Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR086C81079536270.0
Kwal_55.2157598979214920.0
KLLA0F07447g97578814870.0
Scas_615.994277613261e-170
YDR270W (CCC2)100479012291e-155
CAGL0M08602g101264012031e-151
YBR295W (PCA1)12165826221e-67
AGL041C12336216175e-67
KLLA0D04092g11522903954e-39
YGL008C (PMA1)9185562053e-16
YPL036W (PMA2)9475531911e-14
Scas_707.48*7411911856e-14
AGL085C9095571841e-13
YGL167C (PMR1)9501671831e-13
Kwal_47.175228995581803e-13
CAGL0I04312g9511701769e-13
AEL301W9571721732e-12
KLLA0A09031g8995571732e-12
KLLA0A03157g9381671661e-11
Scas_688.19135551661e-11
CAGL0J01870g9461671607e-11
Kwal_14.14989391671581e-10
CAGL0A00495g9025771534e-10
Scas_710.419041901482e-09
KLLA0E14630g10822511294e-07
KLLA0F20658g10822221151e-05
Scas_297.1800421106e-05
Kwal_23.316011001841081e-04
AGL097C1096831071e-04
CAGL0K12034g10872001071e-04
Scas_569.0d468831052e-04
CAGL0A00517g11221771053e-04
YGL006W (PMC1)1173551043e-04
KLLA0A08910g12802161035e-04
AFL011W12422001000.001
YDR039C (ENA2)1091178990.001
YDR038C (ENA5)1091178990.001
CAGL0M11308g145249970.002
Kwal_47.175471240184970.002
YDR040C (ENA1)1091178950.003
YOR291W147250910.010
KLLA0B08217g143949900.014
Scas_665.30143947870.030
CAGL0L01419g121439840.064
YEL031W (SPF1)121549840.072
Kwal_26.9207146950820.12
KLLA0E22352g120639810.17
AFR567W144948800.20
YDR440W (DOT1)582102750.76
AFR354C121039750.80
AFR098W349149731.1
Scas_583.14*87539722.0
KLLA0E01650g155046694.1
Scas_669.3163846686.4
Kwal_26.70701315128677.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR086C
         (795 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..51...  1401   0.0  
Kwal_55.21575                                                         579   0.0  
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...   577   0.0  
Scas_615.9                                                            515   e-170
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...   478   e-155
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...   468   e-151
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...   244   1e-67
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...   242   5e-67
KLLA0D04092g complement(344666..348124) some similarities with s...   156   4e-39
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    84   3e-16
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    78   1e-14
Scas_707.48*                                                           76   6e-14
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    75   1e-13
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    75   1e-13
Kwal_47.17522                                                          74   3e-13
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    72   9e-13
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    71   2e-12
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    71   2e-12
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    69   1e-11
Scas_688.1                                                             69   1e-11
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    66   7e-11
Kwal_14.1498                                                           65   1e-10
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    64   4e-10
Scas_710.41                                                            62   2e-09
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    54   4e-07
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    49   1e-05
Scas_297.1                                                             47   6e-05
Kwal_23.3160                                                           46   1e-04
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    46   1e-04
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    46   1e-04
Scas_569.0d                                                            45   2e-04
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    45   3e-04
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    45   3e-04
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    44   5e-04
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    43   0.001
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    43   0.001
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    43   0.001
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    42   0.002
Kwal_47.17547                                                          42   0.002
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    41   0.003
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    40   0.010
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    39   0.014
Scas_665.30                                                            38   0.030
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    37   0.064
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    37   0.072
Kwal_26.9207                                                           36   0.12 
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    36   0.17 
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    35   0.20 
YDR440W (DOT1) [1261] chr4 (1342481..1344229) Histone H3 methylt...    33   0.76 
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    33   0.80 
AFR098W [3290] [Homologous to ScYJL088W (ARG3) - SH] complement(...    33   1.1  
Scas_583.14*                                                           32   2.0  
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...    31   4.1  
Scas_669.3                                                             31   6.4  
Kwal_26.7070                                                           30   7.3  

>ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH]
           (511968..514400) [2433 bp, 810 aa]
          Length = 810

 Score = 1401 bits (3627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 707/795 (88%), Positives = 707/795 (88%)

Query: 1   MEVTGLEAEMARMGNGSMAGTTAVLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEE 60
           MEVTGLEAEMARMGNGSMAGTTAVLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEE
Sbjct: 1   MEVTGLEAEMARMGNGSMAGTTAVLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEE 60

Query: 61  CRVEYERKRVGLRQIVETIEDCGFEARVGGCAREEQVRRLXXXXXXXXXXXXXXXXXXXX 120
           CRVEYERKRVGLRQIVETIEDCGFEARVGGCAREEQVRRL                    
Sbjct: 61  CRVEYERKRVGLRQIVETIEDCGFEARVGGCAREEQVRRLARAEETAQWRRRAAQAWAAA 120

Query: 121 XVMMGLYMVAPLEEALGPTPLAGLFWRDXXXXXXXXXXXXXXXRPFXXXXXXXXXXXXTM 180
            VMMGLYMVAPLEEALGPTPLAGLFWRD               RPF            TM
Sbjct: 121 AVMMGLYMVAPLEEALGPTPLAGLFWRDVAGLAVASGVLATAGRPFLRGLGALRHGRGTM 180

Query: 181 DTLVALSSGVTYLFSVATICRGVWLGSADPPSTFLDTTVMLVAFICVGKLLESXXXXXXX 240
           DTLVALSSGVTYLFSVATICRGVWLGSADPPSTFLDTTVMLVAFICVGKLLES       
Sbjct: 181 DTLVALSSGVTYLFSVATICRGVWLGSADPPSTFLDTTVMLVAFICVGKLLESRARARAA 240

Query: 241 DSLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEGEAEVDES 300
           DSLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEGEAEVDES
Sbjct: 241 DSLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEGEAEVDES 300

Query: 301 LMTGESTLVPKYPGSRVLCGSVNGAAGFLYRADLVGEETRLAGIVAAMKQAQLAKAPIQR 360
           LMTGESTLVPKYPGSRVLCGSVNGAAGFLYRADLVGEETRLAGIVAAMKQAQLAKAPIQR
Sbjct: 301 LMTGESTLVPKYPGSRVLCGSVNGAAGFLYRADLVGEETRLAGIVAAMKQAQLAKAPIQR 360

Query: 361 YADFLASWFIPSVLILALLTFVCWMLICTLLATPPSIFNNSNRLYVCSRIAITVIVVACP 420
           YADFLASWFIPSVLILALLTFVCWMLICTLLATPPSIFNNSNRLYVCSRIAITVIVVACP
Sbjct: 361 YADFLASWFIPSVLILALLTFVCWMLICTLLATPPSIFNNSNRLYVCSRIAITVIVVACP 420

Query: 421 CPLGLAAPTAIMVGTGLGAERGLLFKGGDVIETAAAVQAILFDXXXXXXXXXXXVHNFTS 480
           CPLGLAAPTAIMVGTGLGAERGLLFKGGDVIETAAAVQAILFD           VHNFTS
Sbjct: 421 CPLGLAAPTAIMVGTGLGAERGLLFKGGDVIETAAAVQAILFDKTGTLTTGKLTVHNFTS 480

Query: 481 ESKALTPDQWALVCAAERLSEHPIARAIVTYAEPYASPEAVARIVVLNHEVLVGLGVRCV 540
           ESKALTPDQWALVCAAERLSEHPIARAIVTYAEPYASPEAVARIVVLNHEVLVGLGVRCV
Sbjct: 481 ESKALTPDQWALVCAAERLSEHPIARAIVTYAEPYASPEAVARIVVLNHEVLVGLGVRCV 540

Query: 541 LQLDGVEHRITIGSARLLPERPSKFSGSTASFVAVNDVLLGRFDLSDSLREDAYEVVQAL 600
           LQLDGVEHRITIGSARLLPERPSKFSGSTASFVAVNDVLLGRFDLSDSLREDAYEVVQAL
Sbjct: 541 LQLDGVEHRITIGSARLLPERPSKFSGSTASFVAVNDVLLGRFDLSDSLREDAYEVVQAL 600

Query: 601 LSRGHYVGMVTGDNHEAAMHVSHALGIPLNNVFSERLPEGKCDVLRQLRQKYDYVAFIGD 660
           LSRGHYVGMVTGDNHEAAMHVSHALGIPLNNVFSERLPEGKCDVLRQLRQKYDYVAFIGD
Sbjct: 601 LSRGHYVGMVTGDNHEAAMHVSHALGIPLNNVFSERLPEGKCDVLRQLRQKYDYVAFIGD 660

Query: 661 GINDSVALAESDLGISLSGNSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVKL 720
           GINDSVALAESDLGISLSGNSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVKL
Sbjct: 661 GINDSVALAESDLGISLSGNSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVKL 720

Query: 721 NIFWAVLYNSLMLPVSMGVLIPWGIQLPPXXXXXXXXXXXXXXXXXXXXXXRWRPVPAAS 780
           NIFWAVLYNSLMLPVSMGVLIPWGIQLPP                      RWRPVPAAS
Sbjct: 721 NIFWAVLYNSLMLPVSMGVLIPWGIQLPPMAAAAGMAMSSVSVVTSSLLLARWRPVPAAS 780

Query: 781 RKAAVGSWRNFFKKG 795
           RKAAVGSWRNFFKKG
Sbjct: 781 RKAAVGSWRNFFKKG 795

>Kwal_55.21575
          Length = 989

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/792 (41%), Positives = 462/792 (58%), Gaps = 22/792 (2%)

Query: 4   TGLEAEM-----ARMGNGSMAGTTAVLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVT 58
           +G EAE+      R   GS     A L V GMTC ACV TV+ A+    GVV+ +VSL T
Sbjct: 149 SGFEAEIINDDAERPTRGSTV-RKATLKVLGMTCGACVSTVESALSQEPGVVSIQVSLAT 207

Query: 59  EECRVEYERKRVGLRQIVETIEDCGFE-ARVGGCAREEQVRRLXXXXXXXXXXXXXXXXX 117
           EE ++EY    +G+R I   IED GFE A V       QV  L                 
Sbjct: 208 EEAQLEYNPAVIGVRAIASKIEDLGFESAPVNSFNSVAQVNLLAKVREINFWKRTCVQSC 267

Query: 118 XXXXVMMGLYMVAPLEEA------LGPTPLAGLFWRDXXXXXXXXXXXXXXXRPFXXXX- 170
               +M+ LY   PL            T + GLF+RD                 F     
Sbjct: 268 CFMVLMLLLYKAGPLWIPARNLFFYKQTGIPGLFYRDIIGFIITCYVQFWVGWHFYPAGW 327

Query: 171 XXXXXXXXTMDTLVALSSGVTYLFSVATICRGVWLGSADPPSTFLDTTVMLVAFICVGKL 230
                   +MDT+V LS+  ++ FS+ +I   V   S   P+   D +VML+ FI VGKL
Sbjct: 328 KSIRHGSGSMDTVVLLSTLCSFAFSLYSIAMNVAKKSERMPNVIFDASVMLIGFISVGKL 387

Query: 231 LESXXXXXXXDSLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTV 290
           LE+       +SL++++S APS CTI E+G  RE+ VE LQ GD V ++PG K+P DG +
Sbjct: 388 LENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVI 447

Query: 291 LEGEAEVDESLMTGESTLVPKYPGSRVLCGSVNGAAGFLYRADLVGEETRLAGIVAAMKQ 350
           +EGE+EVDESL+TGES +VP+Y G  V+ GS+NG   FL  A  VG++T+LA I+  MKQ
Sbjct: 448 IEGESEVDESLITGESLMVPRYKGFPVIAGSINGPNRFLLTATSVGDDTKLAQIIQTMKQ 507

Query: 351 AQLAKAPIQRYADFLASWFIPSVLILALLTFVCWMLICTLLATPPSIFNNSN-RLYVCSR 409
           AQL+KAPIQ YAD+LAS F+PSVL+LA++TFV W ++  +L+ PPSIF++ N + ++C  
Sbjct: 508 AQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILSRVLSNPPSIFDSPNGKFFICLE 567

Query: 410 IAITVIVVACPCPLGLAAPTAIMVGTGLGAERGLLFKGGDVIETAAAVQAILFDXXXXXX 469
           + I+VIVVACPC LGLAAPTAIMVGTGLGA+ G+L KGGD++E  ++++  LFD      
Sbjct: 568 MTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGGDILEKCSSLETFLFDKTGTLT 627

Query: 470 XXXXXVHNFTSES--KALTPDQWALVCAAERLSEHPIARAIVTYAEPYASPEAVARIVVL 527
                V  F        LT ++   + A+E +SEHP+ +AIV + +     +     VV 
Sbjct: 628 TGHMTVEQFVPMGVRDNLTTEELLCINASEAVSEHPVGKAIVEFTDSLIE-DCDRTAVVT 686

Query: 528 NHEVLVGLGVRCVLQLDGVEHRITIGSARLLPERP-SKFSGSTASFVAVNDVLLGRFDLS 586
             + ++G G+ C  +LDG  + + IG+  ++ +   S  + ST ++V +N  L+GRF++S
Sbjct: 687 KSKTILGGGLICDCELDGKAYHVVIGNRNVMQDMSLSADASSTLAYVKINGELVGRFEIS 746

Query: 587 DSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLNNVFSERLPEGKCDVLR 646
           D +++DA EVVQ L  +GH V MVTGDNH++AM V+  LGI  NNV+SE  P  K  +++
Sbjct: 747 DFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEANNVYSELTPADKNQLVQ 806

Query: 647 QLRQ-KYDYVAFIGDGINDSVALAESDLGISLSGNSDIVADAAGIVVLDHS--SAPPLTR 703
            L+      VAFIGDGINDS AL  SDLG+S+S  +DI  +AA +++L+ S  +   L  
Sbjct: 807 DLQDGGRKNVAFIGDGINDSPALVTSDLGVSISTGTDIAMEAADVIILNRSENNHVSLRE 866

Query: 704 ILYAIDLARATFNRVKLNIFWAVLYNSLMLPVSMGVLIPWGIQLPPXXXXXXXXXXXXXX 763
           ++YA+D+A+ TF RVK+N FWA+ YN  MLP++MGVL+PW I + P              
Sbjct: 867 LIYALDIAQKTFRRVKINFFWAICYNLFMLPIAMGVLVPWEITMDPIVAVACMAASSVSV 926

Query: 764 XXXXXXXXRWRP 775
                    W+P
Sbjct: 927 VGNSLLLNLWKP 938

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 44/67 (65%)

Query: 22  TAVLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEECRVEYERKRVGLRQIVETIED 81
           TAVLSV+ MTC ACV T+   + A +GV+   VSL TEECRVE++   V   ++   I+D
Sbjct: 89  TAVLSVQHMTCGACVATITNNLEAQEGVLEVAVSLATEECRVEFDPAVVTAAELKGIIDD 148

Query: 82  CGFEARV 88
            GFEA +
Sbjct: 149 SGFEAEI 155

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 39/66 (59%)

Query: 23 AVLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEECRVEYERKRVGLRQIVETIEDC 82
          AVL V GMTC ACV T++  ++ + GV    VSL+T EC V +E++      +   I DC
Sbjct: 7  AVLLVEGMTCGACVATIESQLKRIKGVDEVTVSLITGECEVRFEKEDTDEETLKGAIIDC 66

Query: 83 GFEARV 88
          GF A V
Sbjct: 67 GFSATV 72

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/788 (40%), Positives = 457/788 (57%), Gaps = 21/788 (2%)

Query: 25  LSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEECRVEYERKRVGLRQIVETIEDCGF 84
           L + GM   +    ++  V  + GV++ + SL +EE  V ++   +G R I++ IE+ GF
Sbjct: 171 LKIFGMLSESDRADIESKVSELKGVISIDTSLQSEEATVIHDANEIGNRDIIDCIEEMGF 230

Query: 85  EARVGGC-AREEQVRRLXXXXXXXXXXXXXXXXXXXXXVMMGLYMVAPL-------EEAL 136
           +  +        Q+  L                     ++MGLYM  P+           
Sbjct: 231 QTFISNTLDNSTQLSLLSKTKEIQFWKKNCIRGGISSILIMGLYMCVPMLFPAVLTHFPF 290

Query: 137 GPTPLAGLFWRDXXXXXXXXXXXXXXXRPFXXXX-XXXXXXXXTMDTLVALSSGVTYLFS 195
             TP+ GLF+RD                 F             TMDTL+ LS+   Y+FS
Sbjct: 291 VQTPIIGLFYRDIIGIIITTYVQIYVGSYFYKAAWISLKHGSGTMDTLIGLSTVCAYIFS 350

Query: 196 VATICRGVWLGSADPPSTFLDTTVMLVAFICVGKLLESXXXXXXXDSLARMVSSAPSMCT 255
             +I   ++  S   P    DT VML+ FI +GKLLE+        ++++++S  PS C+
Sbjct: 351 CYSIISSIYHKSTKMPKVIFDTAVMLLTFISLGKLLENKAKSETSTAMSKLISLTPSSCS 410

Query: 256 I-RESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEGEAEVDESLMTGESTLVPKYPG 314
           I    GS RE+ VELLQ  D+V + PG K+PADG V+  E EVDESL+TGES LV K  G
Sbjct: 411 IVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRNETEVDESLITGESMLVEKIVG 470

Query: 315 SRVLCGSVNGAAGFLYRADLVGEETRLAGIVAAMKQAQLAKAPIQRYADFLASWFIPSVL 374
           S+V+ GSVNG   F +RA  VGE+T+LA I+A MK+AQL+KAPIQ+YAD +A  F+P V+
Sbjct: 471 SQVIGGSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVI 530

Query: 375 ILALLTFVCWMLICTLLATPPSIFNNSN-RLYVCSRIAITVIVVACPCPLGLAAPTAIMV 433
            L+ +TF+ WML+   + TPP IFN+ N + ++C +++I+VI+VACPC LGLAAPTAIMV
Sbjct: 531 SLSAITFITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMV 590

Query: 434 GTGLGAERGLLFKGGDVIETAAAVQAILFDXXXXXXXXXXXVHNFTSESKALTPDQWALV 493
           GTG+GA  G+L KGGDV+E  +A+Q  LFD           V NF + +  ++   W ++
Sbjct: 591 GTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSVENFINYNSDVSDLHWKMI 650

Query: 494 CAAERLSEHPIARAIVTYAEPYASPEAVARIVVLNHEVLVGLGVRCVLQLDGVE--HRIT 551
              E + EHP+A+AIV YA+ + +  ++  + + N EVL+G G+ C +        H IT
Sbjct: 651 SLCESIGEHPVAKAIVNYADSHVNKSSIFDLDLSNEEVLIGKGISCNITDKNTSKIHTIT 710

Query: 552 IGSARLLP-ERPSKFSGS--TASFVAVNDVLLGRFDLSDSLREDAYEVVQALLSRGHYVG 608
           IG+ +L P E  S  + S  T S+V+++  L+G+F++SD ++EDA+ VV+ L + G    
Sbjct: 711 IGNKKLFPDESLSDIASSTLTESYVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCC 770

Query: 609 MVTGDNHEAAMHVSHALGIPLNNVFSERLPEGKCDVLRQLRQK-YDYVAFIGDGINDSVA 667
           MVTGD H++A+ V+  LGI  N+VFSE  PE K D++ QL+    + VAF+GDGINDS A
Sbjct: 771 MVTGDAHQSALKVAQQLGISANDVFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPA 830

Query: 668 LAESDLGISLSGNSDIVADAAGIVVLDHSSA-PPLTRILYAIDLARATFNRVKLNIFWAV 726
           L E+DLGIS+S  +DI  +AA IV+LD  +    L  ++YA+D+AR TF RVKLN FWAV
Sbjct: 831 LVEADLGISISSGTDIAIEAADIVILDSDNKNNSLKGLVYALDIARKTFYRVKLNFFWAV 890

Query: 727 LYNSLMLPVSMGVLIPWGIQLPPXXXXXXXXXXXXXXXXXXXXXXRWRP--VPAASRKAA 784
            YN+ M+P++MG+L PWGI L P                      RW P  +   S +A+
Sbjct: 891 CYNTFMIPIAMGLLAPWGITLHPMLSSAAMALSSVSVVCSSLMLKRWTPPSLNIKSMEAS 950

Query: 785 VG-SWRNF 791
            G SW  F
Sbjct: 951 GGLSWLRF 958

 Score = 83.2 bits (204), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 51/71 (71%)

Query: 18 MAGTTAVLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEECRVEYERKRVGLRQIVE 77
          MA T A++SV+GMTC ACVKTV   V  VDGV   EVSL+TEEC V +++ R    +I+E
Sbjct: 1  MADTQALISVQGMTCGACVKTVQTQVGNVDGVTECEVSLLTEECHVLFDKGRTTTSEILE 60

Query: 78 TIEDCGFEARV 88
          TI++CGF+  +
Sbjct: 61 TIDECGFDGSL 71

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 47/67 (70%)

Query: 22  TAVLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEECRVEYERKRVGLRQIVETIED 81
           + +L V GMTC ACVKTV   V  + GV+  +VSLVTEEC+V+++     + +I E I+D
Sbjct: 88  SGILLVSGMTCGACVKTVTGQVLKLSGVLECDVSLVTEECKVKFDPHFTSMAEIAECIDD 147

Query: 82  CGFEARV 88
           CGF+A+V
Sbjct: 148 CGFDAKV 154

>Scas_615.9
          Length = 942

 Score =  515 bits (1326), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 290/776 (37%), Positives = 427/776 (55%), Gaps = 47/776 (6%)

Query: 41  EAVRAVDGVVNAEVSLVTEECRVEYERKRVGLRQIVETIEDCGFEARVGGC-----AREE 95
           E V   DG+++ E +L      + Y+  ++G+R ++      G++A V        +   
Sbjct: 124 EKVGKQDGILSLEPALEVNTFNITYDENKIGIRDLIYFFNYLGYDATVESSNIISVSSAT 183

Query: 96  QVRRLXXXXXXXXXXXXXXXXXXXXXVMMGLYMVAPL------EEALGPTP----LAGLF 145
           Q+  L                     V M LYM  P+      +    P      + GLF
Sbjct: 184 QLALLSKWDEIQFWKFTCLKACVCAIVAMALYMWIPMIFPNLIKNNHFPFKETFFVHGLF 243

Query: 146 WRDXXXXXXXXXXXXXXXRPFXXXX-XXXXXXXXTMDTLVALSSGVTYLFSVATICRGVW 204
           +RD                 F             TMDTL+ALS+   YLFS+ +I   + 
Sbjct: 244 YRDIIGWAIATYSQFRLGIYFYKAAWSSMKHGSGTMDTLIALSTSCAYLFSIFSIIHTMV 303

Query: 205 LGSADP-----PSTFLDTTVMLVAFICVGKLLESXXXXXXXDSLARMVSSAPSMCTIRE- 258
           L   +      P+   DT+VML+AFI  GKLLE+        SL++++   PS C I + 
Sbjct: 304 LSRGNEESPMLPNVVFDTSVMLIAFISFGKLLENKAKAQTSSSLSKLIQLTPSKCIILQD 363

Query: 259 ----SGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEGEAEVDESLMTGESTLVPKYPG 314
                 S  E+E  LLQ  D++ ++PG K+PADG +++GE+E+DESLMTGES LV K  G
Sbjct: 364 KNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQGESEIDESLMTGESILVHKQKG 423

Query: 315 SRVLCGSVNGAAGFLYRADLVGEETRLAGIVAAMKQAQLAKAPIQRYADFLASWFIPSVL 374
           S+V+ GS+NG   F ++A  +G++T+LA I+  MK AQL KAPIQ  AD+LAS F+P++L
Sbjct: 424 SQVIAGSLNGPGHFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLASIFVPTIL 483

Query: 375 ILALLTFVCWMLICTLLATPPSIFNNSN--RLYVCSRIAITVIVVACPCPLGLAAPTAIM 432
            L+++TF+ W+ +  LL  PP IF N+N  + Y   +IAI+VIVVACPC LGLA PTAIM
Sbjct: 484 CLSIITFITWITLSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPTAIM 543

Query: 433 VGTGLGAERGLLFKGGDVIETAAAVQAILFDXXXXXXXXXXXVHNFTSESKALTPDQWAL 492
           VGTG+GA+ G+L KGGD++E    +  I+FD           V  F   S    P    L
Sbjct: 544 VGTGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQRFIPYSNDDLP---VL 600

Query: 493 VC--AAERLSEHPIARAIVTYAEPYASPEAVARIVVLNHEVLVGLGVRCVLQLDGVEHRI 550
            C  AA+ +SEHP+A+AIV Y    +S +  A ++V   E+++G GVRC  +  G  + +
Sbjct: 601 PCIMAAQSISEHPVAKAIVNYCGE-SSQDCDAGVIVTKSEIIIGKGVRCECEYQGRNYTV 659

Query: 551 TIGSARLLPERPSKFSGS--------TASFVAVNDVLLGRFDLSDSLREDAYEVVQALLS 602
           T+G   L+ +  S F  +        T S+V++ND L+G+F++ DS++ED  +++Q L  
Sbjct: 660 TVGHKALMTD--SMFDSNSDNTSDDFTKSYVSINDTLVGKFEIRDSVKEDVADIIQYLQG 717

Query: 603 RGHYVGMVTGDNHEAAMHVSHALGIPLNNVFSERLPEGKCDVLRQLR-QKYDYVAFIGDG 661
             + + MVTGD+H AAM V+  +GI  NNV+S   P GKC+++  L+      VAF+GDG
Sbjct: 718 LHYDIYMVTGDSHGAAMKVAQQVGIAANNVYSGVTPSGKCEIVESLQADSVGGVAFVGDG 777

Query: 662 INDSVALAESDLGISLSGNSDIVADAAGIVVL--DHSSAPPLTRILYAIDLARATFNRVK 719
           INDS  L  SD+G++LS  +DI  +AA IVVL  D      L  ++YA+D++  TF+RVK
Sbjct: 778 INDSPVLVTSDIGVALSTGTDIAMEAADIVVLGNDQDERESLKGLIYALDISAMTFSRVK 837

Query: 720 LNIFWAVLYNSLMLPVSMGVLIPWGIQLPPXXXXXXXXXXXXXXXXXXXXXXRWRP 775
            N+FWA+ YN  M+P++MG+L+PWGI + P                       W+P
Sbjct: 838 WNLFWALGYNIFMIPIAMGILVPWGITIHPMVAGLAMALSSVFVVLNSLRLKSWKP 893

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 50/75 (66%)

Query: 14 GNGSMAGTTAVLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEECRVEYERKRVGLR 73
          G GS       L+V+GMTC+AC   +   V  +DGV + EVSLVT EC VE++ ++V L 
Sbjct: 4  GLGSTTLYKGTLAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKVSLE 63

Query: 74 QIVETIEDCGFEARV 88
           I ET+EDCGF+A+V
Sbjct: 64 LIRETVEDCGFDAQV 78

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score =  478 bits (1229), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 284/790 (35%), Positives = 430/790 (54%), Gaps = 46/790 (5%)

Query: 48  GVVNAEVSLVTEECRVEYERKRVGLRQIVETIEDCGFEARV-GGCAREEQVRRLXXXXXX 106
           GV + E+S       ++Y    +G+R ++  +E  G++  V        Q+R L      
Sbjct: 192 GVKSIEISDDMHTLTIKYCCNELGIRDLLRHLERTGYKFTVFSNLDNTTQLRLLSKEDEI 251

Query: 107 XXXXXXXXXXXXXXXVMMGLYMVAPL------EEALGPTP----LAGLFWRDXXXXXXXX 156
                          + M LYM+ P+      ++ + P      + GLF+RD        
Sbjct: 252 RFWKKNSIKSTLLAIICMLLYMIVPMMWPTIVQDRIFPYKETSFVRGLFYRDILGVILAS 311

Query: 157 XXXXXXXRPFXXXX-XXXXXXXXTMDTLVALSSGVTYLFSVATICRGVWLGSA--DPPST 213
                    F             TMDTLV +S+   Y FSV ++   ++  S+    P  
Sbjct: 312 YIQFSVGFYFYKAAWASLKHGSGTMDTLVCVSTTCAYTFSVFSLVHNMFHPSSTGKLPRI 371

Query: 214 FLDTTVMLVAFICVGKLLESXXXXXXXDSLARMVSSAPSMCTI---RESGSDREVEVELL 270
             DT++M++++I +GK LE+        +L++++   PS+C+I    E    +E+ +ELL
Sbjct: 372 VFDTSIMIISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISDVERNETKEIPIELL 431

Query: 271 QAGDVVVMRPGTKLPADGTVLEGEAEVDESLMTGESTLVPKYPGSRVLCGSVNGAAGFLY 330
           Q  D+V ++PG K+PADG +  GE+E+DESLMTGES LVPK  G  V+ GSVNG   F +
Sbjct: 432 QVNDIVEIKPGMKIPADGIITRGESEIDESLMTGESILVPKKTGFPVIAGSVNGPGHFYF 491

Query: 331 RADLVGEETRLAGIVAAMKQAQLAKAPIQRYADFLASWFIPSVLILALLTFVCWMLICTL 390
           R   VGEET+LA I+  MK+AQL+KAPIQ YAD+LAS F+P +LILA+LTF  W  I  +
Sbjct: 492 RTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILILAVLTFFIWCFILNI 551

Query: 391 LATPPSIF---NNSNRLYVCSRIAITVIVVACPCPLGLAAPTAIMVGTGLGAERGLLFKG 447
            A PP  F     ++  ++C + A +V++VACPC LGLA PTAIMVGTG+GA+ G+L KG
Sbjct: 552 SANPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKG 611

Query: 448 GDVIETAAAVQAILFDXXXXXXXXXXXVHNFTSESKAL--TPDQWALVC--AAERLSEHP 503
           G+V+E   ++   +FD           V  F  +S  +    +   L C  A E +S+HP
Sbjct: 612 GEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGNVDEDEVLACIKATESISDHP 671

Query: 504 IARAIVTYAEPYASPEAVARIVVLNHEVLVGLGVRCVLQLDGVEHRITIGSARLLPERPS 563
           +++AI+ Y +     +A+   VVL  E ++G G+    Q++G  + I IG+  L+ E   
Sbjct: 672 VSKAIIRYCDGLNCNKAL-NAVVLESEYVLGKGIVSKCQVNGNTYDICIGNEALILEDAL 730

Query: 564 KFS---------GSTASFVAVNDVLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDN 614
           K S         G+T S+V+VN  + G F+++D ++ D+Y  VQ L   G+   M+TGDN
Sbjct: 731 KKSGFINSNVDQGNTVSYVSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDN 790

Query: 615 HEAAMHVSHALGIPLNNVFSERLPEGKCDVLRQLRQK--YDYVAFIGDGINDSVALAESD 672
           + AA  V+  +GI   NV+S+  P GKCD++++++ K   + VA +GDGIND+ ALA SD
Sbjct: 791 NSAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSD 850

Query: 673 LGISLSGNSDIVADAAGIVVL--DHSSAPPLTRILYAIDLARATFNRVKLNIFWAVLYNS 730
           LGI++S  ++I  +AA IV+L  +  +   L  +  AID++  TF R+KLN+FWA+ YN 
Sbjct: 851 LGIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIKLNLFWALCYNI 910

Query: 731 LMLPVSMGVLIPWGIQLPPXXXXXXXXXXXXXXXXXXXXXXRWRPVPAASR-------KA 783
            M+P++MGVLIPWGI LPP                      +W P    S        K 
Sbjct: 911 FMIPIAMGVLIPWGITLPPMLAGLAMAFSSVSVVLSSLMLKKWTPPDIESHGISDFKSKF 970

Query: 784 AVGS-WRNFF 792
           ++G+ W   F
Sbjct: 971 SIGNFWSRLF 980

 Score = 72.4 bits (176), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 53/89 (59%), Gaps = 1/89 (1%)

Query: 1   MEVTGLEAEMARMGNGSMAGTT-AVLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTE 59
           +E  G + E+ R    +   T   +LSV+GMTC +CV TV + V  ++GV +  VSLVTE
Sbjct: 59  IEDCGFDCEILRDSEITAISTKEGLLSVQGMTCGSCVSTVTKQVEGIEGVESVVVSLVTE 118

Query: 60  ECRVEYERKRVGLRQIVETIEDCGFEARV 88
           EC V YE  +  L    E IEDCGF++ +
Sbjct: 119 ECHVIYEPSKTTLETAREMIEDCGFDSNI 147

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 44/65 (67%), Gaps = 1/65 (1%)

Query: 24 VLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEECRVEYERKRVGLRQIVETIEDCG 83
          +L+V GMTC+AC  T++  +RA+ GV   ++SLVT EC+V Y+ + V    I E IEDCG
Sbjct: 5  ILAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNE-VTADSIKEIIEDCG 63

Query: 84 FEARV 88
          F+  +
Sbjct: 64 FDCEI 68

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score =  468 bits (1203), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 249/640 (38%), Positives = 382/640 (59%), Gaps = 25/640 (3%)

Query: 179 TMDTLVALSSGVTYLFSVATICRGVWL--GSADPPSTFLDTTVMLVAFICVGKLLESXXX 236
           TMDTLV  S+   YLFS+ ++   +     S   P    DT+VM+VA+I +GK LE+   
Sbjct: 336 TMDTLVCFSTTCAYLFSLYSMTECIVSPPASGKLPKVIFDTSVMIVAYISIGKYLENKAK 395

Query: 237 XXXXDSLARMVSSAPSMCTIRESGSD---REVEVELLQAGDVVVMRPGTKLPADGTVLEG 293
                +L++++S  PS C I +   D   +E+ +ELL+ GD+ +++PG K+P+DG V +G
Sbjct: 396 SKTSTALSKLISLTPSSCIIVDKDDDSITQEIGIELLEVGDIAMVKPGAKIPSDGIVTKG 455

Query: 294 EAEVDESLMTGESTLVPKYPGSRVLCGSVNGAAGFLYRADLVGEETRLAGIVAAMKQAQL 353
            +EVDESLMTGE+ LV K  GS V  G++NG+    +    VG++T+LA I+  MK AQL
Sbjct: 456 ISEVDESLMTGETNLVVKEIGSVVTGGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQL 515

Query: 354 AKAPIQRYADFLASWFIPSVLILALLTFVCWMLIC--TLLATPPSIFNNS--NRLYVCSR 409
            KA IQRY D++AS F+P+VLIL+LLTF+ W  +     + +  SIF  +  +R Y+C +
Sbjct: 516 KKASIQRYTDYVASIFVPTVLILSLLTFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQ 575

Query: 410 IAITVIVVACPCPLGLAAPTAIMVGTGLGAERGLLFKGGDVIETAAAVQAILFDXXXXXX 469
           IA +V++VACPC LGLA PTAIMVGTG+ +E G+L KGGDV+E    V   +FD      
Sbjct: 576 IATSVVIVACPCALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLT 635

Query: 470 XXXXXVHNFTSESKALTPDQWALVCA--AERLSEHPIARAIVTYAEPY--ASPEAVARIV 525
                V  F   ++ +  + + L C   AE LS+HP+++A+V Y       S E  + ++
Sbjct: 636 TGHMTVQQFVGNAE-MIKNLFYLECIERAEALSDHPVSKAVVKYCRDLLGESFEGTS-MI 693

Query: 526 VLNHEVLVGLGVRCVLQLDGVEHRITIGSARLLPERP--------SKFSGSTASFVAVND 577
           + + +++ G G++C ++      RIT+G+  L+ E           +    T +++A++D
Sbjct: 694 IEDEQLITGKGIKCTVKAADKTLRITVGNKSLMDEDSLGEFWQMYGRAGPCTVTYLAIDD 753

Query: 578 VLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLNNVFSERL 637
            + GRF+L D ++ DA +V++ L +  + V MVTGD H++AM V+  + IP NNV+SE  
Sbjct: 754 KVCGRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVYSEVT 813

Query: 638 PEGKCDVLRQLRQKYDYVAFIGDGINDSVALAESDLGISLSGNSDIVADAAGIVVLD--H 695
           P+GK   +  LR++   +AFIGDGINDS+AL  SDLGI++S  +++  +AAGIV+L+   
Sbjct: 814 PDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSGTEVAIEAAGIVILNDPD 873

Query: 696 SSAPPLTRILYAIDLARATFNRVKLNIFWAVLYNSLMLPVSMGVLIPWGIQLPPXXXXXX 755
           +  P L  ++ A+DL+  TF RVKLN+FWA+ YN  MLP++MG+L+PWGI L P      
Sbjct: 874 TDEPTLKGVVNALDLSIRTFRRVKLNLFWALCYNVFMLPIAMGILVPWGITLHPMVAGLA 933

Query: 756 XXXXXXXXXXXXXXXXRWRPVPAASRKAAVGSWRNFFKKG 795
                            W+     S+ +       ++ KG
Sbjct: 934 MAFSSVSVVVNSLMLKWWKAPELTSKNSHSSKGYGYYTKG 973

 Score = 73.2 bits (178), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 57/88 (64%)

Query: 1   MEVTGLEAEMARMGNGSMAGTTAVLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEE 60
           +E  G + E+ R  + + A     + ++GMTC++CV TV + + A++GV + +VSL+TEE
Sbjct: 59  VEDCGFDCELIREKSMAPALCRGFIGIKGMTCSSCVATVTKQLEAIEGVSDVDVSLMTEE 118

Query: 61  CRVEYERKRVGLRQIVETIEDCGFEARV 88
           C V ++ + V +  I ETI+DCGF+  V
Sbjct: 119 CTVVFDPQLVAIEDIKETIDDCGFDGTV 146

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 43/65 (66%), Gaps = 1/65 (1%)

Query: 24 VLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEECRVEYERKRVGLRQIVETIEDCG 83
          VL VRGMTCA+CV  V   V A++GV + +VSLVT EC+V  E   V    I+E +EDCG
Sbjct: 5  VLIVRGMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVVSE-DSVATDGIIEAVEDCG 63

Query: 84 FEARV 88
          F+  +
Sbjct: 64 FDCEL 68

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transporting
            ATPase, involved in resistance to cadmium [3651 bp, 1216
            aa]
          Length = 1216

 Score =  244 bits (622), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 168/582 (28%), Positives = 291/582 (50%), Gaps = 28/582 (4%)

Query: 180  MDTLVALSSGVTYLFSVATICRGVWLGSADPPSTFLDTTVMLVAFICVGKLLESXXXXXX 239
            MD L+ LS+   Y+FS+ +    V +G       F +T+ +LV  I VG+ +        
Sbjct: 625  MDLLIVLSTSAAYIFSIVSFGYFV-VGRPLSTEQFFETSSLLVTLIMVGRFVSELARHRA 683

Query: 240  XDSLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEGEAEVDE 299
              S++     A S   + ++G + E+ + LLQ GD+  + P +++P DGTV+ G +EVDE
Sbjct: 684  VKSISVRSLQASSAILVDKTGKETEINIRLLQYGDIFKVLPDSRIPTDGTVISGSSEVDE 743

Query: 300  SLMTGESTLVPKYPGSRVLCGSVNGAAG-FLYRADLVGEETRLAGIVAAMKQAQLAKAPI 358
            +L+TGES  VPK   S V+ GSVNG    F+  + L G  T ++ I   + +A+L K  I
Sbjct: 744  ALITGESMPVPKKCQSIVVAGSVNGTGTLFVKLSKLPGNNT-ISTIATMVDEAKLTKPKI 802

Query: 359  QRYADFLASWFIPSVLILALLTFVCWMLICTLLATPPSIFNNSNRLYVCSRIAITVIVVA 418
            Q  AD +AS+F+P+++ + ++TF  W+ +   +       + S+ +      AITV++V+
Sbjct: 803  QNIADKIASYFVPTIIGITVVTFCVWIAVGIRVEKQ----SRSDAVIQAIIYAITVLIVS 858

Query: 419  CPCPLGLAAPTAIMVGTGLGAERGLLFKGGDVIETAAAVQAILFDXXXXXXXXXXXVHNF 478
            CPC +GLA P   ++ +G+ A+RG++FK  + IE A     ++FD           V + 
Sbjct: 859  CPCVIGLAVPIVFVIASGVAAKRGVIFKSAESIEVAHNTSHVVFDKTGTLTEGKLTVVHE 918

Query: 479  TSESKALTPDQWALVCAAERLSEHPIARAIVTY-AEPYASPEAVARIVVLNHEVLVGLGV 537
            T   +    +  +L+       +HP++ AI +Y  E   S + V+    +  + + G   
Sbjct: 919  T--VRGDRHNSQSLLLGLTEGIKHPVSMAIASYLKEKGVSAQNVSNTKAVTGKRVEGTSY 976

Query: 538  RCVLQLDGVEHRITIGSARLLPERPSKFSGSTASFVAVNDVLLGRFDLSDSLREDAYEVV 597
               L+L G   R  +G       R +   G +    +VN  +   + L DSLR DA   +
Sbjct: 977  S-GLKLQGGNCRW-LGHNNDPDVRKALEQGYSVFCFSVNGSVTAVYALEDSLRADAVSTI 1034

Query: 598  QALLSRGHYVGMVTGDNHEAAMHVSHALGIPLNNVFSERLPEGKCDVLRQL--------- 648
              L  RG  + +++GD+  A   ++  LGI  +N+ S   P  K + ++ +         
Sbjct: 1035 NLLRQRGISLHILSGDDDGAVRSMAARLGIESSNIRSHATPAEKSEYIKDIVEGRNCDSS 1094

Query: 649  -RQKYDYVAFIGDGINDSVALAESDLGISLSGNSDIVADAAGIVVLDHSSAPPLTRILYA 707
             + K   V F GDG ND++ L ++ +G+ ++  S++   AA +V+L     P L  IL  
Sbjct: 1095 SQSKRPVVVFCGDGTNDAIGLTQATIGVHINEGSEVAKLAADVVML----KPKLNNILTM 1150

Query: 708  IDLARATFNRVKLNIFWAVLYNSLMLPVSMGVLIPWGIQLPP 749
            I +++    RVKLN  W+  YN   + ++ G  + +   +PP
Sbjct: 1151 ITVSQKAMFRVKLNFLWSFTYNLFAILLAAGAFVDF--HIPP 1190

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score =  242 bits (617), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 180/621 (28%), Positives = 304/621 (48%), Gaps = 66/621 (10%)

Query: 179  TMDTLVALSSGVTYLFSVATICRGVWLGSAD----PPSTFLDTTVMLVAFICVGKLLESX 234
            +M+ LV+L + V Y  S+  +        A+     P T+ D+ V L  F+ +G+LLES 
Sbjct: 563  SMNLLVSLGTSVAYFASILLLILSALKKDANHHKGSPDTYFDSVVFLTLFLLIGRLLESL 622

Query: 235  XXXXXXDSLARMVSSAPSMCTIRESGSDRE------VEVELLQAGDVVVMRPGTKLPADG 288
                   +L  + S       + ++   R+      V  E+L+ GD ++++PG     D 
Sbjct: 623  SKSKMVKTLESLTSLKQRTGILMQADGARDFKKETSVSAEMLELGDHILIKPGASPAVDA 682

Query: 289  TVLEGEAEVDESLMTGESTLVPKYPGSRVLCGSVN-GAAGFLYRADLVGEETRLAGIVAA 347
             +++GE E DES +TGES  +  +PG ++  G+VN G    + +       + L  +++A
Sbjct: 683  LIVQGETEFDESSLTGESRPITHFPGDQIFAGTVNVGQCAVIAKVSTAPGNSLLDHVISA 742

Query: 348  MKQAQLAKAPIQRYADFLASWFIPSVLILALLTFVCWMLICTLLATPPSIFNNS--NRLY 405
            ++  QL  API+R AD L  +F+P +++LA+LT+  W+++           + S     +
Sbjct: 743  VRDGQLRGAPIERIADVLTGYFVPFIVLLAILTWAIWLILGFAGVLSQEKLDGSVGGWPF 802

Query: 406  VCSRIAITVIVVACPCPLGLAAPTAIMVGTGLGAERGLLFKGGD-VIETAAAVQAILFDX 464
                 AI V V+ACPC +GLAAPTA+ VG  + A+ G+L +GG    +  + V  + FD 
Sbjct: 803  WSLEFAIAVFVIACPCGIGLAAPTALFVGANIAAKYGILARGGSAAFQMGSKVTTVCFDK 862

Query: 465  XXXXXXX-XXXVHNFTSESKALTPDQWALVCAAERL------SEHPIARAIVTYAEPYAS 517
                       V ++     A+ PD        + L      S+HP++ ++  +A     
Sbjct: 863  TGTLTKGCAPEVTDY-----AIYPDPRIHKILGKVLHEFGLASKHPLSHSMKCFALKTLG 917

Query: 518  PEAVARIVVLNHEVLVGLGVRCVL-----QLDG-----VEHRITIGSARLLPERPSKFSG 567
             E ++ I VL  + + G G+  V+     Q  G     V   + +G+ + + E   + S 
Sbjct: 918  -EDLSDINVLEIKEIPGKGMTGVIEPSPAQPSGFRDELVPSEVIVGNEKFMAENGCQLSP 976

Query: 568  STASFV--------------------AVNDVLLGRFDLS--DSLREDAYEVVQALLSRGH 605
               S +                    A     +    L+  D LR +A EVVQAL  RG 
Sbjct: 977  DQESLLYSWKIEGRSIIIIGMNFPEGAATQCFIPTLFLAVRDELRPEAKEVVQALHERGI 1036

Query: 606  YVGMVTGDNHEAAMHVSHALGIPLNNVFSERLPEGKCDVLRQLRQKYDY---VAFIGDGI 662
               M++GDN  AA  V+  +GI   +V ++ LPEGK + ++ +R+       +A +GDG+
Sbjct: 1037 ECWMISGDNSLAANAVALEVGI--KHVIADVLPEGKAEKIQWIRETSGQGVAIAMVGDGM 1094

Query: 663  NDSVALAESDLGISLSGNSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVKLNI 722
            ND+ A+A +D+GISL+  SD+   +   V+L  S   PLT I+  + L++  F RVK N 
Sbjct: 1095 NDAPAIAAADVGISLASGSDLAMISCDFVLL--SKKNPLTGIVVLLQLSKKVFRRVKFNF 1152

Query: 723  FWAVLYNSLMLPVSMGVLIPW 743
             WA++YN + +P++ GVL P+
Sbjct: 1153 VWALVYNIICVPIAAGVLYPY 1173

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 7/68 (10%)

Query: 27  VRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEEC----RVEYERKRVGLRQIVETIEDC 82
           + G+TCA+C  ++  A   +D + +  V+ VT+       V  ER    LR +V   E+C
Sbjct: 289 IGGITCASCCNSITAAASKLDFIADVAVNAVTKTAIFISDVNNERAINCLRDVV---EEC 345

Query: 83  GFEARVGG 90
           GFE  + G
Sbjct: 346 GFEFELVG 353

>KLLA0D04092g complement(344666..348124) some similarities with
           sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
           copper-transporting ATPase P16.2.f2.1, hypothetical
           start
          Length = 1152

 Score =  156 bits (395), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 95/290 (32%), Positives = 156/290 (53%), Gaps = 24/290 (8%)

Query: 179 TMDTLVALSSGVTYLFSVATICRGVWLGSADP------------PSTFLDTTVMLVAFIC 226
           +M+ L++L + V Y  S+A +     + ++ P             +T+ D+ V L  F+ 
Sbjct: 468 SMNLLMSLGTTVAYFASIALLG----IAASRPRDTSDSRMHKGLSTTYFDSVVFLTFFLL 523

Query: 227 VGKLLESXXXXXXXDSLARMVSSAPSMCTIRESGSDREVEVELLQA-----GDVVVMRPG 281
           +G+LLES        +++ + S      T+ +   D+  EVE +Q      GD + + PG
Sbjct: 524 IGRLLESLAKTKTASAISNLSSFKQETATLMQKVGDQYQEVETVQIQYLELGDYIKISPG 583

Query: 282 TKLPADGTVLEGEAEVDESLMTGESTLVPKYPGSRVLCGSVN-GAAGFLYRADLVGEETR 340
              P D  +LEGE E DES +TGES  + +  G ++  G+VN G++  + +      E+ 
Sbjct: 584 QSPPLDSIILEGETEFDESALTGESIPMVRLRGDQIFAGTVNVGSSSVIAKVSSFDGESL 643

Query: 341 LAGIVAAMKQAQLAKAPIQRYADFLASWFIPSVLILALLTFVCWMLICTLLATPPSIFNN 400
           L  IV  ++  QL +API+R AD L  +F+P ++ LA+LT+V W+ +      P    + 
Sbjct: 644 LDQIVNTVRDGQLNRAPIERLADILTGYFVPIIIFLAILTWVVWLSLGLSGKLPEHYLDT 703

Query: 401 SNRLY-VCS-RIAITVIVVACPCPLGLAAPTAIMVGTGLGAERGLLFKGG 448
               + V S   AI+V V+ACPC +GLAAPTA+ VG+G+ A+ G+L +GG
Sbjct: 704 DIGGWPVWSLEFAISVFVIACPCGIGLAAPTALFVGSGMAAKFGILCRGG 753

 Score = 90.1 bits (222), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 94/165 (56%), Gaps = 11/165 (6%)

Query: 586  SDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLNNVFSERLPEGKCDVL 645
             D +R +A +V++ L   G    M++GDN   A  V+  L I  +NV +E LPE K   +
Sbjct: 928  KDEIRPEAKDVIKELRRSGIECWMISGDNEVTARAVAQELDI--DNVIAEVLPEEKAAKV 985

Query: 646  RQLRQK-------YDYVAFIGDGINDSVALAESDLGISLSGNSDIVADAAGIVVLDHSSA 698
            + ++         +  VA +GDGIND+ ALA +D+GI+L+  S++   +   V+L  S  
Sbjct: 986  KWIQHNNIGANGHHKVVAMVGDGINDAPALAAADVGIALASGSELAMTSCDFVLL--SPI 1043

Query: 699  PPLTRILYAIDLARATFNRVKLNIFWAVLYNSLMLPVSMGVLIPW 743
              L  +L  + L++  FNR+K N  WA++YN L LP++ GV+ P+
Sbjct: 1044 NTLVSLLALLKLSKTVFNRIKFNFTWALVYNMLALPIAAGVIYPY 1088

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 26  SVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTE-ECRVEYERKRVGLRQIVETIEDCGF 84
           S+ G+TCAAC  ++  AV  +D V +  V++V++    +     +  L Q+ ET+EDCGF
Sbjct: 192 SIGGITCAACASSITNAVSDLDFVSDVAVNVVSKVGVFILDSDDQSKLDQLKETVEDCGF 251

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 83.6 bits (205), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 130/556 (23%), Positives = 219/556 (39%), Gaps = 86/556 (15%)

Query: 250 APSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEGEA--EVDESLMTGEST 307
           A +   IR+ G   E+    +  GD++ +  GT +P DG ++  +   ++D+S +TGES 
Sbjct: 177 ANTAVVIRD-GQLVEIPANEVVPGDILQLEDGTVIPTDGRIVTEDCFLQIDQSAITGESL 235

Query: 308 LVPKYPGSRVLCGS-VNGAAGFLYRADLVGEETRLAGIVAAMKQAQLAKAPIQRYADFLA 366
            V K+ G +    S V    GF+      G+ T +    A + +A   +       + + 
Sbjct: 236 AVDKHYGDQTFSSSTVKRGEGFMV-VTATGDNTFVGRAAALVNKAAGGQGHFTEVLNGIG 294

Query: 367 SWFIPSVLILALLTFVCWMLICTLLATPPSIFNNSNRLYVCSRIAITVIVVACPCPLGLA 426
                 +++L L+       I TLL    + F  +N +    R  + + ++  P  L   
Sbjct: 295 ------IILLVLV-------IATLLLVWTACFYRTNGIVRILRYTLGITIIGVPVGLPAV 341

Query: 427 APTAIMVGTGLGAERGLLFKGGDVIETAAAVQAILFDXXXXXXXXXXXVHN-FTSESKAL 485
             T + VG    A++  + +    IE+ A V+ +  D           +H  +T E   +
Sbjct: 342 VTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVE--GV 399

Query: 486 TPDQWALVC--AAER---------------LSEHPIAR-AIVTYAEPYASP-EAVARIVV 526
           +PD   L    AA R               L ++P A+ A+  Y      P + V++ V 
Sbjct: 400 SPDDLMLTACLAASRKKKGLDAIDKAFLKSLKQYPKAKDALTKYKVLEFHPFDPVSKKVT 459

Query: 527 LNHEVLVGLGVRCV-----LQLDGVE---------HRITIGSARLLPERPSKFSGSTASF 572
              E   G  + CV       L  VE         H         L  R  +  G     
Sbjct: 460 AVVESPEGERIVCVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVARKR 519

Query: 573 VAVNDVLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLN-- 630
              +  +LG     D  R+D  + V      G  V M+TGD    A      LG+  N  
Sbjct: 520 GEGHWEILGVMPCMDPPRDDTAQTVSEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIY 579

Query: 631 -------------------------NVFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDS 665
                                    + F+E  P+ K  V+  L+ +   VA  GDG+ND+
Sbjct: 580 NAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDA 639

Query: 666 VALAESDLGISLSGNSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVKLNIFWA 725
            +L ++D GI++ G +D    AA IV L    AP L+ I+ A+  +R  F+R+   + + 
Sbjct: 640 PSLKKADTGIAVEGATDAARSAADIVFL----APGLSAIIDALKTSRQIFHRMYSYVVYR 695

Query: 726 VLYNSLMLPVSMGVLI 741
           +   SL L + +G+ I
Sbjct: 696 IAL-SLHLEIFLGLWI 710

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 124/553 (22%), Positives = 212/553 (38%), Gaps = 83/553 (15%)

Query: 252 SMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEGEA--EVDESLMTGESTLV 309
           +  T+   G   E+    +  G+++ +  GT  PADG ++  +   ++D+S +TGES   
Sbjct: 207 NTATVIRDGQLIEIPANEVVPGEILQLESGTIAPADGRIVTEDCFLQIDQSAITGESLAA 266

Query: 310 PKYPGSRVLCGSVNGAAGFLYRADLVGEETRLAGIVAAMKQAQLAKAPIQRYADFLASWF 369
            K+ G  V   S              G+ T +    A + QA   +       + +    
Sbjct: 267 EKHYGDEVFSSSTVKTGEAFMVVTATGDNTFVGRAAALVGQASGVEGHFTEVLNGIG--- 323

Query: 370 IPSVLILALLTFVCWMLICTLLATPPSIFNNSNRLYVCSRIAITVIVVACPCPLGLAAPT 429
              +++L L+       I TLL    + F  +  +    R  + + ++  P  L     T
Sbjct: 324 ---IILLVLV-------IATLLLVWTACFYRTVGIVSILRYTLGITIIGVPVGLPAVVTT 373

Query: 430 AIMVGTGLGAERGLLFKGGDVIETAAAVQAILFDXXXXXXXXXXXVHN-FTSESKALTPD 488
            + VG    A++  + +    IE+ A V+ +  D           +H  +T E   ++PD
Sbjct: 374 TMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVE--GVSPD 431

Query: 489 QWALVC--AAER---------------LSEHPIAR-AIVTYAEPYASP-EAVARIVVLNH 529
              L    AA R               L E+P A+ A+  Y      P + V++ V    
Sbjct: 432 DLMLTACLAASRKKKGLDAIDKAFLKSLIEYPKAKDALTKYKVLEFHPFDPVSKKVTAVV 491

Query: 530 EVLVGLGVRCV-----LQLDGVE---------HRITIGSARLLPERPSKFSGSTASFVAV 575
           E   G  + CV       L  VE         H         L  R  +  G        
Sbjct: 492 ESPEGERIVCVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVARKRGEG 551

Query: 576 NDVLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLN----- 630
           +  +LG     D  R+D  + +    + G  + M+TGD    A      LG+  N     
Sbjct: 552 HWEILGVMPCMDPPRDDTAQTINEARNLGLRIKMLTGDAVGIAKETCRQLGLGTNIYNAE 611

Query: 631 ----------------------NVFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVAL 668
                                 + F+E  P+ K  V+  L+ +   VA  GDG+ND+ +L
Sbjct: 612 RLGLGGGGDMPGSELADFVENADGFAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSL 671

Query: 669 AESDLGISLSGNSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVKLNIFWAVLY 728
            ++D GI++ G +D    AA IV L    AP L+ I+ A+  +R  F+R+   + + +  
Sbjct: 672 KKADTGIAVEGATDAARSAADIVFL----APGLSAIIDALKTSRQIFHRMYSYVVYRIAL 727

Query: 729 NSLMLPVSMGVLI 741
            SL L + +G+ I
Sbjct: 728 -SLHLEIFLGLWI 739

>Scas_707.48*
          Length = 741

 Score = 75.9 bits (185), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 95/191 (49%), Gaps = 38/191 (19%)

Query: 558 LPERPSKFSGSTASFVAVNDVLL-GRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHE 616
           LP+ P+  +  +     V D++  G   ++D  R      ++ LL  G ++ M+TGD+  
Sbjct: 548 LPDSPTLLTEES-----VGDLIFTGLIGMNDPPRPTVKPAIEQLLQGGVHIIMITGDSEN 602

Query: 617 AAMHVSHALGIP-------------LN--------------NVFSERLPEGKCDVLRQLR 649
            A++++  +GIP             LN              N+F+   PE K +++R LR
Sbjct: 603 TAVNIARQIGIPVLDPKLSVLSGDKLNEMSDDQLANVIDHVNIFARATPEHKLNIVRALR 662

Query: 650 QKYDYVAFIGDGINDSVALAESDLGISLSG-NSDIVADAAGIVVLDHSSAPPLTRILYAI 708
           ++ D VA  GDG+ND+ AL  +D+G+S+    +D+  +A+ +V+ D       + IL AI
Sbjct: 663 KRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMVLTDDD----FSTILTAI 718

Query: 709 DLARATFNRVK 719
           +  +  FN ++
Sbjct: 719 EEGKGIFNNIQ 729

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 62/269 (23%), Positives = 108/269 (40%), Gaps = 41/269 (15%)

Query: 218 TVMLVAFICVGKLLESXXXXXXXDSLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVV 277
           T+ +V  + VG  ++        ++L ++V   P+ C +   G +  V    L  GD+V 
Sbjct: 121 TLAIVIVVSVG-FVQEYRSEKSLEALNKLV---PAECHLIRCGQESHVLASGLVPGDLVH 176

Query: 278 MRPGTKLPADGTVLEG-EAEVDESLMTGESTLVPKYPGSRVLCGSVNGAAGFL------- 329
            + G ++PAD  ++E  +  +DES +TGE+  V K     V   S N     +       
Sbjct: 177 FKIGDRIPADLRIIEAVDLSIDESNLTGENEPVHK-SAKEVNKDSFNDQPNSIIPISDRT 235

Query: 330 ---YRADLV------------GEETRLAGIVAAMKQAQLAKAPIQRYADFLASWFIPSVL 374
              Y   LV            G+ T    I   +   +  K P+Q   D L         
Sbjct: 236 CVAYMGTLVKEGHGKGIVVGIGKNTSFGAIFEMLSNIEKPKTPLQNAMDKLGKD------ 289

Query: 375 ILALLTFVCWMLICTLLATPPSIFNNSNRLYVCSRIAITVIVVACPCPLGLAAPTAIMVG 434
            L+L +F+   LIC +      I    + L +  +I++++ V A P  L +     + +G
Sbjct: 290 -LSLFSFIVIGLICLV-----GILQGRSWLEMF-QISVSLAVAAIPEGLPIIVTVTLALG 342

Query: 435 TGLGAERGLLFKGGDVIETAAAVQAILFD 463
               A+R  + +    +ET  +V  I  D
Sbjct: 343 VLRMAKRKAIVRRLPSVETLGSVNVICSD 371

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 128/557 (22%), Positives = 216/557 (38%), Gaps = 88/557 (15%)

Query: 250 APSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVL-EG-EAEVDESLMTGEST 307
           A S   IR+ GS  E+    +  GD++ +  G  +PADG ++ EG   ++D+S +TGES 
Sbjct: 158 ANSAVVIRD-GSLVEIPANEVVPGDILQLEDGVIIPADGRIVTEGCFVQIDQSAITGESL 216

Query: 308 LVPKYPGSRVLCGS-VNGAAGFLYRADLVGEETRLAGIVAAMKQAQLAKAPIQRYADFLA 366
            V K  G      S V    GF+      G+ T +    A + +A           + + 
Sbjct: 217 AVDKRYGDATFSSSTVKRGEGFMI-VTATGDSTFVGRAAALVNKASAGSGHFTEVLNGIG 275

Query: 367 SWFIPSVLILALLTFVCWMLICTLLATPPSIFNNSNRLYVCSRIAITVIVVACPCPLGLA 426
           +  +  V++  L+ +V     C         F  S  +    R  + + VV  P  L   
Sbjct: 276 TILLILVILTLLVVYVA----C---------FYRSIDIVTILRYTLAITVVGVPVGLPAV 322

Query: 427 APTAIMVGTGLGAERGLLFKGGDVIETAAAVQAILFDXXXXXXXXXXXVHNFTSESKALT 486
             T + VG    A++  + +    IE+ A V+ +  D           +H   +      
Sbjct: 323 VTTTMAVGAAYLAKKKAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEA 382

Query: 487 PDQWALVCAA----------------ERLSEHPIARAIVTYAE--PYASPEAVARIVVLN 528
            D     C A                + L  +P A+A +T  +   +   + V++ V   
Sbjct: 383 DDLMLTACLAASRKKKGLDAIDKAFLKSLINYPRAKAALTKYKVLEFHPFDPVSKKVTAI 442

Query: 529 HEVLVGLGVRCVLQLDGVEHRI--TIGSARLLPERPSKFSGSTASFVAVNDV-------- 578
            E   G  + CV    G    +  T+    L+PE   +   +  + +A            
Sbjct: 443 VESPEGERIVCV---KGAPLFVLKTVEENHLIPEDVKENYENKVAELASRGYRALGVARK 499

Query: 579 -------LLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLN- 630
                  +LG     D  R+D  + V      G  V M+TGD    A      LG+  N 
Sbjct: 500 RGEGHWEILGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNI 559

Query: 631 --------------------------NVFSERLPEGKCDVLRQLRQKYDYVAFIGDGIND 664
                                     + F+E  P+ K +V+  L+Q+   VA  GDG+ND
Sbjct: 560 YNAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVND 619

Query: 665 SVALAESDLGISLSGNSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVKLNIFW 724
           + +L ++D GI++ G +D    AA IV L    AP L+ I+ A+  +R  F+R+   + +
Sbjct: 620 APSLKKADTGIAVEGATDAARSAADIVFL----APGLSAIIDALKTSRQIFHRMYSYVVY 675

Query: 725 AVLYNSLMLPVSMGVLI 741
            +   SL L + +G+ I
Sbjct: 676 RIAL-SLHLEIFLGLWI 691

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 84/167 (50%), Gaps = 32/167 (19%)

Query: 581 GRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPL----------- 629
           G   ++D  R +    ++ LL  G ++ M+TGD+   A++++  +GIP+           
Sbjct: 574 GLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGD 633

Query: 630 ----------------NNVFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVALAESDL 673
                            N+F+   PE K +++R LR++ D VA  GDG+ND+ AL  SD+
Sbjct: 634 KLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDI 693

Query: 674 GISLSG-NSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVK 719
           G+S+    +D+  +A+ +V+ D       + IL AI+  +  FN ++
Sbjct: 694 GVSMGRIGTDVAKEASDMVLTDDD----FSTILTAIEEGKGIFNNIQ 736

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 56/246 (22%), Positives = 99/246 (40%), Gaps = 39/246 (15%)

Query: 242 SLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEG-EAEVDES 300
           SL  +    P+ C +   G +  V    L  GD+V  R G ++PAD  ++E  +  +DES
Sbjct: 141 SLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDES 200

Query: 301 LMTGESTLVPKYPGSRVLCGS-----------VNGAAGFLYRADLV------------GE 337
            +TGE+   P +  S+ +  S           ++  +   Y   LV            G 
Sbjct: 201 NLTGENE--PVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGT 258

Query: 338 ETRLAGIVAAMKQAQLAKAPIQRYADFLASWFIPSVLILALLTFVCWMLICTLLATPPSI 397
            T    +   M   +  K P+Q   D L          L+L++F+   +IC +      I
Sbjct: 259 NTSFGAVFEMMNNIEKPKTPLQLTMDKLGKD-------LSLVSFIVIGMICLV-----GI 306

Query: 398 FNNSNRLYVCSRIAITVIVVACPCPLGLAAPTAIMVGTGLGAERGLLFKGGDVIETAAAV 457
               + L +  +I++++ V A P  L +     + +G    A+R  + +    +ET  +V
Sbjct: 307 IQGRSWLEMF-QISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSV 365

Query: 458 QAILFD 463
             I  D
Sbjct: 366 NVICSD 371

>Kwal_47.17522
          Length = 899

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 126/558 (22%), Positives = 220/558 (39%), Gaps = 86/558 (15%)

Query: 248 SSAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEGEA--EVDESLMTGE 305
           S A S   +R+ G+  E+    +  GD++ +  G  + ADG ++  E   ++D+S +TGE
Sbjct: 156 SLANSAVVVRD-GNLVEIPANEVVPGDIMQLEDGVVICADGRLVTEECFLQIDQSAITGE 214

Query: 306 STLVPKYPGSRVLCGS-VNGAAGFLYRADLVGEETRLAGIVAAMKQAQLAKAPIQRYADF 364
           S  V K+ G      S V    GF+      G+ T +    A + QA   +     + + 
Sbjct: 215 SLAVDKHYGDTTFSSSTVKRGEGFMI-VTATGDNTFVGRAAALVNQAAGDQG---HFTEV 270

Query: 365 LASWFIPSVLILALLTFVCWMLICTLLATPPSIFNNSNRLYVCSRIAITVIVVACPCPLG 424
           L       ++++ +   + W           + F  ++R+    R  + + ++  P  L 
Sbjct: 271 LNGIGTILLVLVIVTLLLVWT----------ACFYRTDRIVRILRYTLGITIIGVPVGLP 320

Query: 425 LAAPTAIMVGTGLGAERGLLFKGGDVIETAAAVQAILFDXXXXXXXXXXXVHN-FTSESK 483
               T + VG    A++  + +    IE+ A V+ +  D           +H  +T E  
Sbjct: 321 AVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVE-- 378

Query: 484 ALTPDQWALVC--AAERLSE--HPIARAIVTYAEPYA-SPEAVARIVVLNHEVL--VGLG 536
            + PD   L    AA R  +    I +A +     Y  +  A+ +  VL+      V   
Sbjct: 379 GVEPDDLMLTACLAASRKKKGLDAIDKAFLKSLIQYPRAKNALTKYKVLDFHPFDPVSKK 438

Query: 537 VRCVLQLDGVEHRITIGSARL-----------LPERPSKFSGSTASFVAVNDV------- 578
           V  V++    E  I +  A L           +PE   +   +  + +A           
Sbjct: 439 VTAVVESPEGERIICVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVAR 498

Query: 579 --------LLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLN 630
                   +LG     D  R+D  + V      G  V M+TGD    A      LG+  N
Sbjct: 499 KRGEGHWEILGVMPCMDPPRDDTAQTVHEARRLGLRVKMLTGDAVGIAKETCRQLGLGTN 558

Query: 631 ---------------------------NVFSERLPEGKCDVLRQLRQKYDYVAFIGDGIN 663
                                      + F+E  P+ K  V+  L+Q+   VA  GDG+N
Sbjct: 559 IYNAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYSVVEILQQRGYLVAMTGDGVN 618

Query: 664 DSVALAESDLGISLSGNSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVKLNIF 723
           D+ +L ++D GI++ G +D    AA IV L    AP L+ I+ A+  +R  F+R+   + 
Sbjct: 619 DAPSLKKADTGIAVEGATDAARSAADIVFL----APGLSAIIDALKTSRQIFHRMYSYVV 674

Query: 724 WAVLYNSLMLPVSMGVLI 741
           + +   SL L + +G+ I
Sbjct: 675 YRIAL-SLHLEIFLGLWI 691

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score = 72.4 bits (176), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 83/170 (48%), Gaps = 32/170 (18%)

Query: 578 VLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIP--------- 628
           V  G   ++D  R      +   L  G ++ M+TGD+   A++++  +GIP         
Sbjct: 572 VFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVL 631

Query: 629 ----LN--------------NVFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVALAE 670
               LN              N+F+   PE K +++R LR++ D VA  GDG+ND+ AL  
Sbjct: 632 SGDKLNEMTDDQLANVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKL 691

Query: 671 SDLGISLSG-NSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVK 719
           +D+G+S+    +D+  +A+ +++ D       + IL AI+  +  FN ++
Sbjct: 692 ADIGVSMGRMGTDVAKEASDMILTDDD----FSTILTAIEEGKGIFNNIQ 737

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 74/188 (39%), Gaps = 35/188 (18%)

Query: 203 VWLGSADPPSTFLDTTVMLVAFICVGKLLESXXXXXXXDSLARMVSSAPSMCTIRESGSD 262
           V+LG+ D     +  T+ +V  + VG  ++        ++L ++V   P  C +   G +
Sbjct: 117 VFLGNIDDA---ISITMAIVIVVTVG-FVQEYRSEKSLEALNKLV---PQECHLIRGGRE 169

Query: 263 REVEVELLQAGDVVVMRPGTKLPADGTVLE-GEAEVDESLMTGESTLVPK---------- 311
             V    L  GD+V  R G ++PAD  ++E  +  +DES +TGE+  V K          
Sbjct: 170 SNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALSRDSY 229

Query: 312 --YPGSRVLCGSVNGAAGFLYRADLV------------GEETRLAGIVAAMKQAQLAKAP 357
              P S V        A   Y   LV            G ET    +   M   +  K P
Sbjct: 230 NDQPNSIVPVAERTNIA---YMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTP 286

Query: 358 IQRYADFL 365
           +Q   D L
Sbjct: 287 LQLTMDKL 294

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
           complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 84/172 (48%), Gaps = 32/172 (18%)

Query: 576 NDVLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIP-LN---- 630
           N   +G   + D  R      ++ LL  G +V M+TGD    A++++  +GIP +N    
Sbjct: 576 NLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEIS 635

Query: 631 ----------------------NVFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVAL 668
                                 N+F+   PE K +++R L+++ D VA  GDG+ND+ AL
Sbjct: 636 VLTGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPAL 695

Query: 669 AESDLGISLSG-NSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVK 719
             +D+G+++    +D+  +A+ +V+ D       + IL AI+  +  FN ++
Sbjct: 696 KLADIGVAMGHMGTDVAKEASDMVLTDDD----FSTILTAIEEGKGIFNNIQ 743

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 58/146 (39%), Gaps = 22/146 (15%)

Query: 242 SLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEG-EAEVDES 300
           SL  +    P+ C +   G++  V    L  GD+V  + G ++PAD  ++E  +  +DES
Sbjct: 147 SLEALHKLVPASCHLIRFGAETHVLASCLVPGDLVYFKVGDRIPADVRIIESTDLSLDES 206

Query: 301 LMTGESTLVPK------------YPGSRVLCGSVNGAA--GFLYRAD-------LVGEET 339
            +TGE+  V K             PG  +  G     A  G L R           G+ T
Sbjct: 207 TLTGETEPVHKSCTPVNSATYSDVPGGIIPIGERTSIAYMGTLVREGHGKGIVVATGKHT 266

Query: 340 RLAGIVAAMKQAQLAKAPIQRYADFL 365
               +   M   +  K P+Q   D L
Sbjct: 267 MFGAVFEMMNSIEKPKTPLQMAMDTL 292

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 127/557 (22%), Positives = 221/557 (39%), Gaps = 88/557 (15%)

Query: 250 APSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEGEA--EVDESLMTGEST 307
           A S   IR+ G+  EV    +  GD++ +  G  +PADG ++  +   ++D+S +TGES 
Sbjct: 158 ANSAVVIRD-GNLVEVPSNEVVPGDILQLEDGVVIPADGRLVTEDCFIQIDQSAITGESL 216

Query: 308 LVPKYPGSRVLCGSV--NGAAGFLYRADLVGEETRLAGIVAAMKQAQLAKAPIQRYADFL 365
            V K  G      S    G A  +  A   G+ T +    A + +A         + + L
Sbjct: 217 AVDKRFGDSTFSSSTVKRGEAFMIVTA--TGDSTFVGRAAALVNKAAAGSG---HFTEVL 271

Query: 366 ASWFIPSVLILALLTFVCWMLICTLLATPPSIFNNSNRLYVCSRIAITVIVVACPCPLGL 425
                  ++++ +   + W+          + F  +N++    R  + + +V  P  L  
Sbjct: 272 NGIGTILLILVIVTLLLVWV----------ASFYRTNKIVRILRYTLAITIVGVPVGLPA 321

Query: 426 AAPTAIMVGTGLGAERGLLFKGGDVIETAAAVQAILFDXXXXXXXXXXXVHN-FTSESKA 484
              T + VG    A++  + +    IE+ A V+ +  D           +H  +T E   
Sbjct: 322 VVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVE--G 379

Query: 485 LTPDQWALVC--AAER---------------LSEHPIARAIVTYAE--PYASPEAVARIV 525
           + PD   L    AA R               L  +P A+A +T  +   +   + V++ V
Sbjct: 380 VDPDDLMLTACLAASRKKKGLDAIDKAFLKSLISYPRAKAALTKYKLLEFHPFDPVSKKV 439

Query: 526 VLNHEVLVGLGVRCV-------LQLDGVEHRITIGSARLLPERPSKFSGSTASFVAV--- 575
               E   G  + CV       L+    EH I          + ++ +      + V   
Sbjct: 440 TAIVESPEGERIICVKGAPLFVLKTVEEEHPIPEDVRENYENKVAELASRGFRALGVARK 499

Query: 576 ----NDVLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLN- 630
               +  +LG     D  R+D  + V      G  V M+TGD    A      LG+  N 
Sbjct: 500 RGEGHWEILGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNI 559

Query: 631 --------------------------NVFSERLPEGKCDVLRQLRQKYDYVAFIGDGIND 664
                                     + F+E  P+ K +V+  L+Q+   VA  GDG+ND
Sbjct: 560 YNAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVND 619

Query: 665 SVALAESDLGISLSGNSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVKLNIFW 724
           + +L ++D GI++ G +D    AA IV L    AP L+ I+ A+  +R  F+R+   + +
Sbjct: 620 APSLKKADTGIAVEGATDAARSAADIVFL----APGLSAIIDALKTSRQIFHRMYSYVVY 675

Query: 725 AVLYNSLMLPVSMGVLI 741
            +   SL L + +G+ I
Sbjct: 676 RIAL-SLHLEIFLGLWI 691

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 81/167 (48%), Gaps = 32/167 (19%)

Query: 581 GRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIP-LN--------- 630
           G   ++D  R      ++ LL    +V M+TGD    A+ ++  +GIP +N         
Sbjct: 562 GLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIPVINPEYSVLSGD 621

Query: 631 -----------------NVFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVALAESDL 673
                            NVF+   PE K +++R L+++ D VA  GDG+ND+ AL  +D+
Sbjct: 622 KLDQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADI 681

Query: 674 GISLSG-NSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVK 719
           G+S+    +D+  +A+ +V+ D       + IL AI+  +  FN ++
Sbjct: 682 GVSMGKMGTDVAKEASDMVLTDDD----FSTILTAIEEGKGIFNNIQ 724

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 58/148 (39%), Gaps = 22/148 (14%)

Query: 242 SLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEG-EAEVDES 300
           SL  +    P+ C +  SG    V    L  GD+V  + G ++PAD  ++E  +  VDES
Sbjct: 136 SLEALNKLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESIDLCVDES 195

Query: 301 LMTGESTLVPK------------YPGSRVLCGSVN--GAAGFLYRAD-------LVGEET 339
            +TGE+  V K             PGS +  G  N  G  G L R           G+ T
Sbjct: 196 NLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIVIATGKHT 255

Query: 340 RLAGIVAAMKQAQLAKAPIQRYADFLAS 367
               +   M      K P+Q   D L  
Sbjct: 256 VFGSVFEMMSGIDKPKTPLQTAMDKLGQ 283

>Scas_688.1
          Length = 913

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 123/555 (22%), Positives = 215/555 (38%), Gaps = 84/555 (15%)

Query: 250 APSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEGE--AEVDESLMTGEST 307
           A S   IR+ G   EV    +  GD++ +  G  +PADG ++  +   ++D+S +TGES 
Sbjct: 172 ANSAIVIRD-GQLVEVPANEVVPGDILQLEDGVIIPADGRIVTEDCFVQIDQSAITGESL 230

Query: 308 LVPKYPGSRVLCGSV--NGAAGFLYRADLVGEETRLAGIVAAMKQAQLAKAPIQRYADFL 365
              K+ G +    S    G A  +  A   G+ T +    A + +A   +     + + L
Sbjct: 231 AADKHYGDQTFSSSTVKRGEAFMVITA--TGDNTFVGRAAALVNKASGGQG---HFTEVL 285

Query: 366 ASWFIPSVLILALLTFVCWMLICTLLATPPSIFNNSNRLYVCSRIAITVIVVACPCPLGL 425
               I  ++++ +   + W           + F  ++ +    R  + + +V  P  L  
Sbjct: 286 NGIGIILLVLVIVTLLLVWT----------ASFYRTDGIVRILRYTLGITIVGVPVGLPA 335

Query: 426 AAPTAIMVGTGLGAERGLLFKGGDVIETAAAVQAILFDXXXXXXXXXXXVHN-FTSESKA 484
              T + VG    A++  + +    IE+ A V+ +  D           +H  +T E  +
Sbjct: 336 VVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVS 395

Query: 485 LTPDQWALVCAAERLSE--HPIARAIVTYAEPY-ASPEAVARIVVLNHEVL--VGLGVRC 539
                     AA R  +    I +A +     Y A+  A+ +  VL       V   V  
Sbjct: 396 ADDLMLTACLAASRKKKGLDAIDKAFLKSLAQYPAAKNALTKYKVLEFHPFDPVSKKVTA 455

Query: 540 VLQLDGVEHRITIGSARL-----------LPERPSKFSGSTASFVAVNDV---------- 578
           V++    E  I +  A L           +PE   +   +  + +A              
Sbjct: 456 VVESPEGERIICVKGAPLFVLKTVEEDHPIPEDIHENYENKVAELASRGFRALGVARKRG 515

Query: 579 -----LLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLN--- 630
                +LG     D  R+D  E V      G  V M+TGD    A      LG+  N   
Sbjct: 516 EGHWEILGVMPCMDPPRDDTGETVAEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNVYN 575

Query: 631 ------------------------NVFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSV 666
                                   + F+E  P+ K  V+  L+ +   VA  GDG+ND+ 
Sbjct: 576 AERLGLSGGGDMPGSELADFVENADGFAEVFPQDKYRVVEILQTRGYLVAMTGDGVNDAP 635

Query: 667 ALAESDLGISLSGNSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVKLNIFWAV 726
           +L ++D GI++ G +D    AA IV L    AP L+ I+ A+  +R  F+R+   + + +
Sbjct: 636 SLKKADTGIAVEGATDAARSAADIVFL----APGLSAIIDALKTSRQIFHRMYSYVVYRI 691

Query: 727 LYNSLMLPVSMGVLI 741
              S+ L + +G+ I
Sbjct: 692 AL-SIHLEIFLGLWI 705

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 66.2 bits (160), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 81/167 (48%), Gaps = 32/167 (19%)

Query: 581 GRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLN---------- 630
           G F L+D  R +    ++ L   G ++ M+TGD+   A+ ++  +G+ +           
Sbjct: 570 GLFGLADPPRPNVKASIEKLHRGGVHIIMITGDSVNTAVSIAEKIGLSVQDRESSVMTGD 629

Query: 631 -----------------NVFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVALAESDL 673
                            N+F+   PE K ++++ LR++ D VA  GDG+ND+ AL  +D+
Sbjct: 630 KVSELTEDELSKVIDKVNIFARATPENKLNIVKALRKRGDIVAMTGDGVNDAPALKLADI 689

Query: 674 GISLS-GNSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVK 719
           GI++    +D+  + + +++ D       + IL AI+  +  FN ++
Sbjct: 690 GIAMGISGTDVAKEVSDMILTDDD----FSSILTAIEEGKGIFNNIR 732

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 242 SLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEG-EAEVDES 300
           SL  +    P+ C +   G +       L  GD+V  + G ++PAD  ++E  +  +DES
Sbjct: 151 SLEALNKLVPTKCHLIRYGRESNTLASELVPGDLVRFKIGDRIPADVRIIEAVDLSIDES 210

Query: 301 LMTGES 306
            +TGE+
Sbjct: 211 NLTGET 216

>Kwal_14.1498
          Length = 939

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 79/167 (47%), Gaps = 32/167 (19%)

Query: 581 GRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPL----------- 629
           G   ++D  R      V+ L     ++ M+TGD    A+ ++  +GIP+           
Sbjct: 563 GLLGMNDPPRPSVKAAVERLSEGSVHIIMITGDAENTAVSIARQIGIPVVNPETAVLTGD 622

Query: 630 ----------------NNVFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVALAESDL 673
                            N+F+   PE K +++R L+++ D VA  GDG+ND+ AL  +D+
Sbjct: 623 KLDHMSEDQLASIIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADI 682

Query: 674 GISLSG-NSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVK 719
           G+S+    +D+  +A+ +V+ D       + IL AI+  +  FN ++
Sbjct: 683 GVSMGKMGTDVAKEASDMVLTDDD----FSTILTAIEEGKGIFNNIQ 725

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 59/268 (22%), Positives = 111/268 (41%), Gaps = 39/268 (14%)

Query: 218 TVMLVAFICVGKLLESXXXXXXXDSLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVV 277
           T+ +V  + VG  ++        ++L R+V   P  C +   G + ++   +L  GDVV 
Sbjct: 116 TLAIVIVVTVG-FVQEYRSEKSLEALNRLV---PDQCHLIRCGQESKLLASVLVPGDVVR 171

Query: 278 MRPGTKLPADGTVLEG-EAEVDESLMTGESTLVPKYPGS------RVLCGS---VNGAAG 327
            R G ++PAD  ++E  +  ++ES +TGE+  V K   +      +   GS   V+  + 
Sbjct: 172 FRVGDRIPADLRIIEAVDLSIEESNLTGENEPVHKSTATVNKEFYKENLGSIVPVSERSC 231

Query: 328 FLYRADLVGE------------ETRLAGIVAAMKQAQLAKAPIQRYADFLASWFIPSVLI 375
             +   LV E             T    +   M   +  K P+Q   D L          
Sbjct: 232 IAFMGTLVREGHGRGIVIGTAKNTAFGKVFEMMNAIEKPKTPLQTAMDKLGKD------- 284

Query: 376 LALLTFVCWMLICTLLATPPSIFNNSNRLYVCSRIAITVIVVACPCPLGLAAPTAIMVGT 435
           L+ ++F+   +IC +      +    + L +  +I++++ V A P  L +     + +G 
Sbjct: 285 LSFMSFIVIGIICLI-----GVIQGRSWLEMF-QISVSLAVAAIPEGLPIIVTVTLALGV 338

Query: 436 GLGAERGLLFKGGDVIETAAAVQAILFD 463
              A+R  + +    +ET  +V  I  D
Sbjct: 339 LRMAKRRAIIRRLPSVETLGSVNVICSD 366

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 127/577 (22%), Positives = 215/577 (37%), Gaps = 83/577 (14%)

Query: 226 CVGKLLESXXXXXXXDSLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLP 285
           CVG  ++        D L + +++   +  +   G   EV    +  GD++ +  GT +P
Sbjct: 140 CVG-FIQEFQAGSIVDELKKTLAN---VAVVIRDGQLVEVPANEVVPGDILQLEDGTIIP 195

Query: 286 ADGTVLEGEA--EVDESLMTGESTLVPKYPGSRVLCGSVNGAAGFLYRADLVGEETRLAG 343
           ADG ++      +VD+S +TGES  V K  G +    S              G+ T +  
Sbjct: 196 ADGRLVTENCFLQVDQSAITGESLAVDKGYGDQTFSSSTVKRGEAFMVVTATGDNTFVGR 255

Query: 344 IVAAMKQAQLAKAPIQRYADFLASWFIPSVLILALLTFVCWMLICTLLATPPSIFNNSNR 403
             A + +A   +     + + L    I  ++++ +     W           + F  ++ 
Sbjct: 256 AAALVNKASGGQG---HFTEVLNGIGILLLVLVIVTLLGVW----------AACFYRTDN 302

Query: 404 LYVCSRIAITVIVVACPCPLGLAAPTAIMVGTGLGAERGLLFKGGDVIETAAAVQAILFD 463
           +    R  + + ++  P  L     T + VG    A++  + +    IE+ A V+ +  D
Sbjct: 303 IVKILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSD 362

Query: 464 XXXXXXXXXXXVHN-FTSESKALTPDQWALVCAAER---------------LSEHPIAR- 506
                      +H  +T E  +          AA R               L  +P A+ 
Sbjct: 363 KTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAASRKKKGLDAIDKAFLKSLINYPKAKD 422

Query: 507 AIVTYAEPYASP-EAVARIVVLNHEVLVGLGVRCV-----LQLDGVE---------HRIT 551
           A+  Y      P + V++ V    E   G  + CV       L  VE         H   
Sbjct: 423 ALTKYKVIEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVEEDHPIPEDVHENY 482

Query: 552 IGSARLLPERPSKFSGSTASFVAVNDVLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVT 611
                 L  R  +  G        +  +LG     D  R+D  E V      G  V M+T
Sbjct: 483 ENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAETVNEARRLGLRVKMLT 542

Query: 612 GDNHEAAMHVSHALGIPLN---------------------------NVFSERLPEGKCDV 644
           GD    A      LG+  N                           + F+E  P+ K  V
Sbjct: 543 GDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYKV 602

Query: 645 LRQLRQKYDYVAFIGDGINDSVALAESDLGISLSGNSDIVADAAGIVVLDHSSAPPLTRI 704
           +  L+ +   VA  GDG+ND+ +L ++D GI++ G SD    AA IV L    AP L+ I
Sbjct: 603 VEILQNRGYLVAMTGDGVNDAPSLKKADTGIAVEGASDAARSAADIVFL----APGLSAI 658

Query: 705 LYAIDLARATFNRVKLNIFWAVLYNSLMLPVSMGVLI 741
           + A+  +R  F+R+   + + +   SL L + +G+ I
Sbjct: 659 IDALKTSRQIFHRMYSYVVYRIAL-SLHLELFLGLWI 694

>Scas_710.41
          Length = 904

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 84/190 (44%), Gaps = 32/190 (16%)

Query: 579 LLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLN-------- 630
           +LG     D  R+D    +    + G  V M+TGD    A   S  LG+ +N        
Sbjct: 513 ILGVMPCMDPPRDDTARTIAEARTLGLRVKMLTGDAVGIAKETSRQLGLGVNIYNAEKLG 572

Query: 631 -------------------NVFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVALAES 671
                              + F+E  P+ K  V+  L+ +   VA  GDG+ND+ +L ++
Sbjct: 573 LGGGGDMPGSELADFVENADGFAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKA 632

Query: 672 DLGISLSGNSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVKLNIFWAVLYNSL 731
           D GI++ G +D    AA IV L    AP L+ I+  +  +R  F+R+   + + +   SL
Sbjct: 633 DTGIAVEGATDAARSAADIVFL----APGLSAIIDGLKTSRQIFHRMYSYVVYRIAL-SL 687

Query: 732 MLPVSMGVLI 741
            L +  G+ I
Sbjct: 688 HLEIFFGLWI 697

 Score = 36.6 bits (83), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 44/223 (19%), Positives = 89/223 (39%), Gaps = 16/223 (7%)

Query: 256 IRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEGEA--EVDESLMTGESTLVPKYP 313
           IR+ G+ +E+    +  GD++ +  GT +PADG ++      +VD+S +TGES  V K  
Sbjct: 170 IRD-GTLQEIPANEIVPGDILELDEGTIIPADGRLVTENRFLQVDQSAITGESLAVDKNY 228

Query: 314 GSRVLCGSVNGAAGFLYRADLVGEETRLAGIVAAMKQAQLAKAPIQRYADFLASWFIPSV 373
           G      S       +      G+ T +    A + +A   +     + D L       +
Sbjct: 229 GDVTFSSSTVKTGTSVMVVTATGDNTFVGRAAALVGEASGGQG---HFTDILNDIGTILL 285

Query: 374 LILALLTFVCWMLICTLLATPPSIFNNSNRLYVCSRIAITVIVVACPCPLGLAAPTAIMV 433
           +++ +   + W           + F  ++ + +  R  + + ++  P  L     T + V
Sbjct: 286 VLVIITLLLVWT----------ACFYRTDGIVMILRFTLGITIIGVPVGLPAVVTTTMAV 335

Query: 434 GTGLGAERGLLFKGGDVIETAAAVQAILFDXXXXXXXXXXXVH 476
           G    A++  + +    IE+ A V+ +  D           +H
Sbjct: 336 GAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLH 378

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 103/251 (41%), Gaps = 55/251 (21%)

Query: 511 YAEPYASPEAVAR----IVVLNHEVLVGLGVRCVLQLDGV--EHRITIGSARLLPERPSK 564
           Y  P  SP+ +       V  N + L   G+R +        E + TI   +LL ER   
Sbjct: 565 YTTPDGSPQPLTEEDLETVQKNVDTLSSEGLRVLAFAKKTFNESQFTINKDKLLKER--- 621

Query: 565 FSGSTASFVAVNDVLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHA 624
                  FV  N   LG   + D  R ++   V+     G  V M+TGD    A  ++  
Sbjct: 622 ------DFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHMLTGDFPGTAKSIAQE 675

Query: 625 LGIPLNNVF--------------------SER---------------LPEGKCDVLRQLR 649
           +GI  +N++                    S++                P+ K  ++  L 
Sbjct: 676 VGILPHNLYHYPKEVVNFMVMTATDFDALSDKEIDELPVLPLVIARCAPQTKVRMIEALH 735

Query: 650 QKYDYVAFIGDGINDSVALAESDLGISLSGN-SDIVADAAGIVVLDHSSAPPLTRILYAI 708
           ++  + A  GDG+NDS +L  +++GI++  N SD+  DA+ IV+ D + A     IL A+
Sbjct: 736 RRNRFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFA----SILNAV 791

Query: 709 DLARATFNRVK 719
           +  R   + ++
Sbjct: 792 EEGRRMSDNIQ 802

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 39/67 (58%), Gaps = 2/67 (2%)

Query: 249 SAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEG-EAEVDESLMTGEST 307
           S PS   IR +G+D  +E + L  GD+ ++R G  +PAD  + E    E DE+L+TGES 
Sbjct: 128 STPSAHVIR-AGNDLTIESKELVPGDICIIRVGDTVPADLRLFEAINLETDEALLTGESL 186

Query: 308 LVPKYPG 314
            V K  G
Sbjct: 187 PVAKSHG 193

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 90/222 (40%), Gaps = 49/222 (22%)

Query: 534 GLGVRCVLQLDGVEHRITIGSARLLPERPSKFSGSTASFVAVNDVLLGRFDLSDSLREDA 593
           GL V    +    E        +LL ER          FV      LG   + D  R+++
Sbjct: 594 GLRVLAFAKKSFNESEFNANKDKLLKER---------DFVECKLTFLGLIGIYDPPRQES 644

Query: 594 YEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLNNVF-------------------- 633
              V+     G  V M+TGD    A  ++  +GI  +N++                    
Sbjct: 645 LAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDAL 704

Query: 634 SER---------------LPEGKCDVLRQLRQKYDYVAFIGDGINDSVALAESDLGISLS 678
           S++                P+ K  ++  L ++  + A  GDG+NDS +L  +++GI++ 
Sbjct: 705 SDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMG 764

Query: 679 GN-SDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVK 719
            N SD+  DA+ IV+ D + A     IL A++  R   + ++
Sbjct: 765 INGSDVAKDASDIVLSDDNFA----SILNAVEEGRRMSDNIQ 802

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 39/64 (60%), Gaps = 2/64 (3%)

Query: 249 SAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEG-EAEVDESLMTGEST 307
           S PS   IR+ G+D  ++ + L  GD+ +++ G  +PAD  +LE    E DE+L+TGES 
Sbjct: 128 STPSAHVIRD-GNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESL 186

Query: 308 LVPK 311
            V K
Sbjct: 187 PVAK 190

>Scas_297.1
          Length = 800

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 30/42 (71%)

Query: 270 LQAGDVVVMRPGTKLPADGTVLEGEAEVDESLMTGESTLVPK 311
           L  GD++ ++ G  +PADG ++EG+ EVDES +TGES  + K
Sbjct: 616 LLVGDIITLQTGDVIPADGVLVEGQCEVDESSITGESDTIKK 657

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%)

Query: 627 IPLNNVFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVALAESDLGISLSGNSDIVAD 686
           +P   V +   PE K  ++  L+   D VA  GDG ND+ AL  +D+G S+  +   VA 
Sbjct: 46  LPNLRVMARSSPEDKRLLVETLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAR 105

Query: 687 AAGIVVL 693
            A  ++L
Sbjct: 106 EASDIIL 112

>Kwal_23.3160
          Length = 1100

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 80/184 (43%), Gaps = 40/184 (21%)

Query: 572 FVAVNDVLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLNN 631
           FV  + +  G   + D  R++    V+     G  V M+TGD    A  ++  +GI   N
Sbjct: 640 FVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRN 699

Query: 632 VFS----------------ERL-------------------PEGKCDVLRQLRQKYDYVA 656
           ++                 ++L                   P+ K  ++  L ++  + A
Sbjct: 700 LYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCA 759

Query: 657 FIGDGINDSVALAESDLGISLSGN-SDIVADAAGIVVLDHSSAPPLTRILYAIDLARATF 715
             GDG+NDS +L ++++GI++  N SD+  DA+ IV+ D + A     IL A++  R   
Sbjct: 760 MTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFA----SILNAVEEGRRMS 815

Query: 716 NRVK 719
           + ++
Sbjct: 816 DNIQ 819

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 103/253 (40%), Gaps = 47/253 (18%)

Query: 249 SAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEG-EAEVDESLMTGEST 307
           S PS   IR+ G+D  +  + L  GD+ V++ G  +PAD  ++E    E DE+L+TGES 
Sbjct: 132 STPSAHVIRD-GNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESL 190

Query: 308 LVPK-----YP-------GSRVLCG------SVNGAAGFLYRADLVGEETRLAGIVAAMK 349
            + K     YP       G R+         S   A G + +    G  T +  I  ++K
Sbjct: 191 PIAKEASQVYPATEDTPVGDRLNLAFASSTVSKGRATGIVVK---TGLNTEIGKIAQSLK 247

Query: 350 --QAQLAKAPIQRY---ADFLASWFIPSVL--------------ILALLTFVCWMLICTL 390
              + ++K   + +   A    +  I S L              +  LL F+  +    +
Sbjct: 248 GDNSLISKDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKLAVLLFFIAVVFAIVV 307

Query: 391 LATPPSIFNNSNRLYVCSRIAITVIVVACPCPLGLAAPTAIMVGTGLGAERGLLFKGGDV 450
           +AT   + N    +Y     AI V V   P  L +     + VG  + A R ++ +  D 
Sbjct: 308 MATQKFVVNKEVAIY-----AICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDS 362

Query: 451 IETAAAVQAILFD 463
           +E   AV  +  D
Sbjct: 363 LEALGAVNDVCSD 375

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
           (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 49/83 (59%), Gaps = 5/83 (6%)

Query: 638 PEGKCDVLRQLRQKYDYVAFIGDGINDSVALAESDLGISLSGN-SDIVADAAGIVVLDHS 696
           P+ K  ++  L ++  + A  GDG+NDS +L ++++GI++  N SD+  DA+ IV+ D +
Sbjct: 730 PQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDN 789

Query: 697 SAPPLTRILYAIDLARATFNRVK 719
            A     IL A++  R   + ++
Sbjct: 790 FAS----ILNAVEEGRRMSDNIQ 808

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 38/68 (55%), Gaps = 2/68 (2%)

Query: 249 SAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEG-EAEVDESLMTGEST 307
           S PS   IR +G D  +    +  GD+V +R G  +PAD  ++E    E DE+L+TGE+ 
Sbjct: 130 STPSARVIR-NGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEAL 188

Query: 308 LVPKYPGS 315
            V K P +
Sbjct: 189 PVAKDPAA 196

>CAGL0K12034g complement(1161299..1164562) highly similar to
           sp|P13587 Saccharomyces cerevisiae YDR040c ENA1 or
           sp|Q01896 Saccharomyces cerevisiae YDR039c ENA2 or
           sp|Q12691 Saccharomyces cerevisiae YDR038c ENA5,
           hypothetical start
          Length = 1087

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 84/200 (42%), Gaps = 49/200 (24%)

Query: 556 RLLPERPSKFSGSTASFVAVNDVLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNH 615
           ++L ER    +G T          LG   + D  RE+    V+     G  V M+TGD  
Sbjct: 622 KILKERDYAETGLT---------FLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFP 672

Query: 616 EAAMHVSHALGI-PLN--------------------NVFSERL--------------PEG 640
             A  ++  +GI P N                    N+  + +              P+ 
Sbjct: 673 GTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPVLPLVIARCSPQT 732

Query: 641 KCDVLRQLRQKYDYVAFIGDGINDSVALAESDLGISLSGN-SDIVADAAGIVVLDHSSAP 699
           K  ++  L ++  + A  GDG+NDS +L  +++GI++  N SD+  DA+ IV+ D + A 
Sbjct: 733 KVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDNFA- 791

Query: 700 PLTRILYAIDLARATFNRVK 719
               IL A++  R   + ++
Sbjct: 792 ---SILNAVEEGRRMSDNIQ 808

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 249 SAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPAD-GTVLEGEAEVDESLMTGEST 307
           S+P+   IR +G+   V+   +  GD+VV++ G  +PAD   V +   E DE+L+TGES 
Sbjct: 122 SSPNAHVIR-NGNSEVVDSTDVVPGDLVVVKVGDTIPADLRLVSQQNFETDEALLTGESL 180

Query: 308 LVPK 311
            V K
Sbjct: 181 PVSK 184

>Scas_569.0d
          Length = 468

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 48/83 (57%), Gaps = 5/83 (6%)

Query: 638 PEGKCDVLRQLRQKYDYVAFIGDGINDSVALAESDLGISLSGN-SDIVADAAGIVVLDHS 696
           P+ K  ++  L ++  + A  GDG+NDS +L  +++GI++  N SD+  DA+ IV+ D +
Sbjct: 110 PQTKVRMIEALHRRDKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDN 169

Query: 697 SAPPLTRILYAIDLARATFNRVK 719
            A     IL AI+  R   + ++
Sbjct: 170 FAS----ILNAIEEGRRMSDNIQ 188

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 70/177 (39%), Gaps = 37/177 (20%)

Query: 585 LSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGI----------------- 627
           + D LRE+    V      G  V MVTGDN   A  ++   GI                 
Sbjct: 691 IQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGILSSKSLNDSACAMEGPA 750

Query: 628 -------------PLNNVFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVALAESDLG 674
                        P   V +   PE K  ++R L++  + VA  GDG ND+ AL  +D+G
Sbjct: 751 FRKLSDSERKRILPKLRVLARSSPEDKKILVRALKEMGEVVAVTGDGTNDAPALKLADVG 810

Query: 675 ISLSGNSDIVADAAGIVVL--DHSSAPPLTRILYAIDLARATFNRVKLNIFWAVLYN 729
            S+      VA  A  ++L  D  SA     I+ AI   R     +K  I + ++ N
Sbjct: 811 FSMGITGTEVAREASDIILMTDDFSA-----IVNAIKWGRCVAASIKKFIQFQLIVN 862

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 30/49 (61%)

Query: 265 VEVELLQAGDVVVMRPGTKLPADGTVLEGEAEVDESLMTGESTLVPKYP 313
           + +  L  GD++ ++ G  +PAD  ++ GE E DES +TGES  + K P
Sbjct: 170 ISIHNLLVGDLLKLQTGDVVPADCVLVRGECETDESALTGESNTIKKLP 218

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 261 SDREVEVELLQA--GDVVVMRPGTKLPADGTVLEGEAEVDESLMTGESTLVPKYP 313
           +D+E+ + +     GDV+ ++ G  +PAD  ++ G+ E DES +TGES  + K+P
Sbjct: 199 NDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESNTIQKFP 253

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 73/183 (39%), Gaps = 35/183 (19%)

Query: 578 VLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLNNVFSERL 637
           +L G   + D LR    E VQ     G  V MVTGDN   A  ++    I   ++ SE  
Sbjct: 729 ILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTDISSEAY 788

Query: 638 ------------------------------PEGKCDVLRQLRQKYDYVAFIGDGINDSVA 667
                                         PE K  ++  L+   D VA  GDG ND+ A
Sbjct: 789 SAMEGTEFRKLTKNERIRILPNLRVLARSSPEDKRLLVETLKGMGDVVAVTGDGTNDAPA 848

Query: 668 LAESDLGISLS-GNSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVKLNIFWAV 726
           L  +D+G S+    +++  +A+ I+++        + I+ AI   R     +K  I + +
Sbjct: 849 LKLADVGFSMGISGTEVAREASDIILM----TDDFSAIVNAIKWGRCVSVSIKKFIQFQL 904

Query: 727 LYN 729
           + N
Sbjct: 905 IVN 907

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
           Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 1280

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 83/216 (38%), Gaps = 52/216 (24%)

Query: 562 PSKFSGSTASFVAVNDVLLGR-----------------FDLSDSLREDAYEVVQALLSRG 604
           P +F+ ST   +A  D+++G                    L D LRE   E V+     G
Sbjct: 720 PKEFADSTDPSIASPDLVMGHELDHKNLSSEGMTLDAMVGLQDPLREGVKESVEQCQRAG 779

Query: 605 HYVGMVTGDNHEAAMHVSHALGI------------------------------PLNNVFS 634
             V MVTGDN   A  +S    I                              P   V +
Sbjct: 780 VTVRMVTGDNILTARAISRNCNILSEEGYNDPECAMEGPTFRKLPYKKMLRVIPKLRVLA 839

Query: 635 ERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVALAESDLGISLS-GNSDIVADAAGIVVL 693
              PE K  ++  L++  + VA  GDG ND+ AL  +D+G S+    +++  +A+ I+++
Sbjct: 840 RSSPEDKRILVETLKKMGEVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILM 899

Query: 694 DHSSAPPLTRILYAIDLARATFNRVKLNIFWAVLYN 729
                   T I+ AI   R     +K  I + +  N
Sbjct: 900 ----TDDFTAIVNAIKWGRCVSVSIKKFIQFQLTVN 931

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%)

Query: 259 SGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEGEAEVDESLMTGESTLVPK 311
           +G +  + +  L  GDV+ ++ G  +PAD  ++ G  E DES +TGES  + K
Sbjct: 246 NGDEHLISIHDLLVGDVISLQTGDVVPADAVLISGSCECDESALTGESDTIKK 298

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 76/200 (38%), Gaps = 38/200 (19%)

Query: 560 ERPSKFSGSTASFVAVNDVLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAM 619
           +RPS  + + +  +     L G   + D LR    E V+     G  V M+TGDN     
Sbjct: 692 DRPSIITNNNSGLI-----LDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTGR 746

Query: 620 HVSHALGI------------------------------PLNNVFSERLPEGKCDVLRQLR 649
            ++ A GI                              P   V +   PE K   +  L+
Sbjct: 747 AIARACGILSESEYADHECAMEGPVFRKLSRRQMMDAAPKLKVLARSSPEDKRIFVDILK 806

Query: 650 QKYDYVAFIGDGINDSVALAESDLGISLSGNSDIVADAAGIVVLDHSSAPPLTRILYAID 709
           +  + VA  GDG ND+ AL  +D+G S+  +   VA  A  ++L        T I+ AI 
Sbjct: 807 KMNEVVAVTGDGTNDAPALTLADVGFSMGISGTGVAREASDIIL---MTDDFTSIVNAIK 863

Query: 710 LARATFNRVKLNIFWAVLYN 729
             R     +K  I + +  N
Sbjct: 864 WGRCVSLSIKKFIQFQLTVN 883

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%)

Query: 259 SGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEGEAEVDESLMTGESTLVPK 311
           +G    + V  L  GD++ ++ G  +P D  ++EG+ E DES +TGES  + K
Sbjct: 190 NGDKHVISVHDLLVGDLLSLQTGDVVPVDCILVEGKCECDESGITGESDTIKK 242

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 76/178 (42%), Gaps = 40/178 (22%)

Query: 578 VLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLNNVF--SE 635
           V LG   + D  R +    V+     G  V M+TGD    A  ++  +GI   N++  S+
Sbjct: 640 VFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQ 699

Query: 636 RL---------------------------------PEGKCDVLRQLRQKYDYVAFIGDGI 662
            +                                 P+ K  ++  L ++  + A  GDG+
Sbjct: 700 EIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGV 759

Query: 663 NDSVALAESDLGISLSGN-SDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVK 719
           NDS +L  +++GI++  N SD+  +A+ IV+ D + A     IL A++  R   + ++
Sbjct: 760 NDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFAS----ILNAVEEGRRMTDNIQ 813

 Score = 37.0 bits (84), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 45/83 (54%), Gaps = 4/83 (4%)

Query: 230 LLESXXXXXXXDSLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGT 289
           L++        +SL  +  S+P+   IR +G    +  + +  GD+ +++ G  +PAD  
Sbjct: 109 LVQEYKATKTMNSLKNL--SSPNAHVIR-NGKSETINSKDVVPGDICLVKVGDTIPADLR 165

Query: 290 VLEGEA-EVDESLMTGESTLVPK 311
           ++E +  + DESL+TGES  V K
Sbjct: 166 LIETKNFDTDESLLTGESLPVSK 188

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 76/178 (42%), Gaps = 40/178 (22%)

Query: 578 VLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLNNVF--SE 635
           V LG   + D  R +    V+     G  V M+TGD    A  ++  +GI   N++  S+
Sbjct: 640 VFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQ 699

Query: 636 RL---------------------------------PEGKCDVLRQLRQKYDYVAFIGDGI 662
            +                                 P+ K  ++  L ++  + A  GDG+
Sbjct: 700 EIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGV 759

Query: 663 NDSVALAESDLGISLSGN-SDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVK 719
           NDS +L  +++GI++  N SD+  +A+ IV+ D + A     IL A++  R   + ++
Sbjct: 760 NDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFAS----ILNAVEEGRRMTDNIQ 813

 Score = 37.0 bits (84), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 45/83 (54%), Gaps = 4/83 (4%)

Query: 230 LLESXXXXXXXDSLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGT 289
           L++        +SL  +  S+P+   IR +G    +  + +  GD+ +++ G  +PAD  
Sbjct: 109 LVQEYKATKTMNSLKNL--SSPNAHVIR-NGKSETINSKDVVPGDICLVKVGDTIPADLR 165

Query: 290 VLEGEA-EVDESLMTGESTLVPK 311
           ++E +  + DESL+TGES  V K
Sbjct: 166 LIETKNFDTDESLLTGESLPVSK 188

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 33/49 (67%), Gaps = 2/49 (4%)

Query: 631  NVFSERLPEGKCDVLRQLRQKYDY-VAFIGDGINDSVALAESDLGISLS 678
            ++F+   P+ K +++ QL QK DY V F GDG ND  AL  +D+GISLS
Sbjct: 1138 SIFARMSPDEKHELVEQL-QKMDYTVGFCGDGANDCGALKAADVGISLS 1185

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 284 LPADGTVLEGEAEVDESLMTGESTLVPKYPGSR 316
           LP D  +L G+  V+ES++TGES  V KYP S 
Sbjct: 573 LPCDSILLSGDCIVNESMLTGESVPVSKYPASE 605

>Kwal_47.17547
          Length = 1240

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 75/184 (40%), Gaps = 37/184 (20%)

Query: 578 VLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGI---------- 627
           VL G   + D LR+   + V+     G  V MVTGDN   A  ++    I          
Sbjct: 716 VLDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCSILSEEQAENPE 775

Query: 628 --------------------PLNNVFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVA 667
                               P   V +   PE K  ++  L++  D VA  GDG ND+ A
Sbjct: 776 SSMEGPRFRKLSNKERVRILPNLRVLARSSPEDKRILVETLKKMGDVVAVTGDGTNDAPA 835

Query: 668 LAESDLGISLS-GNSDIVADAAGIVVL-DHSSAPPLTRILYAIDLARATFNRVKLNIFWA 725
           L  +D+G S+    +++  +A+ I+++ D  SA     I+ AI   R     +K  I + 
Sbjct: 836 LKLADVGFSMGIAGTEVAREASDIILMTDDFSA-----IVNAIKWGRCVSTSIKKFIQFQ 890

Query: 726 VLYN 729
           +  N
Sbjct: 891 LTVN 894

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 95/239 (39%), Gaps = 34/239 (14%)

Query: 259 SGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEGEAEVDESLMTGESTLVPK------Y 312
           +G +  + +  +  GD++ ++ G  +PAD  +++G  E DES +TGES  + K      Y
Sbjct: 193 NGDEHLISIHDILVGDILSLQTGDVVPADCILVKGSCECDESALTGESATIKKAAIDVCY 252

Query: 313 PGSRVLCGSVN----GAAGFLYRAD--LVGEETRLAGI---------VAAMK-------Q 350
              + L  +      G  G     D  L+     L+G+         V +M        +
Sbjct: 253 EKYKQLSATDAAIDIGTPGAEKVPDPMLISGSKLLSGLGRAVVTSVGVNSMHGRTLMALK 312

Query: 351 AQLAKAPIQRYADFLA-SWFIPSVLILALLTFVCWMLICTLLATPPSIFN-----NSNRL 404
            +    P+Q   D LA S  +       LL F+ +M     L     + +       +R 
Sbjct: 313 VEAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLKKGGELHDLTPAQKGSRF 372

Query: 405 YVCSRIAITVIVVACPCPLGLAAPTAIMVGTGLGAERGLLFKGGDVIETAAAVQAILFD 463
                + ITVIVVA P  L LA   A+   T   A+ G L +     ET  +  A+  D
Sbjct: 373 MNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNLVRVLRACETMGSATAVCSD 431

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
           involved in Na+ and Li+ efflux, required for Na+
           tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 75/178 (42%), Gaps = 40/178 (22%)

Query: 578 VLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLNNVF--SE 635
           V LG   + D  R +    V+     G  V M+TGD    A  ++  +GI   N++  S+
Sbjct: 640 VFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQ 699

Query: 636 RL---------------------------------PEGKCDVLRQLRQKYDYVAFIGDGI 662
            +                                 P+ K  ++  L ++  +    GDG+
Sbjct: 700 EIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGV 759

Query: 663 NDSVALAESDLGISLSGN-SDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVK 719
           NDS +L  +++GI++  N SD+  +A+ IV+ D + A     IL A++  R   + ++
Sbjct: 760 NDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFAS----ILNAVEEGRRMTDNIQ 813

 Score = 37.0 bits (84), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 45/83 (54%), Gaps = 4/83 (4%)

Query: 230 LLESXXXXXXXDSLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGT 289
           L++        +SL  +  S+P+   IR +G    +  + +  GD+ +++ G  +PAD  
Sbjct: 109 LVQEYKATKTMNSLKNL--SSPNAHVIR-NGKSETINSKDVVPGDICLVKVGDTIPADLR 165

Query: 290 VLEGEA-EVDESLMTGESTLVPK 311
           ++E +  + DESL+TGES  V K
Sbjct: 166 LIETKNFDTDESLLTGESLPVSK 188

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 2/50 (4%)

Query: 630  NNVFSERLPEGKCDVLRQLRQKYDY-VAFIGDGINDSVALAESDLGISLS 678
            +++++   P+ K +++ QL QK DY V F GDG ND  AL  +D+GISLS
Sbjct: 1157 SSIYARMSPDEKHELMIQL-QKLDYTVGFCGDGANDCGALKAADVGISLS 1205

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 270 LQAGDVV-VMRPG-TKLPADGTVLEGEAEVDESLMTGESTLVPKYPGSR 316
           L  GD+  V  P  T LP D  +L  +  V+ES++TGES  V K+P + 
Sbjct: 569 LVPGDIYEVSDPNITILPCDSILLSSDCIVNESMLTGESVPVSKFPATE 617

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 33/49 (67%), Gaps = 2/49 (4%)

Query: 631  NVFSERLPEGKCDVLRQLRQKYDY-VAFIGDGINDSVALAESDLGISLS 678
            ++++   P+ K +++ QL QK DY V F GDG ND  AL  +++GISLS
Sbjct: 1125 SIYARMSPDEKHELVEQL-QKLDYNVGFCGDGANDCGALKAANIGISLS 1172

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 284 LPADGTVLEGEAEVDESLMTGESTLVPKY 312
           LP D  ++ G+  V+ES++TGES  V KY
Sbjct: 572 LPCDAVLISGDCIVNESMLTGESVPVSKY 600

>Scas_665.30
          Length = 1439

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 30/47 (63%)

Query: 632 VFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVALAESDLGISLS 678
           +++   P+ K +++ QL++    V F GDG ND  AL  +D+GISLS
Sbjct: 929 IYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLS 975

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 282 TKLPADGTVLEGEAEVDESLMTGESTLVPKYPG 314
           T  P D  +L G+  V+ES++TGES  V K+P 
Sbjct: 359 TVFPCDSLLLSGDCIVNESMLTGESVPVSKFPA 391

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 37.0 bits (84), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%)

Query: 589 LREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGI 627
           L+ DA E +Q L    H   M+TGDN   A+HV+  +GI
Sbjct: 673 LKHDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGI 711

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 37.0 bits (84), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 589 LREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLNNVFSERL 637
           L++DA E ++ L    H   M+TGDN   A+HV+  +GI    VF E L
Sbjct: 675 LKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGI----VFGETL 719

>Kwal_26.9207
          Length = 1469

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 630  NNVFSERLPEGKCDVLRQLRQKYDYV-AFIGDGINDSVALAESDLGISLS 678
            +++++   P+ K +++ QL Q  DYV  F GDG ND  AL  +D+G+SLS
Sbjct: 1154 SSIYARMSPDEKHELVGQL-QGLDYVVGFCGDGANDCGALKAADVGVSLS 1202

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 37/75 (49%), Gaps = 4/75 (5%)

Query: 245 RMVSSAPSMCTIR--ESGSDREVEVELLQAGDVV-VMRPG-TKLPADGTVLEGEAEVDES 300
           R+   + S C +R    G   +V    L  GDV  +  P  +  P D  +L G+  V+ES
Sbjct: 548 RLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCIVNES 607

Query: 301 LMTGESTLVPKYPGS 315
           ++TGES  V K P S
Sbjct: 608 MLTGESVPVSKIPAS 622

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%)

Query: 589 LREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGI 627
           L++DA E ++ L    H   M+TGDN   A+HV+  +GI
Sbjct: 673 LKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGI 711

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 30/48 (62%)

Query: 631  NVFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVALAESDLGISLS 678
            ++++   P+ K +++ +L+     V F GDG ND  AL  +D+GISLS
Sbjct: 1135 SIYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLS 1182

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 59/130 (45%), Gaps = 16/130 (12%)

Query: 192 YLFSVATICRGVWLGSADPPSTFLDTTVMLVAFICV-GKLLESXXXXXXXDSLARMVSSA 250
           Y+F + +I   +W+  A     +  T + +++ + V   L+E+         L++     
Sbjct: 487 YIFQIFSII--LWMFDA---YYYYATCIFIISVLSVIDTLVETKQSSERLSELSQF---- 537

Query: 251 PSMCTIR--ESGSDREVEVELLQAGDVV-VMRPG-TKLPADGTVLEGEAEVDESLMTGES 306
              C +R    G   +V    L  GD+  +  P  + LP D  ++ G+  V+ES++TGES
Sbjct: 538 --YCDVRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSILISGDCLVNESMLTGES 595

Query: 307 TLVPKYPGSR 316
             V K   +R
Sbjct: 596 VPVSKVAATR 605

>YDR440W (DOT1) [1261] chr4 (1342481..1344229) Histone H3
           methyltransferase specific for lysine 79 that is
           involved in silencing at telomeres and other repressed
           loci, required for meiotic arrest checkpoint [1749 bp,
           582 aa]
          Length = 582

 Score = 33.5 bits (75), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 46/102 (45%), Gaps = 3/102 (2%)

Query: 615 HEAAMHVSHALGIPLNNVFSERLPEGKCDVLRQLR-QKYDYVAFIGDGINDSVALAESDL 673
           H  A  + H      N V+ E LP    DV +Q + +K D    +G G+ + V  A  + 
Sbjct: 355 HPQANKLKHYKAFS-NYVYGELLPNFLSDVYQQCQLKKGDTFMDLGSGVGNCVVQAALEC 413

Query: 674 GISLSGNSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATF 715
           G +LS   +I+ DA+ + +L +       + LY + L    F
Sbjct: 414 GCALSFGCEIMDDASDLTILQYEELKKRCK-LYGMRLNNVEF 454

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%)

Query: 589 LREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGI 627
           L++DA E ++ L    H   M+TGDN   A+HV+  + I
Sbjct: 676 LKDDAIETIKMLNESSHRCIMITGDNPLTAVHVAKEVAI 714

>AFR098W [3290] [Homologous to ScYJL088W (ARG3) - SH]
           complement(611040..612089) [1050 bp, 349 aa]
          Length = 349

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 70/149 (46%), Gaps = 20/149 (13%)

Query: 555 ARLLPERPSKFSGST---ASFVAVNDVLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVT 611
           A +  +R ++   ST   A+F     + LG+ D+   + E  Y+ ++ + S    +    
Sbjct: 79  ALIFSKRSTRTRISTEGAAAFFGAQPMFLGKDDIQLGVNESLYDTIKVISSMVACIFARV 138

Query: 612 GDNHEAAMHVSHALGIPLNNVFSERLP--EGKCDVLRQLRQKYDY------VAFIGDGIN 663
           G + E    V H+  +P+ N   ++    +  CD+L  +++ ++Y      +A+IGD  N
Sbjct: 139 GKHSEIQEFVKHS-KVPVINSLCDKFHPLQAICDMLT-IKEHFNYQEKKLKLAWIGDANN 196

Query: 664 --DSVALAESDLGISLSGNSDIVADAAGI 690
             + +A+A   LGI +     +VA   GI
Sbjct: 197 VINDMAIAALKLGIDV-----VVATPQGI 220

>Scas_583.14*
          Length = 875

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%)

Query: 589 LREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGI 627
           L+ DA E ++ L    H   M+TGDN   A+HV+  + I
Sbjct: 329 LKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAI 367

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 579  LLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHA 624
            LLG   + D L+E   E +Q +   G  + M+TGD  E A+++ +A
Sbjct: 1001 LLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYA 1046

>Scas_669.3
          Length = 1638

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (56%)

Query: 579  LLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHA 624
            LLG   + D L+E   E ++ +   G  + M+TGD  E A+++ ++
Sbjct: 1056 LLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYS 1101

>Kwal_26.7070
          Length = 1315

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 57/128 (44%), Gaps = 14/128 (10%)

Query: 497 ERLS--EHPIARAIVTYAEPYASPEAVARIVVLNHEVLVGLGVRCVLQLDGVEHR-ITIG 553
           ERL   E+P   A + + E YA+ E +  +          L  R V + +  E + I   
Sbjct: 728 ERLKAGENPYIEATLRHLEDYAA-EGLRTLC---------LASRTVTESEYAEWKDIYDA 777

Query: 554 SARLLPERPSKFSGSTASFVAVNDVLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGD 613
           ++  L +R  K   + A  +  +  LLG   + D L++   E +  L   G  V ++TGD
Sbjct: 778 ASTTLDDRAQKLDDA-AELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGD 836

Query: 614 NHEAAMHV 621
             E A+++
Sbjct: 837 RQETAVNI 844

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,887,956
Number of extensions: 709664
Number of successful extensions: 1872
Number of sequences better than 10.0: 70
Number of HSP's gapped: 1825
Number of HSP's successfully gapped: 124
Length of query: 795
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 685
Effective length of database: 12,788,129
Effective search space: 8759868365
Effective search space used: 8759868365
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 66 (30.0 bits)