Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR087C25725212731e-180
Sklu_1979.227325610471e-145
CAGL0I00946g2592549991e-138
Kwal_55.215702412369971e-138
KLLA0E21967g2602469801e-135
Scas_699.432562479651e-133
YOR039W (CKB2)2582429591e-132
KLLA0A04818g2772184584e-56
Kwal_47.174492502284295e-52
Scas_638.72702414281e-51
CAGL0A00275g2662334262e-51
Sklu_1768.43292114233e-50
YGL019W (CKB1)2782374116e-49
AGR163W2752393891e-45
CAGL0K10076g100837720.40
Scas_618.499855662.1
Scas_678.24161031644.2
Kwal_23.5668168941634.6
YDR283C (GCN2)165929627.3
Kwal_14.237748175609.2
KLLA0C10802g167243619.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR087C
         (252 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR087C [1134] [Homologous to ScYOR039W (CKB2) - SH] (514602..51...   494   e-180
Sklu_1979.2 YOR039W, Contig c1979 3847-4668 reverse complement        407   e-145
CAGL0I00946g complement(76974..77753) highly similar to sp|P3893...   389   e-138
Kwal_55.21570                                                         388   e-138
KLLA0E21967g 1951763..1952545 similar to sp|P38930 Saccharomyces...   382   e-135
Scas_699.43                                                           376   e-133
YOR039W (CKB2) [4851] chr15 (405767..406543) Casein kinase II Pr...   374   e-132
KLLA0A04818g 429275..430108 similar to sp|P43639 Saccharomyces c...   181   4e-56
Kwal_47.17449                                                         169   5e-52
Scas_638.7                                                            169   1e-51
CAGL0A00275g 29069..29869 highly similar to sp|P43639 Saccharomy...   168   2e-51
Sklu_1768.4 YGL019W, Contig c1768 4317-5306 reverse complement        167   3e-50
YGL019W (CKB1) [1954] chr7 (458159..458995) Casein kinase II (Pr...   162   6e-49
AGR163W [4474] [Homologous to ScYGL019W (CKB1) - SH] complement(...   154   1e-45
CAGL0K10076g complement(983446..986472) similar to sp|P38959 Sac...    32   0.40 
Scas_618.4                                                             30   2.1  
Scas_678.24                                                            29   4.2  
Kwal_23.5668                                                           29   4.6  
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    28   7.3  
Kwal_14.2377                                                           28   9.2  
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    28   9.8  

>ACR087C [1134] [Homologous to ScYOR039W (CKB2) - SH]
           (514602..515375) [774 bp, 257 aa]
          Length = 257

 Score =  494 bits (1273), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 237/252 (94%), Positives = 237/252 (94%)

Query: 1   MSERRLEEHGTAETADVEMADAVETNSTGSSDYVELWIDLFLGKKGHEYFCDVDTEYITD 60
           MSERRLEEHGTAETADVEMADAVETNSTGSSDYVELWIDLFLGKKGHEYFCDVDTEYITD
Sbjct: 1   MSERRLEEHGTAETADVEMADAVETNSTGSSDYVELWIDLFLGKKGHEYFCDVDTEYITD 60

Query: 61  RFNLINLQKTVSKFTQVIQYMVDELDDTTLEAMSRTKLTQLEADARKLYGLIHARYIITI 120
           RFNLINLQKTVSKFTQVIQYMVDELDDTTLEAMSRTKLTQLEADARKLYGLIHARYIITI
Sbjct: 61  RFNLINLQKTVSKFTQVIQYMVDELDDTTLEAMSRTKLTQLEADARKLYGLIHARYIITI 120

Query: 121 KGLQKMLQKYRDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRH 180
           KGLQKMLQKYRDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRH
Sbjct: 121 KGLQKMLQKYRDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRH 180

Query: 181 SSIDGAYFGTSFPGMFLQAFPEVVPKHPTKRYVPKVFGFDLHKQAQLARWXXXXXXXXXX 240
           SSIDGAYFGTSFPGMFLQAFPEVVPKHPTKRYVPKVFGFDLHKQAQLARW          
Sbjct: 181 SSIDGAYFGTSFPGMFLQAFPEVVPKHPTKRYVPKVFGFDLHKQAQLARWQELQRLKLER 240

Query: 241 XXXXXGVDLTKN 252
                GVDLTKN
Sbjct: 241 ELIKKGVDLTKN 252

>Sklu_1979.2 YOR039W, Contig c1979 3847-4668 reverse complement
          Length = 273

 Score =  407 bits (1047), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 195/256 (76%), Positives = 213/256 (83%), Gaps = 8/256 (3%)

Query: 3   ERRLEEHGTAETADVE------MADAVETNSTGSSDYVELWIDLFLGKKGHEYFCDVDTE 56
           E R EE    E  DVE        D    ++T SS+YVE WIDLFLG+KGHEYFCDVDT+
Sbjct: 15  EARKEE--DVEMVDVEHQGQGTRVDEANHDTTDSSEYVEFWIDLFLGRKGHEYFCDVDTD 72

Query: 57  YITDRFNLINLQKTVSKFTQVIQYMVDELDDTTLEAMSRTKLTQLEADARKLYGLIHARY 116
           YITDRFNLINLQKTVS+FTQVIQY+VDELDDT LE MSR++L QLE+DARKLYGLIHARY
Sbjct: 73  YITDRFNLINLQKTVSRFTQVIQYIVDELDDTALEQMSRSRLEQLESDARKLYGLIHARY 132

Query: 117 IITIKGLQKMLQKYRDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLYIPK 176
           IIT+KGLQKMLQKYRDADF RCPRV+CNFQ LLPVGLHDVPGIDCVKLYCPSCEDLYIPK
Sbjct: 133 IITVKGLQKMLQKYRDADFGRCPRVYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLYIPK 192

Query: 177 SSRHSSIDGAYFGTSFPGMFLQAFPEVVPKHPTKRYVPKVFGFDLHKQAQLARWXXXXXX 236
           SSRHSSIDGAYFGTSFPGMFLQAFPE+VPKHP KRYVP++FGF+LHKQAQLARW      
Sbjct: 193 SSRHSSIDGAYFGTSFPGMFLQAFPEMVPKHPVKRYVPRIFGFELHKQAQLARWQELQRL 252

Query: 237 XXXXXXXXXGVDLTKN 252
                    GV+L+KN
Sbjct: 253 KLESQLDKEGVELSKN 268

>CAGL0I00946g complement(76974..77753) highly similar to sp|P38930
           Saccharomyces cerevisiae YOR039w CKB2 casein kinase II
           beta chain, start by similarity
          Length = 259

 Score =  389 bits (999), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 181/254 (71%), Positives = 210/254 (82%), Gaps = 2/254 (0%)

Query: 1   MSER--RLEEHGTAETADVEMADAVETNSTGSSDYVELWIDLFLGKKGHEYFCDVDTEYI 58
           M+ER  ++ +  +  T+ VE+ D V  ++T SS+Y ++WIDLFLG+KGHEYFCDVD EYI
Sbjct: 1   MTERDIQMADRMSTNTSRVELDDEVMDDATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYI 60

Query: 59  TDRFNLINLQKTVSKFTQVIQYMVDELDDTTLEAMSRTKLTQLEADARKLYGLIHARYII 118
           TDRFNLINLQKTVSKF+QV+QY+VDELDD+ +E MS+ +L QLE DARK YGLIHARYII
Sbjct: 61  TDRFNLINLQKTVSKFSQVVQYIVDELDDSIVENMSKARLEQLENDARKFYGLIHARYII 120

Query: 119 TIKGLQKMLQKYRDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLYIPKSS 178
           T+KGLQKML KY+DADF RC RV+CNFQPLLPVGLHDVPGID VKLYCPSCEDLY PKSS
Sbjct: 121 TVKGLQKMLSKYKDADFGRCSRVYCNFQPLLPVGLHDVPGIDSVKLYCPSCEDLYNPKSS 180

Query: 179 RHSSIDGAYFGTSFPGMFLQAFPEVVPKHPTKRYVPKVFGFDLHKQAQLARWXXXXXXXX 238
           RHSSIDGAYFGTSFPGMFLQAFP++VPKHPT RYVPK+FGF+LHKQAQL RW        
Sbjct: 181 RHSSIDGAYFGTSFPGMFLQAFPDMVPKHPTARYVPKIFGFELHKQAQLTRWQELQRLKL 240

Query: 239 XXXXXXXGVDLTKN 252
                   VDL+K+
Sbjct: 241 VKRLQAKEVDLSKS 254

>Kwal_55.21570
          Length = 241

 Score =  388 bits (997), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 182/236 (77%), Positives = 200/236 (84%), Gaps = 2/236 (0%)

Query: 15  ADVEMADAVETNSTGS--SDYVELWIDLFLGKKGHEYFCDVDTEYITDRFNLINLQKTVS 72
           ADVEM +A    + GS  S+Y E WIDLFLG+KGHEYFCD+DTEYITDRFNLINLQK+V+
Sbjct: 2   ADVEMVEARPDTAEGSDSSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSVN 61

Query: 73  KFTQVIQYMVDELDDTTLEAMSRTKLTQLEADARKLYGLIHARYIITIKGLQKMLQKYRD 132
           KFTQVIQYMVDELDD  LE MS T+L QLE DARKLYGLIHARY+ITIKGLQKMLQKY++
Sbjct: 62  KFTQVIQYMVDELDDGILEQMSSTRLEQLEHDARKLYGLIHARYVITIKGLQKMLQKYKE 121

Query: 133 ADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSF 192
           ADF RCPRV+CNFQPLLPVGLHDVPG DCVKLYC  CEDLYIPKSSRHS+IDGAYFGTSF
Sbjct: 122 ADFGRCPRVYCNFQPLLPVGLHDVPGKDCVKLYCACCEDLYIPKSSRHSAIDGAYFGTSF 181

Query: 193 PGMFLQAFPEVVPKHPTKRYVPKVFGFDLHKQAQLARWXXXXXXXXXXXXXXXGVD 248
           PGMFLQAFPE+VPKHP KRYVPK+FGF+LHKQAQ+ARW               G+D
Sbjct: 182 PGMFLQAFPEMVPKHPVKRYVPKIFGFELHKQAQVARWQELQRMKLEISLREQGID 237

>KLLA0E21967g 1951763..1952545 similar to sp|P38930 Saccharomyces
           cerevisiae YOR039w CKB2 casein kinase II beta chain,
           start by similarity
          Length = 260

 Score =  382 bits (980), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 180/246 (73%), Positives = 199/246 (80%), Gaps = 4/246 (1%)

Query: 11  TAETADVEMADAVETN----STGSSDYVELWIDLFLGKKGHEYFCDVDTEYITDRFNLIN 66
           T E  DV MADA+  N     + S +YVE WIDLFLGKKGHEYFCD+DTEYITDRFNLIN
Sbjct: 10  TTEQPDVVMADALVVNDQDDGSDSGEYVEYWIDLFLGKKGHEYFCDIDTEYITDRFNLIN 69

Query: 67  LQKTVSKFTQVIQYMVDELDDTTLEAMSRTKLTQLEADARKLYGLIHARYIITIKGLQKM 126
           LQKTVSKFT V+QYMVD+L++  +E+MS  +L QLE D RKLYGLIHARYIIT KGLQKM
Sbjct: 70  LQKTVSKFTTVVQYMVDDLEEGIIESMSPARLEQLETDTRKLYGLIHARYIITAKGLQKM 129

Query: 127 LQKYRDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSIDGA 186
           LQKY+ ADF RCPR HCN QPLLPVGLHD+PGIDCVKLYCPSCEDLY PKSSRHS+IDGA
Sbjct: 130 LQKYKAADFGRCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPKSSRHSAIDGA 189

Query: 187 YFGTSFPGMFLQAFPEVVPKHPTKRYVPKVFGFDLHKQAQLARWXXXXXXXXXXXXXXXG 246
           YFGTSFPGMFLQ FPE+ PKHPTKRYVPKVFGFDLHKQAQL RW               G
Sbjct: 190 YFGTSFPGMFLQGFPEMCPKHPTKRYVPKVFGFDLHKQAQLTRWQELQRLKLEKLLITKG 249

Query: 247 VDLTKN 252
           ++L ++
Sbjct: 250 INLNES 255

>Scas_699.43
          Length = 256

 Score =  376 bits (965), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 177/247 (71%), Positives = 200/247 (80%), Gaps = 3/247 (1%)

Query: 6   LEEHGTAETADVEMADAVETNSTGSSDYVELWIDLFLGKKGHEYFCDVDTEYITDRFNLI 65
           ++E G   T D    D      T SS+YV+ WIDLFLGKKGHEYFCD+D +YITDRFNLI
Sbjct: 8   VQEEGLTHTQD---EDDSMGEVTDSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNLI 64

Query: 66  NLQKTVSKFTQVIQYMVDELDDTTLEAMSRTKLTQLEADARKLYGLIHARYIITIKGLQK 125
           NLQKTVSKF+QV+QY+VDELD++ LE MS  +L QLE DARK YGLIHARYIIT+KGLQK
Sbjct: 65  NLQKTVSKFSQVVQYIVDELDESILETMSNARLEQLENDARKFYGLIHARYIITVKGLQK 124

Query: 126 MLQKYRDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSIDG 185
           ML K++DADF RCPRV+CN+QPLLPVGLHD PG+DCVKLYC SCEDLYIPKS RHS IDG
Sbjct: 125 MLDKFKDADFGRCPRVYCNYQPLLPVGLHDTPGMDCVKLYCASCEDLYIPKSMRHSCIDG 184

Query: 186 AYFGTSFPGMFLQAFPEVVPKHPTKRYVPKVFGFDLHKQAQLARWXXXXXXXXXXXXXXX 245
           A+FGTSFPGMFLQAFPE+VPKHPTK+YVPK+FGF+LHKQAQLARW               
Sbjct: 185 AFFGTSFPGMFLQAFPEMVPKHPTKKYVPKIFGFELHKQAQLARWQEFQRLKLEKKLKTL 244

Query: 246 GVDLTKN 252
            VDLTKN
Sbjct: 245 DVDLTKN 251

>YOR039W (CKB2) [4851] chr15 (405767..406543) Casein kinase II
           Protein kinase CK2, regulatory (beta-prime) subunit [777
           bp, 258 aa]
          Length = 258

 Score =  374 bits (959), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 176/242 (72%), Positives = 203/242 (83%)

Query: 11  TAETADVEMADAVETNSTGSSDYVELWIDLFLGKKGHEYFCDVDTEYITDRFNLINLQKT 70
           T E + VE  D +  + + SS+YV++WIDLFLG+KGHEYFCDVD EYITDRFNL+NLQKT
Sbjct: 12  TREGSRVEQDDVLMDDDSDSSEYVDMWIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKT 71

Query: 71  VSKFTQVIQYMVDELDDTTLEAMSRTKLTQLEADARKLYGLIHARYIITIKGLQKMLQKY 130
           VSKF+ V+QY+VD+LDD+ LE M+  +L QLE+D+RKLYGLIHARYIITIKGLQKM  KY
Sbjct: 72  VSKFSYVVQYIVDDLDDSILENMTHARLEQLESDSRKLYGLIHARYIITIKGLQKMYAKY 131

Query: 131 RDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGT 190
           ++ADF RCPRV+CN Q LLPVGLHD+PGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGT
Sbjct: 132 KEADFGRCPRVYCNLQQLLPVGLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGT 191

Query: 191 SFPGMFLQAFPEVVPKHPTKRYVPKVFGFDLHKQAQLARWXXXXXXXXXXXXXXXGVDLT 250
           SFPGMFLQAFP++VPKHPTKRYVPK+FGF+LHKQAQL RW                VDLT
Sbjct: 192 SFPGMFLQAFPDMVPKHPTKRYVPKIFGFELHKQAQLTRWQELQRLKLVEKLESKDVDLT 251

Query: 251 KN 252
           K+
Sbjct: 252 KS 253

>KLLA0A04818g 429275..430108 similar to sp|P43639 Saccharomyces
           cerevisiae YGL019w CKB1 casein kinase II, beta subunit,
           start by similarity
          Length = 277

 Score =  181 bits (458), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 94/218 (43%), Positives = 130/218 (59%), Gaps = 18/218 (8%)

Query: 25  TNSTGSSDYVELWIDLFLGKKGHEYFCDVDTEYITDRFNLINLQKTVSKFTQVIQYMVDE 84
           +N +  S   E WI  F  + GHEYFC V T++I D FNL  L + V+ + + +  ++D 
Sbjct: 7   SNDSSDSGNYEEWIPTFCSRFGHEYFCQVPTDFIEDDFNLTGLSQEVAYYRKALDTILD- 65

Query: 85  LDDTTLEAMSRTKLTQ--------------LEADARKLYGLIHARYIITIKGLQKMLQKY 130
           L+ T+ E   +   +               +E  A +LYGLIHAR+I+T  GLQ M +K+
Sbjct: 66  LESTSDEEEEKNDASSNSKKDNDAHVTRSIVEHSAEQLYGLIHARFILTKAGLQAMAEKF 125

Query: 131 RDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGT 190
              +F  CPR HC    LLP GL D  G   V+LYCPSC+DLYIP+SSRH S++GAY+GT
Sbjct: 126 DRKEFGTCPRYHCGSIQLLPCGLSDTLGKQTVRLYCPSCQDLYIPQSSRHLSLEGAYWGT 185

Query: 191 SFPGMFLQAFPEV---VPKHPTKRYVPKVFGFDLHKQA 225
           SFPG+FL+ F E+   V K   + Y  K+FGF + K+A
Sbjct: 186 SFPGVFLKHFKELEDYVEKKNKETYELKIFGFSIAKEA 223

>Kwal_47.17449
          Length = 250

 Score =  169 bits (429), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 135/228 (59%), Gaps = 19/228 (8%)

Query: 19  MADAVETNS-TGSSD---YVELWIDLFLGKKGHEYFCDVDTEYITDRFNLINLQKTVSKF 74
           M++ V  NS +GSSD     + WI  F  + GHEYFC V TE+I D FN+  L + V  +
Sbjct: 1   MSEYVGDNSRSGSSDESGTFDEWIPSFCARFGHEYFCQVPTEFIEDDFNMTGLGQEVPHY 60

Query: 75  TQVI------QYMVDELDDTTLEAMSRTKLTQLEADARKLYGLIHARYIITIKGLQKMLQ 128
            + +      + M DE    + E +SR+ +   E  A +LYGL+HARYI+T  GLQ M +
Sbjct: 61  RKALDLVLDLEAMSDEEGQDSEEPVSRSIV---EHAAEQLYGLVHARYILTKPGLQAMAE 117

Query: 129 KYRDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYF 188
           K+   +F  CPR +C    +LP GL D  G   V+LYCPSC+DLY+P+SSRH  ++GA++
Sbjct: 118 KFDHKEFGTCPRYYCAGMQMLPCGLTDTLGKLTVRLYCPSCQDLYLPQSSRHLCLEGAFW 177

Query: 189 GTSFPGMFLQAFPEV---VPKHPTKRYVPKVFGFDLHKQAQLA---RW 230
           GTSFPG+FL+ F E+   V +     Y  +VFGF +  +A      RW
Sbjct: 178 GTSFPGVFLKHFKELEDYVDRKSKDTYELRVFGFRIASEAPSGARMRW 225

>Scas_638.7
          Length = 270

 Score =  169 bits (428), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 133/241 (55%), Gaps = 28/241 (11%)

Query: 17  VEMADAVETNSTGSSDYVELWIDLFLGKKGHEYFCDVDTEYITDRFNLINLQKTVSKFTQ 76
           VE+    E +   S +Y E WI  F  + GHEYFC+V TE+I D FNL +L + V  + +
Sbjct: 6   VEVPSHGELSDEDSGNYEE-WIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEVPHYRK 64

Query: 77  VIQYMVD---------------------ELDDTTLEAMSRTKLTQLEADARKLYGLIHAR 115
            +  ++D                     + D+   +       + +E  A +LYGLIHAR
Sbjct: 65  ALDLILDLEAISEEEEEEDEDMVGANNGQTDELVKKKAQAVNRSIIEHAAEQLYGLIHAR 124

Query: 116 YIITIKGLQKMLQKYRDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLYIP 175
           YI+T  GLQ M +K+   +F  CPR HC    LLP GL D  G   V+LYCPSC+DLY+P
Sbjct: 125 YILTKPGLQAMAEKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSCQDLYLP 184

Query: 176 KSSRHSSIDGAYFGTSFPGMFLQAFPEV---VPKHPTKRYVPKVFGFDLHKQA---QLAR 229
           +SSR   ++GA++GTSFPG+FL+ F E+   V +     Y  KVFGF ++ +A   Q  +
Sbjct: 185 QSSRFLCLEGAFWGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGFKINDRAVSGQRMK 244

Query: 230 W 230
           W
Sbjct: 245 W 245

>CAGL0A00275g 29069..29869 highly similar to sp|P43639 Saccharomyces
           cerevisiae YGL019w CKB1, hypothetical start
          Length = 266

 Score =  168 bits (426), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 93/233 (39%), Positives = 133/233 (57%), Gaps = 26/233 (11%)

Query: 19  MADAVETNS-TGSSDYVELWIDLFLGKKGHEYFCDVDTEYITDRFNLINLQKTVSKFTQV 77
           M++ +E NS +  S   + WI  F  + GHEYFC V T++I D FN+ +L + V  + + 
Sbjct: 1   MSEYMEDNSHSDDSGTYDEWIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYRKA 60

Query: 78  IQYMVD--------ELDDTTLEAMSRTKLTQ--------------LEADARKLYGLIHAR 115
           +  ++D        ++D+    A S +                  +   A +LYGLIHAR
Sbjct: 61  LDLILDLEMVSDEEDMDEKESGAESSSGANNNGGVNSKALVNRNIIGHAAEQLYGLIHAR 120

Query: 116 YIITIKGLQKMLQKYRDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLYIP 175
           YI+T  GLQ M +K+   DF  CPR  C+   LLP GL D  G   V+LYCPSC+DLY+P
Sbjct: 121 YILTKPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQDLYLP 180

Query: 176 KSSRHSSIDGAYFGTSFPGMFLQAFPEV---VPKHPTKRYVPKVFGFDLHKQA 225
           +SSRH  ++GAY+GTSFPG+FL+ F E+   V +   + Y  KVFGF ++ QA
Sbjct: 181 QSSRHLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRINDQA 233

>Sklu_1768.4 YGL019W, Contig c1768 4317-5306 reverse complement
          Length = 329

 Score =  167 bits (423), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 88/211 (41%), Positives = 121/211 (57%), Gaps = 28/211 (13%)

Query: 37  WIDLFLGKKGHEYFCDVDTEYITDRFNLINLQKTVSKFTQVIQYMVDELDDTTLEAMSR- 95
           WI  F  + GHEYFC V TE+I D FN+  L + +  + + +  ++D      LEAMS  
Sbjct: 92  WIPSFCSRFGHEYFCQVPTEFIEDDFNMTGLSQEIPHYRKALDLILD------LEAMSDE 145

Query: 96  ------------------TKLTQLEADARKLYGLIHARYIITIKGLQKMLQKYRDADFCR 137
                                + +E  A +LYGLIHARYI+T  GLQ M +K+   +F  
Sbjct: 146 DDEDDNDGAAEEDGSGEPVNRSIMEHAAEQLYGLIHARYILTKPGLQSMAEKFDHKEFGT 205

Query: 138 CPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSFPGMFL 197
           CPR +C    +LP GL D  G   V+LYCPSC+DLY+P+SSRH  +DGA++GTSFPG+FL
Sbjct: 206 CPRYYCGGMQMLPCGLSDTLGKQTVRLYCPSCQDLYLPQSSRHLCMDGAFWGTSFPGVFL 265

Query: 198 QAFPEV---VPKHPTKRYVPKVFGFDLHKQA 225
           + F E+   V +     Y  KVFGF ++ +A
Sbjct: 266 KHFKELEDYVERKSKDVYELKVFGFKINGEA 296

>YGL019W (CKB1) [1954] chr7 (458159..458995) Casein kinase II
           (Protein kinase CK2), regulatory (beta) subunit [837 bp,
           278 aa]
          Length = 278

 Score =  162 bits (411), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 92/237 (38%), Positives = 131/237 (55%), Gaps = 37/237 (15%)

Query: 26  NSTGSSD-----YVELWIDLFLGKKGHEYFCDVDTEYITDRFNLINLQKTVSKFTQVIQY 80
           + TGSSD       + WI  F  + GHEYFC V TE+I D FN+ +L + V  + + +  
Sbjct: 10  SRTGSSDDEDSGAYDEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEVPHYRKALDL 69

Query: 81  MVD------------------------ELDDTTLEAMSRTKL-----TQLEADARKLYGL 111
           ++D                        + +D   E   R K      + +E  A +LYGL
Sbjct: 70  ILDLEAMSDEEEDEDDVVEEDEVDQEMQSNDGHDEGKRRNKSPVVNKSIIEHAAEQLYGL 129

Query: 112 IHARYIITIKGLQKMLQKYRDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCED 171
           IHAR+I+T  GLQ M +K+   +F  CPR +CN   LLP GL D  G   V+LYCPSC+D
Sbjct: 130 IHARFILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTVRLYCPSCQD 189

Query: 172 LYIPKSSRHSSIDGAYFGTSFPGMFLQAFPEV---VPKHPTKRYVPKVFGFDLHKQA 225
           LY+P+SSR   ++GA++GTSFPG+FL+ F E+   V +   + Y  KVFGF ++ +A
Sbjct: 190 LYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGFRINDEA 246

>AGR163W [4474] [Homologous to ScYGL019W (CKB1) - SH]
           complement(1052587..1053414) [828 bp, 275 aa]
          Length = 275

 Score =  154 bits (389), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 89/239 (37%), Positives = 130/239 (54%), Gaps = 45/239 (18%)

Query: 25  TNSTGSSDYVELWIDLFLGKKGHEYFCDVDTEYITDRFNLINLQKTVSKFTQVIQYMVDE 84
           ++ + SS+Y E WI  F  + GHE+FC V TE+I D FNL  L   V  + + +  ++D 
Sbjct: 8   SDVSESSNYDE-WITSFCSRFGHEFFCQVPTEFIEDDFNLTGLSAEVPHYRRALDLILD- 65

Query: 85  LDDTTLEAMSR----------------------TKLTQ-------------LEADARKLY 109
                LE++S                       T + Q             ++  A +LY
Sbjct: 66  -----LESLSEEDEDGVAASAGAASNGGDHSNGTSVRQAAHADGQPINKSIIDHCAEQLY 120

Query: 110 GLIHARYIITIKGLQKMLQKYRDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSC 169
           GLIHARYI+T +GLQ M +K+   +F  CPR +C    LLP GL D  G + V+LYC SC
Sbjct: 121 GLIHARYILTKQGLQAMAEKFDHKEFGTCPRYYCGGMQLLPCGLSDTLGKNTVRLYCASC 180

Query: 170 EDLYIPKSSRHSSIDGAYFGTSFPGMFLQAFPEV---VPKHPTKRYVPKVFGFDLHKQA 225
           +DLY+P SSRH  ++GA++GTSFPG+FL+ F E+   V +     Y  ++FGF + K++
Sbjct: 181 QDLYLPHSSRHLCLEGAFWGTSFPGVFLKHFKELEDYVEQKNKNVYRLRIFGFPVAKES 239

>CAGL0K10076g complement(983446..986472) similar to sp|P38959
           Saccharomyces cerevisiae YDR080w VPS41 required for the
           vacuolar assembly, hypothetical start
          Length = 1008

 Score = 32.3 bits (72), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 23/37 (62%)

Query: 63  NLINLQKTVSKFTQVIQYMVDELDDTTLEAMSRTKLT 99
           +L++L     +F++VI YM++  DD   E + R KLT
Sbjct: 711 SLVSLNLEAKRFSKVIPYMIENKDDRIFEILVRNKLT 747

>Scas_618.4
          Length = 998

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 11/55 (20%)

Query: 159 IDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSFPGMFLQAFPEVVPKHPTKRYV 213
           I C+   C  C+D+ +P +             + P   L   P+V+PK   K YV
Sbjct: 45  IPCLSRSCTKCQDIVVPDAQ-----------NNLPKFVLSESPQVLPKPIGKHYV 88

>Scas_678.24
          Length = 1610

 Score = 29.3 bits (64), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 80   YMVDELDDTTLEAMSRTKLTQLEADARKLYG 110
            + VD L D TLE +S T L Q E   RK++G
Sbjct: 1534 FTVDALRDETLEIISITSLAQKEEWLRKVFG 1564

>Kwal_23.5668
          Length = 1689

 Score = 28.9 bits (63), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%)

Query: 71   VSKFTQVIQYMVDELDDTTLEAMSRTKLTQLEADARKLYGL 111
            +S  +    + VD + D TLE +S T L+Q +   RK++G+
Sbjct: 1604 ISSLSTAPIFAVDAVRDETLEIISVTSLSQRDEWMRKIFGV 1644

>YDR283C (GCN2) [1112] chr4 complement(1025062..1030041)
            Serine/threonine protein kinase that regulates initiation
            of translation by phosphorylation of eIF2alpha (Sui2p),
            involved in general amino acid control response and salt
            tolerance [4980 bp, 1659 aa]
          Length = 1659

 Score = 28.5 bits (62), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 82   VDELDDTTLEAMSRTKLTQLEADARKLYG 110
            VD L D TLE +S T L Q E   RK++G
Sbjct: 1585 VDALRDETLEIISITSLAQKEEWLRKVFG 1613

>Kwal_14.2377
          Length = 481

 Score = 27.7 bits (60), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 32/75 (42%), Gaps = 14/75 (18%)

Query: 154 HDVPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSF-----PGMFLQAFPEVVPKHP 208
           HDV  +      CP  + + + KSS  + + G            P   +  F +V  K P
Sbjct: 163 HDVASV------CPVVDGMTLSKSSTRNFLAGKLLNKLIEKHLEPREIIPMF-KVAQKRP 215

Query: 209 TKRYVPKVFGFDLHK 223
              ++PK F FD+HK
Sbjct: 216 --EFIPKKFDFDIHK 228

>KLLA0C10802g complement(926916..931934) similar to sp|P15442
            Saccharomyces cerevisiae YDR283c GCN2 ser/thr protein
            kinase, start by similarity
          Length = 1672

 Score = 28.1 bits (61), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 25/43 (58%)

Query: 68   QKTVSKFTQVIQYMVDELDDTTLEAMSRTKLTQLEADARKLYG 110
            ++ +   + V  + VD + D TLE +S T L+Q +   RK++G
Sbjct: 1584 RQLIHSLSSVPIFAVDAIHDETLEIISITSLSQKDEWLRKVFG 1626

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.138    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,714,881
Number of extensions: 325778
Number of successful extensions: 780
Number of sequences better than 10.0: 22
Number of HSP's gapped: 773
Number of HSP's successfully gapped: 23
Length of query: 252
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 153
Effective length of database: 13,168,927
Effective search space: 2014845831
Effective search space used: 2014845831
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)