEGCGDYLLCVTSMGQLFCWNVKEGKLKFPVNTI
Sbjct: 541 EGIVYVYSNTGKKLLPPMIMGVPVSFLEGCGDYLLCVTSMGQLFCWNVKEGKLKFPVNTI 600

Query: 601 YPLLNPSIRYSDDVLTRAENITMCTTTENGIPLVTLSNGDGYMFDPDMEIWLLINDSWWA 660
           YPLLNPSIRYSDDVLTRAENITMCTTTENGIPLVTLSNGDGYMFDPDMEIWLLINDSWWA
Sbjct: 601 YPLLNPSIRYSDDVLTRAENITMCTTTENGIPLVTLSNGDGYMFDPDMEIWLLINDSWWA 660

Query: 661 YGSQYWDFTNTSHAGSSAAAGNDKEDKKNKYWNADAEYLIEEXXXXXXXXXXYLESKTND 720
           YGSQYWDFTNTSHAGSSAAAGNDKEDKKNKYWNADAEYLIEE          YLESKTND
Sbjct: 661 YGSQYWDFTNTSHAGSSAAAGNDKEDKKNKYWNADAEYLIEEVKKNKKSVVNYLESKTND 720

Query: 721 EMTRKGLIRNLQRFAKTILMKEGFENLEDIVTLSHLENRLLVALKLNETNEFTKLLKVYC 780
           EMTRKGLIRNLQRFAKTILMKEGFENLEDIVTLSHLENRLLVALKLNETNEFTKLLKVYC
Sbjct: 721 EMTRKGLIRNLQRFAKTILMKEGFENLEDIVTLSHLENRLLVALKLNETNEFTKLLKVYC 780

Query: 781 ISLAEMGFKNRLDDVLSWLYNDGEYKVGTIANEKREELLKQILVACADIRQVQRV 835
           ISLAEMGFKNRLDDVLSWLYNDGEYKVGTIANEKREELLKQILVACADIRQVQRV
Sbjct: 781 ISLAEMGFKNRLDDVLSWLYNDGEYKVGTIANEKREELLKQILVACADIRQVQRV 835

>Sklu_1979.3 YOR038C, Contig c1979 4836-7379
          Length = 847

 Score =  954 bits (2467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/847 (55%), Positives = 595/847 (70%), Gaps = 27/847 (3%)

Query: 1   MKLLKYPRQLHDXXXXXXXXXXXXXXXXXRDRISAYDCGKLQAAARGELAVREVSAEVEL 60
           MKLLKYP+QLHD                  +R+S +D  +L   A G+ +  E+S     
Sbjct: 1   MKLLKYPKQLHDGNLGACAAIHDRLVTVGSERVSVWDTKQLLDTAMGKSSANELSELFSS 60

Query: 61  QVEVGEDALRYXXXXXXXXXXXXDRQIWAAGADWRSAGRGTRFLTVAQLAGGACVTDVKA 120
           +     + L Y            D  ++ A + W        F ++ ++   + +TD+K 
Sbjct: 61  KGNFNNEKLCYVFATDKKLFVGTDHALFYADS-WLETREKMVFHSIYRVEPPSTITDIKY 119

Query: 121 DGAG---LVFVSVSGKDEV-WLYATGAWERVGVVTLAAKPVTLVVDPLGELLTVVLQNRS 176
           D       + VS++ K  V  LY      R+  + L  KP+T ++DP+G++ T+V   RS
Sbjct: 120 DPLNNILFILVSLTSKKNVAILYEGRTCTRLAEILLPTKPMTGIIDPMGQIFTIVGAARS 179

Query: 177 VAVYQYNRQGAVRMHQQLPQYVQTNPLRYSITMSPQGDLLPLVNSIKNGLPSAQLLDRTA 236
           +++YQYN +G+ ++  QLPQYVQ +P+ Y++TMSP  D +P++NS++N  PS  LLDR  
Sbjct: 180 ISIYQYNSKGSYKLVHQLPQYVQIDPVHYTVTMSPPADTIPIINSLRNSTPSVVLLDRNN 239

Query: 237 GFSVQSTLVGYVDKCKILRFSPRLYEKPNKDKPPTQYNLLASSGNEDGSVIVWNTKRTKP 296
            F V +TLVGY  KCKIL+FSP LYEK NK    T+YNLLASSGNE+GSV VWNTKR +P
Sbjct: 240 EFKVSTTLVGYDSKCKILKFSPNLYEKTNKTGT-TRYNLLASSGNENGSVAVWNTKRARP 298

Query: 297 LLNAAKVTDTFINDVQWSRDGTGLFAISNDGYLFIFAFHEVELGRLLDDAELEKLRQSVX 356
           L NAA +  TFIND+ W+ DG GLFA+S+DGY+++FAF E ELG++L   E  KL+ S+ 
Sbjct: 299 LFNAAGIAKTFINDLVWNDDGMGLFAVSDDGYMYVFAFQEKELGQVLPQEETVKLQASIK 358

Query: 357 XXXXXXXXXXXXXAKSEAKPQQDTKPDAK--SSAN-----SVSAKTGKKKIAPTVITSTS 409
                           E KP  D KP     SS N     +   K+GKKK+ PT I STS
Sbjct: 359 KLEPL--------PTEELKPSHDIKPKTSGGSSVNLSLNPTTVTKSGKKKVVPTTIQSTS 410

Query: 410 MEFNEPSYTVPKDLKRRPK-QETQRTGPPTKRPKRDVEPMDFLDTNLLIPNISFSKARLA 468
           MEFN PSY+VPKDLKR+PK +ET   G   K+ K+DV+PMDFLDTN+L+PNISFSK RLA
Sbjct: 411 MEFNPPSYSVPKDLKRKPKDEETMVNG---KKQKKDVDPMDFLDTNILMPNISFSKLRLA 467

Query: 469 TPKVRMNFQYCNTLQQNLVMEVKNGTGSEQKPTSITLTLKDKEKDMVLFQDFTPRFVTIC 528
           TPK+R++FQY     +NL+ +VKNGTG+EQKPTSI+L LK+ E+D ++FQDF P+FVT+ 
Sbjct: 468 TPKIRVSFQYSPVHNKNLIFDVKNGTGNEQKPTSISLLLKEPEQDRMIFQDFIPKFVTLS 527

Query: 529 TCGHSFWACCTEEGIVYVYSNTGKKLLPPMIMGVPVSFLEGCGDYLLCVTSMGQLFCWNV 588
           + G SFWACCTE+G +YVYS+TGK+LLPPMIMGVP SFLE CG YLLCVTSMGQL+CW++
Sbjct: 528 SAGESFWACCTEDGTLYVYSDTGKRLLPPMIMGVPCSFLEACGKYLLCVTSMGQLYCWDI 587

Query: 589 KEGKLKFPVNTIYPLLNPSIRYSDDVLTRAENITMCTTTENGIPLVTLSNGDGYMFDPDM 648
              +LKFPVNT+YPLLNP +RYSDD+LTRAENITMCT T+NG+PL+TLSNGDGYMFD DM
Sbjct: 588 DCKRLKFPVNTVYPLLNPVLRYSDDILTRAENITMCTITKNGVPLLTLSNGDGYMFDCDM 647

Query: 649 EIWLLINDSWWAYGSQYWDFTNTSHAGSSAAAGNDKEDKKNKYWNADAEYLIEEXXXXXX 708
           E WLLI+DSWWAYGSQYWD TNT+  G     G+DK+DKKN+YWN +AE L+        
Sbjct: 648 ETWLLISDSWWAYGSQYWDMTNTN--GVVVTTGSDKDDKKNRYWNPEAENLVSNVRSNKS 705

Query: 709 XXXXYLESKTNDEMTRKGLIRNLQRFAKTILMKEGFENLEDIVTLSHLENRLLVALKLNE 768
               YLESKTNDE++RKG IRNLQ+FAKTILMKEGFENLEDIVTLSHLENR+LV+LKL E
Sbjct: 706 SIVNYLESKTNDELSRKGRIRNLQKFAKTILMKEGFENLEDIVTLSHLENRVLVSLKLGE 765

Query: 769 TNEFTKLLKVYCISLAEMGFKNRLDDVLSWLYNDGEYKVGTIANEKREELLKQILVACAD 828
             EFT+LL VYCI L EMG+KNRL+DVL WLYN+G YK+  IA   REELLKQILVACAD
Sbjct: 766 DQEFTRLLIVYCIRLGEMGYKNRLNDVLQWLYNNGNYKMEKIAGTTREELLKQILVACAD 825

Query: 829 IRQVQRV 835
           IRQVQRV
Sbjct: 826 IRQVQRV 832

>Kwal_55.21566
          Length = 873

 Score =  880 bits (2275), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/844 (51%), Positives = 578/844 (68%), Gaps = 19/844 (2%)

Query: 1   MKLLKYPRQLHDXXXXXXXXXXXXXXXXXRDRISAYDCGKLQAAARGELAVREVSAEVEL 60
           MKLLKYPR LH                  +D +  + C +L  AA G ++ +EV  + E+
Sbjct: 25  MKLLKYPRALHSGKIVGCACIGDNLVTAGQDSVCVWSCSQLVGAAMGNISAKEVREKFEI 84

Query: 61  QV-EVGEDALRYXXXXXXXXXXXXDRQIWAAGADWRSAGRGTRFLTVAQLAGGACVTDVK 119
           +V E   + LR             DR +  A +     G  T F T+  +   ACVTDVK
Sbjct: 85  KVLEARLEPLRLVVGSDACLYVGTDRTVLYADS-LLEKGEKTSFQTLYHVEAPACVTDVK 143

Query: 120 AD-GAGLVFVSVSGKDE----VWLYATGAWERVGVVTL-AAKPVTLVVDPLGELLTVVLQ 173
            D   G +FV V+  +E      L A G   +VG ++L A+KP+T VVDP G++ TV+  
Sbjct: 144 FDFQTGTIFVLVNQGNEGNYVALLDAAGGGAQVGQISLGASKPITGVVDPAGQIFTVICA 203

Query: 174 NRSVAVYQYNRQGAVRMHQQLPQYVQTNPLRYSITMSPQGDLLPLVNSIKNGLPSAQLLD 233
           +R+V+V+QY   G+ ++  +L  Y+Q +PLRYSI+MSPQ D LPL+NS+    P+  LLD
Sbjct: 204 DRNVSVFQYGAGGSHKLLHRLNHYLQVDPLRYSISMSPQADTLPLLNSMSGSTPAILLLD 263

Query: 234 RTAGFSVQSTLVGYVDKCKILRFSPRLYEKPNKDKPPTQYNLLASSGNEDGSVIVWNTKR 293
           R +GF +++TLVG+ DKC+I +FSP LYEK  K      YNL A+SG + GSV++WNTKR
Sbjct: 264 RKSGFKLRATLVGHFDKCQICQFSPSLYEKVQKSGTKVTYNLAATSGFDTGSVVIWNTKR 323

Query: 294 TKPLLNAAKVTDTFINDVQWSRDGTGLFAISNDGYLFIFAFHEVELGRLLDDAELEKLRQ 353
            KPLLN     D+F+ D+QWS DG+ LFA++N+G LFIFAF + ELG+ L  + ++KLR 
Sbjct: 324 LKPLLNTKCTEDSFVTDLQWSDDGSTLFAVTNNGLLFIFAFRDEELGKTLPKSHVDKLRS 383

Query: 354 SVXXXXXXXXXXXXXXAKSEAKPQQDTKPD--AKSSANSVSAKTGKKKIAPTVITSTSME 411
                                   Q  KP+  A  S+  ++   GK K+APT I S SME
Sbjct: 384 DCATLSPLPPTEVPDL-------NQTIKPEIVAPGSSGVITKVNGKNKVAPTTIRSLSME 436

Query: 412 FNEPSYTVPKDLKRRPKQETQRTGPPTKRPKRDVEPMDFLDTNLLIPNISFSKARLATPK 471
           F  PSY+VPKDLKRRPK   Q T    K+ K D+EPMDFLDT+LL+P +SFSK RLA PK
Sbjct: 437 FIAPSYSVPKDLKRRPKDPLQAT--TNKKQKHDLEPMDFLDTSLLMPTVSFSKVRLAAPK 494

Query: 472 VRMNFQYCNTLQQNLVMEVKNGTGSEQKPTSITLTLKDKEKDMVLFQDFTPRFVTICTCG 531
           VR++F Y  +   +L + VKNG+G+EQ PT ITL LK+  ++  +F+DF P+ +TICT G
Sbjct: 495 VRLSFTYYPSTSDSLAISVKNGSGNEQTPTVITLKLKESGQEKTIFEDFLPKLITICTSG 554

Query: 532 HSFWACCTEEGIVYVYSNTGKKLLPPMIMGVPVSFLEGCGDYLLCVTSMGQLFCWNVKEG 591
            +FW+CC+++G VYVYS++G+KLLPPMIMGVP SFLE CG++LLCVTS+GQ++CWNV   
Sbjct: 555 DNFWSCCSDDGTVYVYSDSGRKLLPPMIMGVPCSFLEACGNFLLCVTSIGQVYCWNVDAS 614

Query: 592 KLKFPVNTIYPLLNPSIRYSDDVLTRAENITMCTTTENGIPLVTLSNGDGYMFDPDMEIW 651
           +L FP  ++YPLL+P++R+SDDVLTRAENITMCT T +G+P+VTLSNGDGYM+D  ME+W
Sbjct: 615 RLLFPPTSLYPLLSPNLRFSDDVLTRAENITMCTLTASGVPIVTLSNGDGYMYDKVMEVW 674

Query: 652 LLINDSWWAYGSQYWDFTNTSHAGSSAAAGNDKEDKKNKYWNADAEYLIEEXXXXXXXXX 711
           +LINDSWWAYGSQYWD T T+  G+ A+  NDK DKKN+ WN++A+ L E          
Sbjct: 675 MLINDSWWAYGSQYWDTTKTTTNGTYASEPNDKHDKKNQNWNSEAKGLTESLKENKSSIL 734

Query: 712 XYLESKTNDEMTRKGLIRNLQRFAKTILMKEGFENLEDIVTLSHLENRLLVALKLNETNE 771
            YLES+TNDE+ RKG +RNLQ+FAKTILMKEG+ENLE++VTLSHLEN+LLV+L+L+E  E
Sbjct: 735 NYLESRTNDELNRKGRVRNLQKFAKTILMKEGYENLEEVVTLSHLENKLLVSLRLHEYEE 794

Query: 772 FTKLLKVYCISLAEMGFKNRLDDVLSWLYNDGEYKVGTIANEKREELLKQILVACADIRQ 831
           FTKLL +YCI L+EMG+KNRLDDVL WLY+DG YK  ++A  K EELL++ILVACADIR 
Sbjct: 795 FTKLLTIYCIRLSEMGYKNRLDDVLQWLYDDGNYKAKSVAGVKAEELLRKILVACADIRH 854

Query: 832 VQRV 835
           VQRV
Sbjct: 855 VQRV 858

>KLLA0E21945g complement(1948687..1951230) similar to sp|P32480
           Saccharomyces cerevisiae YOR038c HIR2 histone
           transcription regulator, start by similarity
          Length = 847

 Score =  796 bits (2055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/852 (47%), Positives = 554/852 (65%), Gaps = 37/852 (4%)

Query: 1   MKLLKYPRQLHDXXXXXXXXXXXXXXXXXRDRISAYDCGKLQAAARGELAVREVSAEVEL 60
           MKLLK P +LHD                    +S +D   L  AA G+  V+EV    ++
Sbjct: 1   MKLLKLPSKLHDGQLTQCEVDDNKLYIIGGKYLSIWDSQTLLNAATGKTDVKEVKELEKM 60

Query: 61  QVEVGEDALRYXXXXXXXXXXXXDRQIWAAGADW--------RSAGRGTRFLTVAQLAGG 112
            +++ E                 D Q    G+D         + +    +   +      
Sbjct: 61  SLDLLE-----SNQEDGRWLVVLDNQRLVYGSDHLLACLDLNKDSNSEYKSREIGIFKDN 115

Query: 113 ACVTDVKADGA-GLVFVSVSGKDEVWLYATGAWERVGVVTLAAKPVTLVVDPLGELLTVV 171
             +TD+K D   GL+FVS+S  + + +  +  WE    + L +KP++++ DPLG+LLTV+
Sbjct: 116 EAITDLKYDKVNGLLFVSLSKANSLQIMDSKTWELKSSIELKSKPISIITDPLGQLLTVI 175

Query: 172 LQNRSVAVYQYNRQGAVRMHQQLPQYVQTNPLRYSITMSPQGDLLPLVNSIKNGLPSAQL 231
           LQNRSV +YQY+  G  ++HQ + Q+VQTNPL Y +TMSPQGD++P++NS+ N +P+A L
Sbjct: 176 LQNRSVQIYQYDSHGTTKLHQSINQFVQTNPLPYRMTMSPQGDVIPMINSLHNNVPTAVL 235

Query: 232 LDRTAGFSVQSTLVGYVDKCKILRFSPRLYEKPNKDKPPTQ-----YNLLASSGNEDGSV 286
           LDR   F ++ +LVGYV  CKIL+FSPR+Y   +K K PT      +NLLASSGNEDG+V
Sbjct: 236 LDRIQKFKIKLSLVGYVADCKILKFSPRIY---SKTKSPTSNDTQTFNLLASSGNEDGNV 292

Query: 287 IVWNTKRTKPLLNAAKVTDTFINDVQWSRDGTGLFAISNDGYLFIFAFHEVELGRLLDDA 346
           +VWNT R KPL +A+KV +++I D++W   G GLFAIS DG L IFAF E ELG   D  
Sbjct: 293 VVWNTNRIKPLFDASKVVNSYITDLEWDNSGLGLFAISQDGQLVIFAFQENELG---DVM 349

Query: 347 ELEKLRQSVXXXXXXXXXXXXXXAKSEAKPQQDTKPDAKSSANSVSAKTGKKKIAPTVIT 406
            +E + ++               A+   +P     P+  +   + ++K   K    T I+
Sbjct: 350 PVEAVTEAAKEIKLLDPLPFKPKAE---EPDTKLPPNKTAQQTTTNSKKQPKAAEITTIS 406

Query: 407 STSMEFNEPSYTVPKDLKRRPKQE---TQRTGPPTKRPKRDVEPMDFLDTNLLIPNISFS 463
           ST+MEF +PSY VPKDLKR+P  E     +  P  K+ K++++ +DFLDTNL +P++SFS
Sbjct: 407 STNMEFIQPSYMVPKDLKRKPVTEDPLLAQNKPANKKAKKELDQIDFLDTNLFLPSVSFS 466

Query: 464 KARLATPKVRMNFQYCNTLQQNLVMEVKNGTGSEQKPTSITLTLKDKEKDMVLFQDFTPR 523
           K RLA PK+R +FQY +  Q N V+++KNG G++QKPTSITLT KD E    LFQ F P+
Sbjct: 467 KVRLAHPKIRASFQYSS--QGNFVLDIKNGLGNDQKPTSITLTRKDNESSKQLFQTFLPK 524

Query: 524 FVTICTCGHSFWACCTEEGIVYVYSNTGKKLLPPMIMGVPVSFLEGCGDYLLCVTSMGQL 583
           FVT+C+ G SFWA  T+ G++YV S +G+ L PPM++GVPVSFLEG GDYLLC+TS+GQ+
Sbjct: 525 FVTLCSAGSSFWAWSTDTGMIYVTSISGQMLFPPMLLGVPVSFLEGSGDYLLCITSIGQM 584

Query: 584 FCWNVKEGKLKFPVNTIYPLLNPSIRYSDDVLTRAENITMCTTTENGIPLVTLSNGDGYM 643
           +CWNV  GK+ FP+N +Y LLNP +RYSDDVL+RAENITMC  T  GIP+VTLSNGDGYM
Sbjct: 585 YCWNVNTGKIAFPINDVYSLLNPMLRYSDDVLSRAENITMCAVTSQGIPIVTLSNGDGYM 644

Query: 644 FDPDMEIWLLINDSWWAYGSQYWDFTNTSHAGSSAAAGNDKEDKKNKYWNADAEYLIEEX 703
           FD  ME W+LINDSWW YGSQYW+F   S AG    + +D  +KK+KYWNA+A+ L +E 
Sbjct: 645 FDSAMEAWMLINDSWWPYGSQYWNF--MSSAGVDLTSNDD--EKKDKYWNAEADILAKEV 700

Query: 704 XXXXXXXXXYLESKTNDEMTRKGLIRNLQRFAKTILMKEGFENLEDIVTLSHLENRLLVA 763
                    YLE+KTNDE+TRKG +++LQRFAK +LMKEGFENLE+++TL+HLEN++LV+
Sbjct: 701 KNNKNSIINYLETKTNDELTRKGRMKHLQRFAKVLLMKEGFENLEEMITLAHLENKILVS 760

Query: 764 LKLNETNEFTKLLKVYCISLAEMGFKNRLDDVLSWLYNDGEYKVGTIANEKREELLKQIL 823
            +L E  E  +LLK+YCI +AEMG+ +R    LSWLY+    K   +  ++R  L+K I+
Sbjct: 761 FRLKEVEEAIRLLKIYCIRIAEMGYTDRFSQTLSWLYDPTNTKFSPLDIDRRRNLIKDII 820

Query: 824 VACADIRQVQRV 835
           ++CA+IRQVQRV
Sbjct: 821 ISCANIRQVQRV 832

>YOR038C (HIR2) [4850] chr15 complement(402760..405387) Histone
           transcription regulator, required for periodic
           repression of three of the four histone gene loci and
           for autogenous repression of HTA1-HTB1 locus by H2A and
           H2B [2628 bp, 875 aa]
          Length = 875

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/874 (44%), Positives = 556/874 (63%), Gaps = 50/874 (5%)

Query: 1   MKLLKYPRQLHDXXXXXXXXXXXXXXXXXRD-RISAYDCGKLQAAARGELAVREVSAEVE 59
           M+LLKYP  +H+                     + A+   +L   A   + ++++  EV 
Sbjct: 1   MRLLKYPLDIHNEQVNALAALGPYIILAGSGGHVMAWRQQQLVDTAFDRVMIKDLKPEVS 60

Query: 60  LQVEVGEDA-LRYXXXXXXXXXXXXDRQIWAAGA-------DWRSAGRGTRFLTVAQLAG 111
            QV+      + +            + ++W           +  S  +    L + +   
Sbjct: 61  FQVDQDTTGDIFFITGDLETLYIGSEHRLWGYSGWLCRDTNNINSVEKMNSKL-LFECKS 119

Query: 112 GACVTDVKAD-GAGLVFVSVSGKDEVWLYATGAWERVGVVTL--AAKPVTLVVDPLGELL 168
            + +TDVK D   G++FV +S ++++ L+    ++++  +T+  A+KP+T ++DP G+  
Sbjct: 120 PSTITDVKYDINLGILFVLLSNENKILLFRHKTFDKLSEITIDKASKPITGIIDPTGQTF 179

Query: 169 TVVLQNRSVAVYQYNRQGAVRMHQQLPQYVQTNPLRYSITMSPQGDLLPLVNSIK----N 224
           TV+  +RS+ VYQ N+ G  ++  +L Q+VQ  PL Y I+MSPQ D+LP++NS+K    N
Sbjct: 180 TVMTSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVINSVKGVPNN 239

Query: 225 GLPSAQLLDRTAGFSVQSTLVG-YVDKCKILRFSPRLYEKPN-KDKPPTQYNLLASSGNE 282
                 LLDR   + V  TLV    + C++L +SP  YEKPN K    T+YNL+A+SG+ 
Sbjct: 240 ATSCTALLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFYEKPNLKKGTSTRYNLIATSGST 299

Query: 283 DGSVIVWNTKRTKPLLNAAKVTDTFINDVQWSRDGTGLFAISNDGYLFIFAFHEVELGRL 342
           DG+++VWNTKR KPL NA +V+ T IND+ WS+DG  LFAISND  L+ FAF E +LG  
Sbjct: 300 DGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKDLGVA 359

Query: 343 LDDAELEKLRQSVXXXXXXXXXXXXXXAKSEAKPQQDTKPDAKSSA--------NSVSAK 394
           L   E++ L++                 KS   P+     ++ S+A        ++V  K
Sbjct: 360 LPQTEIKSLQEVNKKLPKLEEPLAEQIPKSF--PENIKLEESASAAPIPNDIGRSAVGKK 417

Query: 395 TGKKKIAPT------VITSTSMEFNEPSYTVPKDLKRRPKQET-QRTGPPTKRPKRDVEP 447
             KKK A         I STSMEFN PSYTVP+DLKR+PK+ T     P +K+ K++++P
Sbjct: 418 PTKKKTANNQTNGIKTIQSTSMEFNTPSYTVPRDLKRKPKEATPSNIAPGSKKQKKELQP 477

Query: 448 MDFLDTNLLIPNISFSKARLATPKVRMNFQYCNTLQQNLVMEVKNGTGSEQKPTSITLTL 507
           +DFLDT LL+PN SFS+ RLATPK+R  F+Y      NL+++VKNG+G+EQ+PT + LT 
Sbjct: 478 IDFLDTGLLLPNTSFSRIRLATPKIRSTFKYSPINNPNLILDVKNGSGNEQRPTIVKLTS 537

Query: 508 KDKEKDMVLFQDFTPRFVTICTCGHSFWACCTEEGIVYVYSNTGKKLLPPMIMGVPVSFL 567
           K  ++D VLFQDF P+ +TICT G +FW+ C+E+G +Y+YS++G+KL+ P+++GV +SFL
Sbjct: 538 KVLDQDQVLFQDFIPKLITICTAGDTFWSFCSEDGSIYIYSDSGRKLMAPLVLGVSISFL 597

Query: 568 EGCGDYLLCVTSMGQLFCWNVKEGKLKFPVNTIYPLLNPSIRYSDDVLTRAENITMCTTT 627
           E CG YLLC+TS+G+L+CWN+++ KL FP NTIYPLLNPS+RYSDD+LTRAENIT+C+ T
Sbjct: 598 EACGTYLLCLTSIGELYCWNIEQKKLAFPTNTIYPLLNPSLRYSDDILTRAENITLCSIT 657

Query: 628 ENGIPLVTLSNGDGYMFDPDMEIWLLINDSWWAYGSQYWDFTNTSHAGSSAA---AGNDK 684
           + G+PLVTLSNGDGY+FD +ME WLL++D WWAYGSQYWD TNT+   SS A   + N  
Sbjct: 658 KKGVPLVTLSNGDGYLFDKNMETWLLVSDGWWAYGSQYWDTTNTTGLSSSKANTDSFNGS 717

Query: 685 EDKKNKYWNADAEYLIEEXXXXXXXXXXYLESKTNDEMTRKGLIRNLQRFAKTILMKEGF 744
           E   N+        ++ +          +LE KTNDE+ RKG I+NLQRFA+TILMKEGF
Sbjct: 718 ESNINE--------IVSDIKNDNQSIINFLECKTNDELNRKGRIKNLQRFARTILMKEGF 769

Query: 745 ENLEDIVTLSHLENRLLVALKLNETNEFTKLLKVYCISLAEMGFKNRLDDVLSWLYNDGE 804
           EN+E+IVTLSHLEN++L++++L E  EF+KL+ VYCI L+E+G+ +RL+DV  WLY+D  
Sbjct: 770 ENMEEIVTLSHLENKILISIRLEEPEEFSKLMMVYCIRLSELGYMDRLNDVFQWLYDDLP 829

Query: 805 YK-VGTIANEK--REELLKQILVACADIRQVQRV 835
               G+   +K  +  LLK+IL+AC DIRQVQRV
Sbjct: 830 ISGTGSAFADKDFKRNLLKKILIACGDIRQVQRV 863

>Scas_699.42
          Length = 885

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/791 (45%), Positives = 489/791 (61%), Gaps = 66/791 (8%)

Query: 93  DWRSAGRGTRFLTVAQLAGGA--CVTDVKADGAG-LVFVSVSGKDEVWLYATGAWERVGV 149
           +W    +  +F  V Q   G+   +TD+K D    +V VS+   D++ L+     + + V
Sbjct: 97  NWLIRDKNKKFECVFQCHMGSDNVITDMKIDQLNKIVLVSMVSPDQILLFNLETLKLINV 156

Query: 150 V------TLAAKPVTLVVDPLGELLTVVLQNRSVAVYQYNRQGAVRMHQQLPQYVQTNPL 203
           +      +L  +P+TL++DP G   TV+  +RS+ VYQ N  G  ++    PQYVQ +PL
Sbjct: 157 IDQEFKPSLNRRPITLIIDPCGTRFTVLCSDRSMLVYQINESGNFKLLNTFPQYVQVHPL 216

Query: 204 RYSITMSPQGDLLPLVNSIKNG----LPSAQLLDRTAGFSVQSTLVG-YVDKCKILRFSP 258
            Y ITM PQGD LPL+NSIK      + +  LLD    + ++ST+V       K+L++SP
Sbjct: 217 HYKITMPPQGDTLPLINSIKGSTSKDITTTVLLDANDNYKIKSTIVSPSSSNTKVLKYSP 276

Query: 259 RLYEKPNKDK-PPTQYNLLASSGNEDGSVIVWNTKRTKPLLNAAKVTDTFINDVQWSRDG 317
            +YEK N+ K     YNLLA+SG EDG++++WNTKR KPL NA   +   IND+ WS+DG
Sbjct: 277 TIYEKTNQKKGTKVSYNLLATSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDG 336

Query: 318 TGLFAISNDGYLFIFAFHEVELGRLLDDAELEKLRQSVXXXXXXXXXXXXXXA------- 370
             LFAIS+D  L+ FAF + +LG  L   ++  LR                         
Sbjct: 337 LTLFAISDDSVLYTFAFQDNDLGDQLSIEQVTLLRDQNKKLPILSNLNLDKKVLQSKLDA 396

Query: 371 ---KSEAKPQQDTKPDAKSSANSVSAKTGKKKIAPT--------VITSTSMEFNEPSYTV 419
              KS+ K     + +  +   S   +T  K+  P         +  ST+MEFN PSY V
Sbjct: 397 CLNKSDEKTITKIQKEEGTKKPSSKRRTSLKQNLPAQSQDSMVKITQSTNMEFNPPSYNV 456

Query: 420 PKDLKRRPKQETQRTGP--------PTKRPKRDVEPMDFLDTNLLIPNISFSKARLATPK 471
           PKDLKR+  +  + + P        PTK+ KRD+EP+ FLDT LL+PN+SFS+ RLATPK
Sbjct: 457 PKDLKRKKPKVKESSTPLNGEQNPSPTKKLKRDLEPISFLDTGLLLPNVSFSRMRLATPK 516

Query: 472 VRMNFQYCNTLQQNLVMEVKNGTGSEQKPTSITL---TLKDKEKDM---VLFQDFTPRFV 525
           +R+ F Y      NL M +KNG+GSEQ P+ ++L    L+ ++KD    ++FQDF P++V
Sbjct: 517 IRLQFTYTPFSDPNLYMTIKNGSGSEQTPSIVSLYQKPLQIRQKDTQPKLIFQDFIPKYV 576

Query: 526 TICTCGHSFWACCTEEGIVYVYSNTGKKLLPPMIMGVPVSFLEGCGDYLLCVTSMGQLFC 585
             C  G SFW CCT +G +Y Y+++G++LLPPM +GVP++FL+ C  YLLCVTS+G+L+C
Sbjct: 577 CQCIAGESFWCCCTSDGTLYTYTDSGRRLLPPMTLGVPITFLQACKQYLLCVTSLGELYC 636

Query: 586 WNVKEGKLKFPVNTIYPLLNPSIRYSDDVLTRAENITMCTTTENGIPLVTLSNGDGYMFD 645
           W++   KL FP+ T+YPLL PSIRYSDDVLTR ENITMCT T  G+PL TLSNGDGY+FD
Sbjct: 637 WDLSMKKLLFPMTTVYPLLKPSIRYSDDVLTRVENITMCTVTSKGVPLATLSNGDGYIFD 696

Query: 646 PDMEIWLLINDSWWAYGSQYWDFTNTSHAGSSAAAGNDKEDKKNKYWNADAEYLIEEXXX 705
            DME WLL++D WWAYGSQYWD  N  +   S    N  E+ KN     + + LI     
Sbjct: 697 KDMESWLLVSDGWWAYGSQYWDSLNNDYKNDS----NTLEELKNA---ENKKSLIN---- 745

Query: 706 XXXXXXXYLESKTNDEMTRKGLIRNLQRFAKTILMKEGFENLEDIVTLSHLENRLLVALK 765
                   +E KTN+E+ RKG I++LQRFAKT+LMKEGFEN+E+IVTLSHLENR+LV+LK
Sbjct: 746 -------MMERKTNEELDRKGRIKHLQRFAKTLLMKEGFENMEEIVTLSHLENRILVSLK 798

Query: 766 LNETNEFTKLLKVYCISLAEMGFKNRLDDVLSWLYNDGEY-KVGTIANEKREELLKQILV 824
           L E NEF  L+  Y   L E+G+  RL+D+L W+YNDG+  K   +  + RE +LK IL+
Sbjct: 799 LEEFNEFKDLIIAYSSRLGELGYIERLNDMLQWIYNDGKMGKSDLLLGQSRELILKDILI 858

Query: 825 ACADIRQVQRV 835
           ACAD+R VQRV
Sbjct: 859 ACADMRHVQRV 869

>CAGL0I00968g 78375..81368 similar to sp|P32480 Saccharomyces
           cerevisiae YOR038c HIR2 histone transcription regulator,
           hypothetical start
          Length = 997

 Score =  499 bits (1286), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 235/471 (49%), Positives = 328/471 (69%), Gaps = 31/471 (6%)

Query: 377 QQDTKPDAKSSANSVSAKTGKKKI--APTVIT----------STSMEFNEPSYTVPKDLK 424
           ++ TKPD KS    + ++ G+ K+  A   I+          ST+ +F  PSY VPKDLK
Sbjct: 519 EKKTKPDKKS----IKSENGESKVNKAQNTISPKESNTTDNKSTTPDFKNPSYQVPKDLK 574

Query: 425 RRPKQETQRTGPPTKRPKRDVEPMDFLDTNLLIPNISFSKARLATPKVRMNFQYCNTLQQ 484
           R+PK++       TKR K+D+EP+DFLDT LL+PN++FS+ RL+TP +RMN    ++   
Sbjct: 575 RKPKEDALGNAV-TKRAKKDLEPVDFLDTGLLLPNVAFSRVRLSTPLIRMNIDCTSSNDS 633

Query: 485 NLVMEVKNGTGSEQKPTSITLTLKDKEKDMVLFQDFTPRFVTICTCGHSFWACCTEEGIV 544
            +++ ++NG+G+EQKPT + L  K    +  LFQDF P+FV++ T G  FWAC +E+G +
Sbjct: 634 KILLNIRNGSGNEQKPTIVKLLDKTVTPERTLFQDFIPKFVSLATSGDDFWACSSEDGTL 693

Query: 545 YVYSNTGKKLLPPMIMGVPVSFLEGCGDYLLCVTSMGQLFCWNVKEGKLKFPVNTIYPLL 604
           Y++++ G+K++PP+ +GVP+SFLE CG YLLCV+S+G+L+CWN+   KL+FPV TI+PLL
Sbjct: 694 YIFNDVGRKIIPPLTIGVPISFLEACGKYLLCVSSIGELYCWNIASSKLEFPVTTIFPLL 753

Query: 605 NPSIRYSDDVLTRAENITMCTTTENGIPLVTLSNGDGYMFDPDMEIWLLINDSWWAYGSQ 664
           +PSIRYSDD+LTRAENITMC+ T NG P+ TLSNGDGYM+D +ME WLL++D WWAYGSQ
Sbjct: 754 SPSIRYSDDILTRAENITMCSVTNNGFPIATLSNGDGYMYDKNMETWLLVSDGWWAYGSQ 813

Query: 665 YWDFTNTSHAGSSAAAGNDKEDKKNKYWNADAEYLIEEXXXXXXXXXXYLESKTNDEMTR 724
           YWD TN S+    ++    +     +   A    L              LE KTN+E+TR
Sbjct: 814 YWDSTNNSNLIPDSSTKPTEGQSSTEISKASIVTL--------------LEKKTNNELTR 859

Query: 725 KGLIRNLQRFAKTILMKEGFENLEDIVTLSHLENRLLVALKLNETNEFTKLLKVYCISLA 784
           KG I+NL+RFA+TILMKEGFEN+E+IVTLSHLEN+LLV L+L E +EF KL+K+Y + L 
Sbjct: 860 KGRIKNLRRFARTILMKEGFENIEEIVTLSHLENKLLVTLRLEEQHEFKKLIKLYAVKLG 919

Query: 785 EMGFKNRLDDVLSWLYNDGEYKVGTIANEKREELLKQILVACADIRQVQRV 835
           E+G+ +RL D+ +W+ +D       I    R+EL+K +L ACAD+R VQRV
Sbjct: 920 ELGYVDRLRDLFAWIISDSNDNGDLIPGINRKELVKTLLTACADLRSVQRV 970

 Score =  181 bits (460), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 106/265 (40%), Positives = 158/265 (59%), Gaps = 17/265 (6%)

Query: 103 FLTVAQLAGGACVTDVKADGA-GLVFVSVSGKDEVWLYATGAWERVGVVTLA----AKPV 157
           + TV+Q    + +TDVK D    ++FV      ++ L+ T +  +  + ++A    +KP+
Sbjct: 114 YTTVSQ----SIITDVKWDSLLDILFVLTDRPCKIHLFDTRSANKKEITSIALDKNSKPL 169

Query: 158 TLVVDPLGE-LLTVVLQNRSVAVYQYNRQGAVRMHQQLPQYVQTNPLRYSITMSPQGDLL 216
           T VVDP G    TV+  +RS+ VY  NR G  +  ++L Q+V   PL Y ITM PQ D L
Sbjct: 170 TGVVDPSGAGTFTVLTSDRSIVVYHINRTGDYKEVKKLSQHVLVYPLHYKITMPPQADFL 229

Query: 217 PLVNSIKN-----GLPSAQLLDRTAGFSVQSTLV-GYVDKCKILRFSPRLYEKPN-KDKP 269
           P++NS+K      G  +  LL+R   + V STLV       K+L  SP++YEK N K   
Sbjct: 230 PIINSLKGSSGAAGSTATVLLNRNENYKVMSTLVPSASSNTKVLVHSPKMYEKANLKRGT 289

Query: 270 PTQYNLLASSGNEDGSVIVWNTKRTKPLLNAAKVTDTFINDVQWSRDGTGLFAISNDGYL 329
            ++YNL+A+S N DGS+++WNTKR KPL     ++D+ IND+ WS +G  LFA+SND  L
Sbjct: 290 ISRYNLVATSTNTDGSIMIWNTKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDNVL 349

Query: 330 FIFAFHEVELGRLLDDAELEKLRQS 354
           + FAF + +LG+ +   E+E +RQS
Sbjct: 350 YTFAFLQDDLGKTVPMEEIENIRQS 374

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 90.9 bits (224), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 125/638 (19%), Positives = 240/638 (37%), Gaps = 151/638 (23%)

Query: 159 LVVDPLGELLTVVLQNRSVAVYQYNRQG--AVRMHQQLPQYVQTNPLR---YSITMSPQG 213
           +V DP  +       +R+V V++Y++    +  +   + +  Q +PL      ++ SP G
Sbjct: 182 VVFDPANKYFATASDDRTVKVFRYHKGTDLSFTIEHIITEPFQGSPLTTYFRRLSWSPDG 241

Query: 214 DLLPLVNSIKNGLPSAQLLDRTAGFSVQSTLVGYVDKCKILRFSPRLYEK---------- 263
             + + N+    + +  ++ R   +    +LVG+    ++  F+PRL+E           
Sbjct: 242 QHIAVPNATNGPVSTVAIISR-GNWDTSVSLVGHDQPTEVACFNPRLFEHNDNHERGEEV 300

Query: 264 --PNKD-------------KPPTQYNLLASSGNEDGSVIVWNTKRTKPLLNAAKVTDTFI 308
              +KD             K   + + + ++  +D ++ VW+T R +P+  A  +T   +
Sbjct: 301 DGASKDNSAASESSGKRRLKDDDRVDSVIATAGQDKTLAVWSTSRARPIFVAYDLTSKSV 360

Query: 309 NDVQWSRDGTGLFAISNDGYLFIFAFHEVELGRLLD-DAELEKL------RQSVXXXXXX 361
            D+ W+ DGT LF  S DG + +  F E ELG+ +  +  +E+L      + S+      
Sbjct: 361 TDIAWTCDGTALFLTSLDGRIIVITFEEGELGKAIPLEQNVEQLHRYGVDKDSLVFPESV 420

Query: 362 XXXXXXXXAKSEAKPQQDTK-------------------------------PDAKSSA-- 388
                   A+   KP  +T                                P A++ A  
Sbjct: 421 KQLILEDKARQYKKPYIETTLLESRIGTVKKPNVLNPRPKHAKNDVAVASIPQAQAPALK 480

Query: 389 ------NSVSAKTGKKKIAPTVITS-----TSMEFNEPSYTVPKDL--KRRPKQET---- 431
                 N+ + + GKK++APT+I++      +++F EP  ++  D   K+ P ++T    
Sbjct: 481 KKEGPLNAATVQNGKKRVAPTLISTGYARAATVKF-EPRSSIDSDFAGKKEPLKDTSYAL 539

Query: 432 --QRTGPPTKRPK--------------------RDVEPMDF----------------LDT 453
             + + P    P+                     D E MD                 L  
Sbjct: 540 AGKISQPSLPLPRLGVHTLIMGVKERGAERFYVEDEESMDDDAEVADEEDETKNEHPLTL 599

Query: 454 NLLI---------PNISFSKARLATPKVRMNFQYCNTLQQNLVMEVKNGTGSE------- 497
           NL           PN+ + +     P   +       L    ++E++NG           
Sbjct: 600 NLKTTPERVWKDEPNLRYLEYPGVIPDADVVICQYGDLDDLHILEIRNGVERSIQFDREA 659

Query: 498 --QKPTSITLTLKDKEKDMVLFQDFTPRFVTICTCGHS--FWACCTEEGIVYVYSNTGKK 553
             + PT I L     E+ +   + F P  V  C    +   WA  T  G +Y+Y N G+ 
Sbjct: 660 LFENPTKI-LGYHQGERTL---EAFLPEVVISCVGSKACQCWALATASGSLYIYGNHGQL 715

Query: 554 LLPPMIMGVPVSFLEGCGDYLLCVTSMGQLFCWNVKEGKLKFPVNTIYPLLNPSIRYSDD 613
           L+P + +G  V  L     +++  T     + W+++  KL     ++ P+L       + 
Sbjct: 716 LVPKISIGHKVIKLIAWQHFVIAFTETCLFWIWDIRAMKLVEKEISVLPVLVQDQPQCNR 775

Query: 614 VLTRAENITMCTTTENGIPLVTLSNGDGYMFDPDMEIW 651
           V      +      ++   LV +S+G  Y++   +  W
Sbjct: 776 VRISRRILDFRMLADSHELLVEMSDGASYVWKKALGCW 813

>Scas_702.16
          Length = 816

 Score = 87.8 bits (216), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/332 (23%), Positives = 146/332 (43%), Gaps = 69/332 (20%)

Query: 159 LVVDPLGELLTVVLQNRSVAVYQYNRQGAVRMHQQLPQYVQTNPLRYS--------ITMS 210
           ++ DP  +       +R++ +++Y++ G      +   +V T P + S        ++ S
Sbjct: 185 VIFDPANKYFATASDDRTMKIFRYHKIGDASFTIE---HVVTEPFKGSPLTTYFRRLSWS 241

Query: 211 PQGDLLPLVNSIKNGLPSAQLLDRTAGFSVQSTLVGYVDKCKILRFSPRLYE-------- 262
           P G  +   N+    + S  +++R   +    +L+G+    +++RF+PRL+E        
Sbjct: 242 PDGQHIAAPNATNGPVSSVAIINR-GTWDSNISLIGHDAPTEVVRFNPRLFEVNDGMTPA 300

Query: 263 KPNKDKPP--TQYNLLASSGNEDGSVIVWNTKRTKPLLNAAKVTDTFINDVQWSRDGTGL 320
           K  +D  P  +  +++A++G +D +V+VW+T R +P+  A  + +  I D+QW+ DGT L
Sbjct: 301 KRKQDSGPNDSMESIIATAG-QDKTVVVWSTTRARPIFIAFDIANKSITDMQWTPDGTML 359

Query: 321 FAISNDGYLFIFAFHEVELGRLLD-DAELEKL------RQSVXXXXXXXXXXXXXXAKSE 373
           F  S D  + I  F + ELG+++  +  +E+L      + S+                  
Sbjct: 360 FLTSLDSSITILVFEDNELGKIIPLEKNIEQLHRYGVDKDSLDFPESVEQLIFEETVNKL 419

Query: 374 AKPQ---------QDTKPD----AKSSA--------------------------NSVSAK 394
            KP+         Q+ KPD    AKSS                           N +  K
Sbjct: 420 KKPKLSSTSNLQLQEKKPDSLLPAKSSKGSESRLLTNETINILIPKRKKDGKPNNKIVMK 479

Query: 395 TGKKKIAPTVITSTSMEFNEPSYTVPKDLKRR 426
            GKK+I PT++T+ +   +E        LK++
Sbjct: 480 DGKKRIVPTLMTTVATSKSESDILTKPTLKKK 511

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 55/136 (40%), Gaps = 17/136 (12%)

Query: 482 LQQNLVMEVKNGTGSE---------QKPTSITLTLKDKEKDMVLFQDFTPRFVTICTCGH 532
           L+   V+E+KNG               PT +    + K    +    F P  V I   G 
Sbjct: 632 LENFRVLEIKNGVERSIQFDKEALYDNPTKLVGYYQGK----ICLTAFLPE-VVITAVGS 686

Query: 533 SF---WACCTEEGIVYVYSNTGKKLLPPMIMGVPVSFLEGCGDYLLCVTSMGQLFCWNVK 589
           S    W   T EG +Y+    G+   P + +G  +  +     YL+ +T  G  + W+++
Sbjct: 687 SHCQCWCLSTAEGSLYIIGYNGQYRSPRISVGHKIIKMINRERYLIALTERGLFYIWDIE 746

Query: 590 EGKLKFPVNTIYPLLN 605
           + KL      I P+LN
Sbjct: 747 DLKLVSKNIPILPILN 762

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 98/212 (46%), Gaps = 33/212 (15%)

Query: 159 LVVDPLGELLTVVLQNRSVAVYQYNRQGAVRMHQQLPQYVQTNPLRYSI--------TMS 210
           +V DP  +       +R++ +++Y++ G +       +++ T P + S         + S
Sbjct: 185 VVFDPANKYFATTSDDRTMKIFRYHKTGDISF---TIEHIITEPFKESPLTTYFRRPSWS 241

Query: 211 PQGDLLPLVNSIKNGLPSAQLLDRTAGFSVQSTLVGYVDKCKILRFSPRLYE-----KPN 265
           P G  + + N+    + S  +++R   +    +L+G+    ++ RF+PRL+E     K  
Sbjct: 242 PDGQHIAVPNATNGPVSSMAIVNR-GTWDTNVSLIGHDAPTEVARFNPRLFERNAGVKQK 300

Query: 266 KDKPP----------------TQYNLLASSGNEDGSVIVWNTKRTKPLLNAAKVTDTFIN 309
           KD  P                   + + ++  +D S+ VW+T R +P+L A  + +  I 
Sbjct: 301 KDDDPENALVGQNDDKVHHFDKNIDSVVATAGQDKSLAVWSTSRPRPILVAFDIANKSIT 360

Query: 310 DVQWSRDGTGLFAISNDGYLFIFAFHEVELGR 341
           D+ W+ DG+ LF  S D  + +F F   ELG+
Sbjct: 361 DMSWNPDGSLLFVASLDSSITLFKFENNELGK 392

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 59/143 (41%), Gaps = 9/143 (6%)

Query: 517 FQDFTPRFVTICTCGHS---FWACCTEEGIVYVYSNTGKKLLPPMIMGVPVSFLEGCGDY 573
            + F P  V IC  G      W   +  G +Y+ S  G++ +P + +G  V  +     Y
Sbjct: 699 IETFIPE-VIICAIGSKDCKCWCLASANGSIYILSYNGQQRIPKICLGHKVIKMVTSSKY 757

Query: 574 LLCVTSMGQLFCWNVKEGKLKFPVNTIYPLLNPSIRYSDDVLTRAENITMCTTTENGIPL 633
           LL +T  G  F W++ + KL      I P+LN    + + V  R   +  C   +     
Sbjct: 758 LLVLTERGLFFAWDLLDLKLVLRNVPILPILNGQPIHGNKV--RINKVIKCFRLDGSSCD 815

Query: 634 VTLSNGDG---YMFDPDMEIWLL 653
           + L  GD    Y +  D+  W L
Sbjct: 816 LLLEVGDPKNVYKWTKDLGCWSL 838

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 72.8 bits (177), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 52/239 (21%), Positives = 108/239 (45%), Gaps = 26/239 (10%)

Query: 126 VFVSVSGKDEVWLYATGAWERVGVVTLAAKPVTLVV-DPLGELLTVVLQNRSVAVYQYNR 184
           + VSV     + ++    +E+V    +    V  VV DP  +       +R++ +++Y++
Sbjct: 148 IMVSVGLDRAIIIWNGSTFEKVKRFDVHQSHVKGVVFDPANKYFATASDDRTIKMFRYHK 207

Query: 185 QGAVRMHQQLPQYVQTNPLRYS--------ITMSPQGDLLPLVNSIKNGLPSAQLLDRTA 236
            G      +   +V T P + S        ++ SP G  +   N++   + +  +++R  
Sbjct: 208 TGETSFSVE---HVITEPFKGSPLTTYFRRLSWSPDGQHIAAPNAMNGPVSTVAIIER-G 263

Query: 237 GFSVQSTLVGYVDKCKILRFSPRLYEKPNKDKPPTQYN------------LLASSGNEDG 284
            +    +LVG+    ++  F+PR++++   D      +            ++ASSG +D 
Sbjct: 264 TWESPVSLVGHDQPTEVASFNPRIFKRQKDDSTTDTIDGKKTGISDEVDCIVASSG-QDK 322

Query: 285 SVIVWNTKRTKPLLNAAKVTDTFINDVQWSRDGTGLFAISNDGYLFIFAFHEVELGRLL 343
           ++ VW+T + +PL+ A  +    I D+ W+ DG  LF  S D  + +  F + E G  +
Sbjct: 323 TLAVWSTSKARPLIVAQDICGKSITDMSWTPDGKILFITSLDSSIVVLTFEDNEFGEAI 381

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 32/156 (20%), Positives = 58/156 (37%), Gaps = 11/156 (7%)

Query: 458 PNISFSKARLATPKVRMNFQYCNTLQQNLVMEVKNGTGSEQKPTSITLTLKDKEKDMV-- 515
           PN  + +     P      +   T+    V+EV+NG   E+     T  L D    ++  
Sbjct: 633 PNTRYLEFNSILPDADAVLREMGTIDDLYVLEVRNGV--ERSIQFDTEALYDNSTRVLGY 690

Query: 516 -----LFQDFTPRFVTICT-CGHS-FWACCTEEGIVYVYSNTGKKLLPPMIMGVPVSFLE 568
                 F+ F P  V  C  C  +  W   T  G ++     G+   P + +G  +  L 
Sbjct: 691 HAGQRSFELFFPDVVLTCVGCMETKTWILATTTGQLFFIDTLGQARCPRISIGHKIIKLC 750

Query: 569 GCGDYLLCVTSMGQLFCWNVKEGKLKFPVNTIYPLL 604
               +++ +T    ++ W++    L      + PLL
Sbjct: 751 TSQSHVIAITETALIYVWDLVSMSLTLKNIPLLPLL 786

>Kwal_47.17465
          Length = 800

 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 100/235 (42%), Gaps = 54/235 (22%)

Query: 159 LVVDPLGELLTVVLQNRSVAVYQYNRQGAVRMHQQLPQYVQTNPLRYS--------ITMS 210
           ++ DP  +       +R+V +++Y++ G +    +   +V + P + S        ++ S
Sbjct: 127 VIFDPANKYFATASDDRTVRIFRYHKAGDMSFSIE---HVVSEPFKGSPITTYFRRLSWS 183

Query: 211 PQGDLLPLVNSIKNGLPSAQLLDRTAGFSVQSTLVGYVDKCKILRFSPRLYE----KPNK 266
           P G  +   N+    + S  ++ R   +    TL+G+    +++RF+PRL++    K  K
Sbjct: 184 PDGQHIAAPNATNGPVSSVSIIAR-GSWDTSVTLIGHDSPTEVVRFNPRLFQVLEKKTEK 242

Query: 267 DKPPTQYNLLA--------------------------------------SSGNEDGSVIV 288
           +KP  +  L++                                      ++  +D +++V
Sbjct: 243 NKPEVESPLVSPETQNGVKDSQDEAGQRKDGQEEQEQEESVEEKVDSVIATAGQDKTLVV 302

Query: 289 WNTKRTKPLLNAAKVTDTFINDVQWSRDGTGLFAISNDGYLFIFAFHEVELGRLL 343
           W+T + +P+  A  +    I D+ W+ +G  LF  S DG +  F F E ELG  +
Sbjct: 303 WSTGKARPIFVAYDIASKSITDMVWNPNGDLLFLTSLDGSIITFHFGEKELGEAI 357

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 98/201 (48%), Gaps = 21/201 (10%)

Query: 159 LVVDPLGELLTVVLQNRSVAVYQYNRQGAVR--MHQQLPQYVQTNPLR---YSITMSPQG 213
           ++ DP  +       +R++ V++Y++ G V   + Q + +    +PL      ++ SP G
Sbjct: 179 VIFDPANKYFATASDDRTMRVFRYHKTGEVSFTIEQVIVEPFIASPLTTYFRRLSWSPDG 238

Query: 214 DLLPLVNSIKNGLPSAQLLDRTAGFSVQSTLVGYVDKCKILRFSPRLYE-------KPNK 266
             + + N+    + S  +++R   +    +L+G+    ++ RF+PRL++       K  K
Sbjct: 239 QHIAVPNATNGPVSSVAIINR-GTWDSSISLIGHDAPTEVARFNPRLFKSDVEKKAKNAK 297

Query: 267 DK--PPTQYN-----LLASSGNEDGSVIVWNTKRTKPLLNAAKVTDTFINDVQWSRDGTG 319
           D+    T+ N     ++A++G +D S+ +W T R +P+  A  +    I D+ W+ +G  
Sbjct: 298 DELSKDTKNNKKLESIIATAG-QDKSLALWITSRPRPIFVAYDIAQKSITDMAWNPNGNI 356

Query: 320 LFAISNDGYLFIFAFHEVELG 340
           LF  S D  + +  F   ELG
Sbjct: 357 LFVTSLDSSIVMLMFDANELG 377

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 61/139 (43%), Gaps = 17/139 (12%)

Query: 479 CNTLQQNLVMEVKNGTGSE---------QKPTSITLTLKDKEKDMVLFQDFTPRFVTICT 529
           C ++     +E++NG               PT I L   + ++ +   + F P  V I  
Sbjct: 631 CGSIDDFFTLEIRNGVERAIQFDSDALFDNPTRI-LGYHEGQRTI---EAFIPN-VIISG 685

Query: 530 CGH---SFWACCTEEGIVYVYSNTGKKLLPPMIMGVPVSFLEGCGDYLLCVTSMGQLFCW 586
            G     +W+  T +G +Y+ S  G+ L+P + +G  V     C +YLL +T  G  + W
Sbjct: 686 VGSPVSKYWSLATADGFIYIISYNGQLLIPKINLGQKVVKQVVCSNYLLVLTERGLFYAW 745

Query: 587 NVKEGKLKFPVNTIYPLLN 605
           ++   +      +I P++N
Sbjct: 746 DISAKRSVIKNVSILPIIN 764

>KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces
           cerevisiae YML102w CAC2 chromatin assembly complex,
           subunit p60, start by similarity
          Length = 493

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 54/104 (51%), Gaps = 4/104 (3%)

Query: 253 ILRFSPRLYEKPNK-DKPPTQYNLLASSGNEDGSVIVWNTKRTKPLLNAAKVTDTFINDV 311
           +++F+P +YE  ++  K P       ++ NE   V+V++T+ T P+  A  +  T I D+
Sbjct: 324 VVKFNPIMYETASEWVKAPYTLVFAVATTNE---VLVYDTQNTSPIAIAGNLHYTPITDL 380

Query: 312 QWSRDGTGLFAISNDGYLFIFAFHEVELGRLLDDAELEKLRQSV 355
            WS+DGT L   S DG+     F + + G  L D  +  L + +
Sbjct: 381 AWSQDGTLLMISSTDGFCSYIHFTDNDFGTPLKDQSIPILTKEL 424

>Kwal_27.10385
          Length = 536

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 49/98 (50%), Gaps = 3/98 (3%)

Query: 251 CKILRFSPRLYEKPNKDKPPTQ--YNLLASSGNEDGSVIVWNTKRTKPLLNAAKVTDTFI 308
           C ++ F+P  Y+   K +P     Y L+ +    D  V+V++++ T P+     +  T I
Sbjct: 325 CLVISFNPLYYKLATKTQPYINLPYKLVFAVATSD-EVLVFDSETTSPICVIGNLHYTPI 383

Query: 309 NDVQWSRDGTGLFAISNDGYLFIFAFHEVELGRLLDDA 346
            D+ WS+DG  L   S DG+    +F E  LG  + ++
Sbjct: 384 TDLSWSQDGLMLMVSSTDGFCSYISFKEGTLGSQIGES 421

>YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly
           complex subunit 1, involved in nucleosome assembly
           linked with DNA replication, has WD (WD-40) repeats
           [1407 bp, 468 aa]
          Length = 468

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 5/75 (6%)

Query: 256 FSPRLYEKPNKD--KPPTQYNLLASSGNEDGSVIVWNTKRTKPLLNAAKVTDTFINDVQW 313
           FSP  YE   K   K P +     ++ NE   V+V++T   +PL     +  + I D+ W
Sbjct: 325 FSPVFYETCQKSVLKLPYKLVFAIATTNE---VLVYDTDVLEPLCVVGNIHYSPITDLAW 381

Query: 314 SRDGTGLFAISNDGY 328
           S DG+ L   S DG+
Sbjct: 382 SEDGSTLLISSTDGF 396

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 43/84 (51%), Gaps = 4/84 (4%)

Query: 252 KILRFSPRLYEKPNKDKPP---TQYNLLASSGNEDGSVIVWNTKRTKPLLNAAKVTDTFI 308
           ++  +S  L +      PP   T Y+ + +SG  DG V +W+T+    + N   V+D+ I
Sbjct: 210 RVSEYSDHLGDVLTLSVPPAGTTSYDSMFASGGSDGYVYLWDTRSPSSVQNFF-VSDSDI 268

Query: 309 NDVQWSRDGTGLFAISNDGYLFIF 332
           + V++  DG  +   S+DG   +F
Sbjct: 269 STVRFFSDGNSIITGSDDGIARLF 292

>Scas_512.3
          Length = 534

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 50/107 (46%), Gaps = 12/107 (11%)

Query: 253 ILRFSPRLYEKPNKDKPPTQ-------YNLL--ASSGNEDGSVIVWNTKRTKPLLNAAKV 303
           ++ F+P  Y+  ++++  T+       Y L+   ++ NE   V++++T   KP+     +
Sbjct: 339 VVSFNPNFYKLTHEEQEGTKKPYLKLPYRLIYAVATSNE---VLIYDTVNVKPISIIGNL 395

Query: 304 TDTFINDVQWSRDGTGLFAISNDGYLFIFAFHEVELGRLLDDAELEK 350
             T + D+ WS+DG  L   S DG+       E   G  L   E E+
Sbjct: 396 HYTALTDLSWSQDGNMLMVSSTDGFCSYITIEENLFGEKLTIEEREQ 442

>AER280C [2782] [Homologous to ScYML102W (CAC2) - SH]
           (1148956..1150488) [1533 bp, 510 aa]
          Length = 510

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 3/90 (3%)

Query: 253 ILRFSPRLYEKPNKDKPPTQ--YNLLASSGNEDGSVIVWNTKRTKPLLNAAKVTDTFIND 310
           ++RFSP LY+     +P  Q  Y L+ +       V++++T  TKP+     +  T + D
Sbjct: 324 VVRFSPILYKIETGVEPWIQLPYKLVFAVATST-EVVIYDTVTTKPIAVVGNLHYTPLTD 382

Query: 311 VQWSRDGTGLFAISNDGYLFIFAFHEVELG 340
           + WS  G  L   S DG+    +  +   G
Sbjct: 383 LSWSDSGHLLVVSSTDGFCSYISMEDSLFG 412

>Scas_605.18
          Length = 424

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 264 PNKDKPPTQYNLLASSGNEDGSVIVWNTKRTKPLLNAAKVTDTFINDVQWSRDGTGLFAI 323
           P+ D+  T  N+ AS G+ DG   +W+T RT   +     +DT +N +Q+ +DG  +   
Sbjct: 232 PSADEN-TGANIFASCGS-DGYTYIWDT-RTSAAVQKFFASDTDVNAIQFFKDGNSIVTG 288

Query: 324 SNDGYLFIF 332
            +DG + +F
Sbjct: 289 GDDGVINMF 297

>KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces
           cerevisiae YMR049c singleton, start by similarity
          Length = 791

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 69/168 (41%), Gaps = 35/168 (20%)

Query: 182 YNRQGAVRMHQQLPQYVQTNPLRYSITMSPQGDLLPLVNSIKNGLPSAQLLDRTAGFSVQ 241
           Y+     R  + L  Y+     +  + + P+  L+P        LPS + L R       
Sbjct: 369 YSESVRERFERSLDLYLAPRVRKNKLNIDPES-LIP-------ELPSTKDL-RPFPIRCS 419

Query: 242 STLVGYVDKCKILRFSPRLYEKPNKDKPPTQYNLLASSGNEDGSVIVWNTKRTKP----- 296
           +  VG+  K + +   P                L  ++G++DG+V VW     +      
Sbjct: 420 TVYVGHKGKIRTMSIDPT--------------GLWLATGSDDGTVRVWEILTGREVYQVT 465

Query: 297 LLNAAKVTDTFINDVQWSRDG-TGLFAISNDGYLF-----IFAFHEVE 338
           +LNA +  D  I+ V+W+ D  TG+ A++    +F     IF F E+E
Sbjct: 466 ILNAEENNDDHIDVVEWNPDSTTGILAVTAGENIFLLVPPIFGF-EIE 512

>ADR242C [1983] [Homologous to ScYMR131C (RRB1) - SH]
           (1126443..1128008) [1566 bp, 521 aa]
          Length = 521

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 36/59 (61%), Gaps = 4/59 (6%)

Query: 270 PTQYNLLASSGNEDGSVIVWN--TKRTKPLLNAAKVTDTFINDVQWSRDGTGLFAISND 326
           P++  + A+ G  DG V +W+  +K+ KP L + KV+DT +N + W++  + L A  +D
Sbjct: 342 PSENTVFATCG-VDGHVRIWDIRSKKHKPAL-SVKVSDTDVNVMSWNQKISYLLATGDD 398

>CAGL0B03575g complement(357525..358784) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2, hypothetical
           start
          Length = 419

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 7/66 (10%)

Query: 272 QYNLLASSGNEDGSVIVWNT----KRTKPLLNAAKVTDTFINDVQWSRDGTGLF-AISND 326
           +Y+LL  SG++D ++ +W+     K  KP +         INDV+W      +F ++S D
Sbjct: 192 KYSLL--SGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSED 249

Query: 327 GYLFIF 332
             + +F
Sbjct: 250 STMKLF 255

>CAGL0J06512g complement(620516..622153) similar to sp|Q04199
           Saccharomyces cerevisiae YML102w CAC2, start by
           similarity
          Length = 545

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 8/90 (8%)

Query: 256 FSPRLYE----KPNKDKPPTQYNLLASSGNEDGSVIVWNTKRTKPLLNAAKVTDTFINDV 311
           FSP  YE    KP  D P   Y L+ +    +  VI ++T+  +P+   + +  T + D+
Sbjct: 373 FSPIFYERTSNKPYVDLP---YKLVFAIATIN-QVIFYDTENIEPISIVSNLHYTPLTDL 428

Query: 312 QWSRDGTGLFAISNDGYLFIFAFHEVELGR 341
            WS  G  +   S DG+    + +    GR
Sbjct: 429 TWSPRGDMVMVSSTDGFCSAISINTAVFGR 458

>Scas_658.1
          Length = 442

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 4/73 (5%)

Query: 270 PTQYNLLASSGNEDGSVIVWNTKRTKPLLNAAKVTDTFINDVQWSRDGTGLFAISNDGYL 329
           P   NLL S GN D  V VW+    + LL   K     IN + ++ DGT   + S D  +
Sbjct: 159 PNSGNLLLSGGN-DNIVKVWDFYHKRNLLRDYKGHSKAINSLDFNDDGTNFISSSFDHTI 217

Query: 330 FIFAFHEVELGRL 342
            I+   + E G++
Sbjct: 218 KIW---DTEQGKV 227

>Scas_657.13
          Length = 411

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 279 SGNEDGSVIVWNTKRTK--PLLNAAKVTDTFINDVQWSRDGTGLF-AISNDGYL 329
           SG++DG++ +WN   +   P+   + V    +ND +WS     +F ++S D  L
Sbjct: 190 SGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTL 243

>Kwal_27.12239
          Length = 316

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 43/95 (45%), Gaps = 8/95 (8%)

Query: 267 DKPPTQYNLLASSGNEDGSVIVWNTKRTKPLLNAAKVTD-------TFINDVQWSRDGTG 319
           D PP   ++L SSG+ DG + +++T     L       D         I+ V++SR+G  
Sbjct: 148 DLPPFDPSIL-SSGSYDGLIRIFDTATGHCLKTLTYDKDWQSENGVVPISQVKFSRNGKY 206

Query: 320 LFAISNDGYLFIFAFHEVELGRLLDDAELEKLRQS 354
           L   S DG L I+ F   ++ R     E   LR S
Sbjct: 207 LLVKSLDGILKIWDFVRGKVVRTFKSGESSSLRYS 241

>Scas_615.8d
          Length = 581

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 40/85 (47%), Gaps = 11/85 (12%)

Query: 609 RYSDDVLTRAENITMCTTTENGIPLVTLSNGDGY-----MFDPDMEIWLLINDSWWAYGS 663
           RYSDD+    EN+ +C  TE+   +V +SNG+       M D   E+    +D+     S
Sbjct: 361 RYSDDI----ENVNVCGKTESSDVIVGVSNGEMSNCPIKMSDLAKEVGEADSDTKSQQSS 416

Query: 664 QYWDFTNTSHAGSSAAAGNDKEDKK 688
              +  NTS A  S     +KE KK
Sbjct: 417 LTLNKANTSVAPHSVLT--NKEPKK 439

>Scas_701.45
          Length = 1276

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 8/64 (12%)

Query: 270 PTQYNLLASSGNEDGSVIVWNTKRT-------KPLLNAAKVTDTFINDVQWSRDGTGLFA 322
           P Q N+LAS+GN +G +++W+  +T             A  T   I  V W++    +FA
Sbjct: 123 PKQQNVLASAGN-NGEILIWDINKTLSSTDYSPSAPGIAMSTQDEIKSVSWNKSLAHVFA 181

Query: 323 ISND 326
            + D
Sbjct: 182 SAGD 185

>Sklu_2167.5 YGL213C, Contig c2167 8275-9186
          Length = 303

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 9/75 (12%)

Query: 274 NLLASSGNEDGSVIVWNTKRTKPLLN-------AAKVTDTFINDVQWSRDGTGLFAISND 326
           N L ++G  DGSV+V   +  +P+ N         +   + + DV++S  G GL A++ND
Sbjct: 101 NGLIATGFSDGSVVVAQLRTLRPIYNFEGFGIQGIEENSSTVRDVKFSPLG-GLLAVAND 159

Query: 327 -GYLFIFAFHEVELG 340
            G       +E E G
Sbjct: 160 SGSYGCVTLYETEYG 174

>Kwal_33.14843
          Length = 567

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 34/77 (44%), Gaps = 4/77 (5%)

Query: 273 YNLLASSGNEDGSVIVWNTKRTKPLLNAAKVTDTFINDVQWSRDGTGLFAISNDGYLFIF 332
           ++++      D  V VW T    PL   ++V D   ND++ S   + +   + DG    F
Sbjct: 425 WSVINDGKERDPKVNVWTTDVAVPLSQFSQVIDATKNDIEQSGLHSAIVGHAGDGNFHTF 484

Query: 333 AFHEVE----LGRLLDD 345
             +  E     G+L+D+
Sbjct: 485 LLYNNEERATAGKLVDN 501

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 58/120 (48%), Gaps = 13/120 (10%)

Query: 207 ITMSPQGDLLPLVNSIKNGLPSAQLLDRTAGFSVQSTLVGYVDKCKILRFSPRLYEKPNK 266
           ++ SP G+L+    S+ N +   +L +   G  V   L G+      L + P    KP +
Sbjct: 192 VSWSPDGELIA-TGSMDNTI---RLWEGNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQ 247

Query: 267 DKPPTQYNLLASSGNEDGSVIVWNTKRTKPLLNAAKVTDTFINDVQWSRDGTGLFAISND 326
            KP        +S ++DG++ +W+T R   L+  +  T + ++ ++W   G  L++ S+D
Sbjct: 248 -KP------RLASASKDGTIKIWDTTRRVCLITLSGHTSS-VSCIKWGGQGV-LYSGSHD 298

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 26,294,240
Number of extensions: 1166140
Number of successful extensions: 3722
Number of sequences better than 10.0: 49
Number of HSP's gapped: 3785
Number of HSP's successfully gapped: 57
Length of query: 835
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 725
Effective length of database: 12,788,129
Effective search space: 9271393525
Effective search space used: 9271393525
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)