Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR085C95493747840.0
KLLA0F16038g86277812741e-161
YBR198C (TAF5)79865970.002
Kwal_27.1205375565960.003
KLLA0E23529g82655950.004
Sklu_2431.1274965940.005
Scas_692.2945667930.006
AEL246C81555900.015
Kwal_26.897544598890.016
YBR103W (SIF2)535114890.017
KLLA0C07425g44461880.023
AER337W44598880.026
CAGL0M05335g80680880.029
Scas_721.3282255870.035
Kwal_27.1155040779830.086
Kwal_26.7736507187830.089
AGR207C320142820.10
YOR272W (YTM1)46063820.11
YDR128W114888820.13
YIL046W (MET30)640112800.22
YKL213C (DOA1)715192800.24
Sklu_1963.231456790.25
CAGL0M06193g31655790.27
Scas_704.40608112790.27
KLLA0F10791g54569790.31
ACL116W804142790.31
Kwal_23.503574471790.32
KLLA0E12287g32659770.41
CAGL0L00781g673112780.47
AFR199C33459760.52
YPL151C (PRP46)451131760.60
Scas_693.22114577760.81
Scas_679.2881571750.87
ABL043W606311750.87
Kwal_56.23685110277750.93
CAGL0F07337g62167741.1
Sklu_2321.249852741.1
KLLA0F27511g62360741.3
CAGL0C00737g81656741.3
Sklu_2226.6398117731.4
CAGL0L10890g45759731.6
Kwal_26.757021857711.6
ADL082C569116731.6
AEL269C455106721.8
Kwal_23.576962788722.1
CAGL0K12188g535106722.2
AFL014C557102722.3
YBR175W (SWD3)31554712.4
Kwal_27.1223931646702.8
YLR129W (DIP2)943252712.8
KLLA0E08415g42282703.4
AGL359C37576693.6
AGR067W112577703.7
Kwal_27.1154279169703.9
YLR222C (UTP13)81759704.1
CAGL0A03454g48675694.6
ADL218C40378694.8
Sklu_1926.550968694.9
Scas_713.50983148695.0
CAGL0B02013g112077695.4
AGR180W80663685.8
AER110W130592686.2
Sklu_2365.2197107658.0
KLLA0D03344g570100678.9
Sklu_1880.347160669.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR085C
         (937 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR085C [1132] [Homologous to NOHBY] (508364..511228) [2865 bp, ...  1847   0.0  
KLLA0F16038g complement(1487475..1490063) weakly similar to ca|C...   495   e-161
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    42   0.002
Kwal_27.12053                                                          42   0.003
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    41   0.004
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      41   0.005
Scas_692.29                                                            40   0.006
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    39   0.015
Kwal_26.8975                                                           39   0.016
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    39   0.017
KLLA0C07425g complement(647673..649007) highly similar to sp|Q12...    39   0.023
AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH] complement(...    39   0.026
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    39   0.029
Scas_721.32                                                            38   0.035
Kwal_27.11550                                                          37   0.086
Kwal_26.7736                                                           37   0.089
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    36   0.10 
YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associa...    36   0.11 
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    36   0.13 
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    35   0.22 
YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein req...    35   0.24 
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         35   0.25 
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    35   0.27 
Scas_704.40                                                            35   0.27 
KLLA0F10791g complement(991642..993279) similar to sp|P26309 Sac...    35   0.31 
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    35   0.31 
Kwal_23.5035                                                           35   0.32 
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    34   0.41 
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...    35   0.47 
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    34   0.52 
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    34   0.60 
Scas_693.22                                                            34   0.81 
Scas_679.28                                                            33   0.87 
ABL043W [549] [Homologous to ScYMR092C (AIP1) - SH] complement(3...    33   0.87 
Kwal_56.23685                                                          33   0.93 
CAGL0F07337g complement(714870..716735) similar to sp|P26309 Sac...    33   1.1  
Sklu_2321.2 YLR015W, Contig c2321 7098-8594 reverse complement         33   1.1  
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...    33   1.3  
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    33   1.3  
Sklu_2226.6 YNL035C, Contig c2226 6858-8054 reverse complement         33   1.4  
CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024 Saccha...    33   1.6  
Kwal_26.7570                                                           32   1.6  
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...    33   1.6  
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    32   1.8  
Kwal_23.5769                                                           32   2.1  
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...    32   2.2  
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    32   2.3  
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    32   2.4  
Kwal_27.12239                                                          32   2.8  
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    32   2.8  
KLLA0E08415g 759718..760986 similar to sp|P53962 Saccharomyces c...    32   3.4  
AGL359C [3953] [Homologous to ScYER187W - NSH] (29052..30179) [1...    31   3.6  
AGR067W [4377] [Homologous to ScYDR128W - SH] complement(842182....    32   3.7  
Kwal_27.11542                                                          32   3.9  
YLR222C (UTP13) [3622] chr12 complement(579320..581773) Componen...    32   4.1  
CAGL0A03454g 349192..350652 similar to tr|Q07979 Saccharomyces c...    31   4.6  
ADL218C [1523] [Homologous to ScYNL035C - SH] (319676..320887) [...    31   4.8  
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         31   4.9  
Scas_713.50                                                            31   5.0  
CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharo...    31   5.4  
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    31   5.8  
AER110W [2615] [Homologous to ScYLR425W (TUS1) - SH] complement(...    31   6.2  
Sklu_2365.2 YPL051W, Contig c2365 827-1420 reverse complement          30   8.0  
KLLA0D03344g 279652..281364 similar to sp|P32891 Saccharomyces c...    30   8.9  
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            30   9.0  

>ACR085C [1132] [Homologous to NOHBY] (508364..511228) [2865 bp, 954
           aa]
          Length = 954

 Score = 1847 bits (4784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 896/937 (95%), Positives = 896/937 (95%)

Query: 1   MQEKDQITFENLDIEKIFGTSTNSKSCFCHXXXXXXXXXXXXXXXXDIRMQDGPPSAGSS 60
           MQEKDQITFENLDIEKIFGTSTNSKSCFCH                DIRMQDGPPSAGSS
Sbjct: 1   MQEKDQITFENLDIEKIFGTSTNSKSCFCHVGSKVAYVASGGVVVSDIRMQDGPPSAGSS 60

Query: 61  MDSLEGVEKLGGAEDAEASRPTVKICSQRFFCAYSAVQHEESAQSANVAKDLYGLCKQDQ 120
           MDSLEGVEKLGGAEDAEASRPTVKICSQRFFCAYSAVQHEESAQSANVAKDLYGLCKQDQ
Sbjct: 61  MDSLEGVEKLGGAEDAEASRPTVKICSQRFFCAYSAVQHEESAQSANVAKDLYGLCKQDQ 120

Query: 121 SILVKTGSWHENDNPDKVSFSSSSDLTPARLSPSKVKNRIKTISCLNLSQDGRYMIVGEL 180
           SILVKTGSWHENDNPDKVSFSSSSDLTPARLSPSKVKNRIKTISCLNLSQDGRYMIVGEL
Sbjct: 121 SILVKTGSWHENDNPDKVSFSSSSDLTPARLSPSKVKNRIKTISCLNLSQDGRYMIVGEL 180

Query: 181 GHKPRILVYSLAPDSNDFPVFVIQQHSFGVANLKFHPSDSRVFMSLGQINDGFLHVWRLT 240
           GHKPRILVYSLAPDSNDFPVFVIQQHSFGVANLKFHPSDSRVFMSLGQINDGFLHVWRLT
Sbjct: 181 GHKPRILVYSLAPDSNDFPVFVIQQHSFGVANLKFHPSDSRVFMSLGQINDGFLHVWRLT 240

Query: 241 STNVVLLGTNKNISSVTDVLWCNSKFITYGVRHLKEWRIDYPAPAGSTGKIQPARTRTSI 300
           STNVVLLGTNKNISSVTDVLWCNSKFITYGVRHLKEWRIDYPAPAGSTGKIQPARTRTSI
Sbjct: 241 STNVVLLGTNKNISSVTDVLWCNSKFITYGVRHLKEWRIDYPAPAGSTGKIQPARTRTSI 300

Query: 301 KGKNIVLREFINATFIDATQLDQNRVLLLTDKNIMVSYENGTLSSVHNLETCLDGQVTSI 360
           KGKNIVLREFINATFIDATQLDQNRVLLLTDKNIMVSYENGTLSSVHNLETCLDGQVTSI
Sbjct: 301 KGKNIVLREFINATFIDATQLDQNRVLLLTDKNIMVSYENGTLSSVHNLETCLDGQVTSI 360

Query: 361 LADADNDTLWTIADGKIHAVSLEYILGNHERLKVAEAALAPRGAPRHPNNSNVIKNCSFL 420
           LADADNDTLWTIADGKIHAVSLEYILGNHERLKVAEAALAPRGAPRHPNNSNVIKNCSFL
Sbjct: 361 LADADNDTLWTIADGKIHAVSLEYILGNHERLKVAEAALAPRGAPRHPNNSNVIKNCSFL 420

Query: 421 NSQLAPLLHIAENNLKGIITVRKFSKSHLLYVTTQGCLGFYDIANQCSYPMVYPVLNNIA 480
           NSQLAPLLHIAENNLKGIITVRKFSKSHLLYVTTQGCLGFYDIANQCSYPMVYPVLNNIA
Sbjct: 421 NSQLAPLLHIAENNLKGIITVRKFSKSHLLYVTTQGCLGFYDIANQCSYPMVYPVLNNIA 480

Query: 481 GYKKIYTSETLLWSREGRFKKLDEHGEQISELDLSLEPDLPYPLGSESSIGAAEMFLNTA 540
           GYKKIYTSETLLWSREGRFKKLDEHGEQISELDLSLEPDLPYPLGSESSIGAAEMFLNTA
Sbjct: 481 GYKKIYTSETLLWSREGRFKKLDEHGEQISELDLSLEPDLPYPLGSESSIGAAEMFLNTA 540

Query: 541 GTVSLAVGTGNGDLLIYEYSNSKTKKVLDTKAHTSKINDIVCLQTGTKTKVDVLVSIGRD 600
           GTVSLAVGTGNGDLLIYEYSNSKTKKVLDTKAHTSKINDIVCLQTGTKTKVDVLVSIGRD
Sbjct: 541 GTVSLAVGTGNGDLLIYEYSNSKTKKVLDTKAHTSKINDIVCLQTGTKTKVDVLVSIGRD 600

Query: 601 RIVQVFLRTEERWELQQTLSDNKGNVIKMIHDDNVVYVASADRSITKYRFEYTDDDLLIY 660
           RIVQVFLRTEERWELQQTLSDNKGNVIKMIHDDNVVYVASADRSITKYRFEYTDDDLLIY
Sbjct: 601 RIVQVFLRTEERWELQQTLSDNKGNVIKMIHDDNVVYVASADRSITKYRFEYTDDDLLIY 660

Query: 661 KEKILSIKSAPINIHLFDDRFLISTNDKQLLIYDKALEKSRYLKLLSDTDDPVIIDNLYL 720
           KEKILSIKSAPINIHLFDDRFLISTNDKQLLIYDKALEKSRYLKLLSDTDDPVIIDNLYL
Sbjct: 661 KEKILSIKSAPINIHLFDDRFLISTNDKQLLIYDKALEKSRYLKLLSDTDDPVIIDNLYL 720

Query: 721 NLRNCKQEEIMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCI 780
           NLRNCKQEEIMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCI
Sbjct: 721 NLRNCKQEEIMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCI 780

Query: 781 FSWAPQSDQLLEQRQFFIPLTGISVNSTLRESLDEQPVSARAARPETIAPRTQYTTVSPV 840
           FSWAPQSDQLLEQRQFFIPLTGISVNSTLRESLDEQPVSARAARPETIAPRTQYTTVSPV
Sbjct: 781 FSWAPQSDQLLEQRQFFIPLTGISVNSTLRESLDEQPVSARAARPETIAPRTQYTTVSPV 840

Query: 841 KLPYKCPDSRADSACSPRFRMSNQRYGLSSSKSGNYCSSMRSCIGDEDXXXXXXXXXXXX 900
           KLPYKCPDSRADSACSPRFRMSNQRYGLSSSKSGNYCSSMRSCIGDED            
Sbjct: 841 KLPYKCPDSRADSACSPRFRMSNQRYGLSSSKSGNYCSSMRSCIGDEDLHQPTLLLQLKL 900

Query: 901 FRDYLSSEDVPGPEHDAXXXXXXXXXXXXXPQNKLLE 937
           FRDYLSSEDVPGPEHDA             PQNKLLE
Sbjct: 901 FRDYLSSEDVPGPEHDAIIHEIKLISSIIEPQNKLLE 937

>KLLA0F16038g complement(1487475..1490063) weakly similar to
           ca|CA1657|IPF16022 Candida albicans unknown function,
           hypothetical start
          Length = 862

 Score =  495 bits (1274), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 284/778 (36%), Positives = 450/778 (57%), Gaps = 69/778 (8%)

Query: 9   FENLDIEKIFGTSTNSKSCFCHXXXXXXXXXXXXXXXXDIRMQDGPPSAGSSMDSLEGVE 68
            +NL I +IFG+S+NS++CF                              S+   L    
Sbjct: 5   LDNLKISRIFGSSSNSRTCF------------------------------SAAKDLIAYA 34

Query: 69  KLGGAEDAEASRPTVKICSQRFFCAYSAVQHEESAQSANVAKDLYGLCKQDQSILVKTGS 128
             GG   A+    T +I  QRFFCA S    +ES    N+AKD YGL K + SI +K  +
Sbjct: 35  ASGGVVVAQLDFDTQQIIKQRFFCASSKSLRQESHSPTNIAKDYYGLIKPEHSISIKGDT 94

Query: 129 WHENDNPDKVSFSSSSDLTPARLSPSKVKNRIKTISCLNLSQDGRYMIVGELGHKPRILV 188
           W+++D   + + +  SDL+PAR SPSK+K+RIK ISCL  S D +++IVGE GH+PRIL+
Sbjct: 95  WNDSDEASEKAVTIGSDLSPARCSPSKIKDRIKDISCLCFSADAKFLIVGETGHQPRILL 154

Query: 189 YSLAPDSNDFPVFVIQQHSFGVANLKFHPSDSRVFMSLGQINDGFLHVWRLTSTNVVLLG 248
           YS+APDSNDFPVFVI QHS+G++ L+FHP DS +F SLG INDGFLH+W+L++ ++ L+ 
Sbjct: 155 YSMAPDSNDFPVFVIHQHSYGISQLQFHPDDSTIFTSLGLINDGFLHIWKLSTNSIRLVA 214

Query: 249 TNKNISSVTDVLWC-NSKFITYGVRHLKEWRIDYPAPAGSTGKIQPARTRTSIKGKNIVL 307
           +NKN + V  + W  +S  +TYGVR +K W+ +      +  K+   RTRT+IKGKNIVL
Sbjct: 215 SNKNSTIVLGLNWYKDSALVTYGVRQIKVWKFENTNNTAN-NKLTIPRTRTAIKGKNIVL 273

Query: 308 REFINATFIDATQLDQNRVLLLTDKNIMVSYENGTLSSVHNLETCLDGQVTSILADADND 367
              I +TFID+  L  +++L LTD   +V Y+NG+L S++ LE   D Q  +IL D DND
Sbjct: 274 GTLIESTFIDSEWLRDDQLLFLTDSRQVVLYQNGSLISLYELEG--DKQYDNILVDWDND 331

Query: 368 TLWTIADGKIHAVSLEYILGNHERLKVAEAALAPRGAPRHPNNSNVIKNCSFLNSQLAPL 427
            LW   D  + ++ L ++L + ERL+    + + RGA    NN   + +  F++++ +  
Sbjct: 332 KLWFSYDEYVDSIPLTHVLNHQERLRPGSGSSSIRGASPIKNN---LFDQKFVDTEASV- 387

Query: 428 LHIAENNLKGIITVRKFSKSHLLYVTTQGCLGFYDIANQCSYPMVYPVLNNIAGYKKIYT 487
                 +   I+ ++  +   +L+ T++G +    I N+   P+  P LN+I  +KKI  
Sbjct: 388 -----RDTHKILMMKLVTNKTVLFCTSKGEIS---IINETIKPISNPSLNDIKVFKKINN 439

Query: 488 SETLLWSREGRFKKLDEHGEQISELDLSLEPDLPYPLGSESSIGAAEMFLNTAGTVSLAV 547
              +L S++G  K  D       ELD+S        L S+  I + +  +N    V   V
Sbjct: 440 DLAVLCSKKGDIKLFDGTKLSKYELDIS-------DLSSDEEITSLDFSVNENYFV---V 489

Query: 548 GTGNGDLLIYEYSNSKTKKVLDTKAHTSKINDIVCLQTGTKTKVDVLVSIGRDRIVQVFL 607
           G   G L +Y+ +  + +    +K H++ IN I   Q   K    ++++I RDR +    
Sbjct: 490 GDSTGKLSVYKDNVCEYQ----SKVHSAAINGI---QIYEKDAFKIVITISRDRTMNFIE 542

Query: 608 RTEERWELQQTLSDNKGNVIKMIHDDNVVYVASADRSITKYRFEYTDDDLLIYKEKILSI 667
                W + +T+ DNKGN+I++   DN +Y  S+DR+++ YR +  D+ L + KE ILS+
Sbjct: 543 LRAGEWNICETVKDNKGNIIQLEMCDNKLYTISSDRTVSCYRIDIVDNTLNVSKETILSV 602

Query: 668 KSAPINIHLFDDRFLISTNDKQLLIYDKALEKS-RYLKLLSDTDDPVIIDNLYLNLRNCK 726
           K++P+ + L +   ++S +DK + I+DK    + R L+LL D  D +++++ Y+   N  
Sbjct: 603 KNSPLRLQLTNSDIIVSRSDKTMQIFDKTSNSTPRLLRLLDDQGDGILVNHFYV---NAD 659

Query: 727 QEEIMCSSA-DKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCIFSW 783
            ++I+CSS+ DK +RC+++TTGK + QY+ H++PVVG+    + K ++++ NGC+FSW
Sbjct: 660 SDQILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVAN-KFVTVTGNGCLFSW 716

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 730 IMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISS-NGCIFSWAPQSD 788
           +   S+DK  R ++ +TG  ++ + GH+ PV+ +    DG+ LS  S +G I  W   + 
Sbjct: 624 VFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTG 683

Query: 789 QLLEQ 793
           + L+Q
Sbjct: 684 KRLKQ 688

>Kwal_27.12053
          Length = 755

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 730 IMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISS-NGCIFSWAPQSD 788
           +   S+DK  R ++ T+G  ++ + GH+ PV     + DG+ LS  S +G I  W   + 
Sbjct: 581 VFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTG 640

Query: 789 QLLEQ 793
           + L+Q
Sbjct: 641 KRLKQ 645

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 730 IMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISS-NGCIFSW 783
           +   S+DK  R ++  TG  ++ + GH+ PV  L  + DG+ L+  S +G I  W
Sbjct: 652 VFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVW 706

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 1/65 (1%)

Query: 730 IMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISS-NGCIFSWAPQSD 788
           +   S DK  R ++  TG  ++ + GH+ PV+    + DG+ LS  S +G I  W   + 
Sbjct: 575 VFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTG 634

Query: 789 QLLEQ 793
           + L+Q
Sbjct: 635 KRLKQ 639

>Scas_692.29
          Length = 456

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 727 QEEIMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCIFSWAPQ 786
           ++ I+ +S D V+R +N + GK+ KQY GHS P+  +    D +L+S  ++  +  W  +
Sbjct: 115 KKAIITASYDGVIRTWNLS-GKVQKQYSGHSGPIRAVKFISDTRLVSAGNDRTLRLWKTK 173

Query: 787 SDQLLEQ 793
           ++  + Q
Sbjct: 174 NNDSVVQ 180

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 36/84 (42%)

Query: 701 RYLKLLSDTDDPVIIDNLYLNLRNCKQEEIMCSSADKVLRCYNFTTGKLMKQYFGHSEPV 760
           R +K +SDT      ++  L L   K  + +    D+     N   GK +    GH  PV
Sbjct: 148 RAVKFISDTRLVSAGNDRTLRLWKTKNNDSVVQHFDEEDEEANIEDGKTLAILEGHKAPV 207

Query: 761 VGLVPARDGKLLSISSNGCIFSWA 784
           V L  +   ++LS S +  I  W+
Sbjct: 208 VSLDVSNTSRILSSSYDNSIGLWS 231

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 730 IMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISS-NGCIFSW 783
           ++  S+DK  R ++  TG  ++ + GH+  VV +  + DG+ L+  S +G I  W
Sbjct: 641 VLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVW 695

>Kwal_26.8975
          Length = 445

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 51/98 (52%), Gaps = 9/98 (9%)

Query: 693 YDKALEKSRYLKLLSDTDDPVIIDNLYLNLRNCKQEEIMCSSADKVLRCYNFTTGKLMKQ 752
           Y +A+    YLK  ++ D        +++  +   ++I+  S D ++R +N + GK+ KQ
Sbjct: 86  YTRAVLPPSYLKSFNNED--------WVSALDVGGDKIVSGSYDGIVRTWNLS-GKVEKQ 136

Query: 753 YFGHSEPVVGLVPARDGKLLSISSNGCIFSWAPQSDQL 790
           Y GHS  V  +      +L+S +++  +  W  ++D+L
Sbjct: 137 YAGHSGAVRAVKYISSTRLVSGANDRTLRLWKTKNDEL 174

>YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in
           telomere silencing, interacts with Sir4p and targets
           Sir4p from telomeres to other sites, component of Set3p
           complex, has WD (WD-40) repeats [1608 bp, 535 aa]
          Length = 535

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 56/114 (49%), Gaps = 7/114 (6%)

Query: 678 DDRFLISTNDKQLLIYDKALEKSRYLKLLSDTDDPVIIDNLYLNLRNCKQEEIMCSSADK 737
           DD+F+I      + +Y +  EK+   KL+     P+ +  L  N  N   + ++ +S D 
Sbjct: 329 DDKFVIPGPKGAIFVY-QITEKTPTGKLIGH-HGPISV--LEFNDTN---KLLLSASDDG 381

Query: 738 VLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCIFSWAPQSDQLL 791
            LR ++   G     ++GHS+ +V      D K++S S +G +  W+ + + LL
Sbjct: 382 TLRIWHGGNGNSQNCFYGHSQSIVSASWVGDDKVISCSMDGSVRLWSLKQNTLL 435

>KLLA0C07425g complement(647673..649007) highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein singleton, start by
           similarity
          Length = 444

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 730 IMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCIFSWAPQSDQ 789
           I   S D ++R YN + GK+ KQY GHS P+  +      +L+S  ++  +  W  ++D 
Sbjct: 116 IYSGSYDGIVRTYNLS-GKVEKQYSGHSGPIRAVHYISSTRLVSAGNDRTLRLWKTKNDD 174

Query: 790 L 790
           L
Sbjct: 175 L 175

>AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH]
           complement(1256750..1258087) [1338 bp, 445 aa]
          Length = 445

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 48/98 (48%), Gaps = 9/98 (9%)

Query: 693 YDKALEKSRYLKLLSDTDDPVIIDNLYLNLRNCKQEEIMCSSADKVLRCYNFTTGKLMKQ 752
           Y +A+    YLK  S+ D        +++  +   E I+  S D V+R +N + GK+ KQ
Sbjct: 87  YTRAVLPPSYLKSFSNED--------WVSALDVGAERIVSGSYDGVVRTWNLS-GKIEKQ 137

Query: 753 YFGHSEPVVGLVPARDGKLLSISSNGCIFSWAPQSDQL 790
           Y GH+  V  +      +L+S  ++  +  W  ++D +
Sbjct: 138 YSGHTGAVRAVKFISSTRLVSGGNDRTLRLWKTKNDDV 175

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 41/80 (51%), Gaps = 4/80 (5%)

Query: 715 IDNLYLNLRNCKQEEIMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSI 774
           +D +  +   C    +   S+DK  R ++ +TG  ++ + GH+ PV+    + DG+ L+ 
Sbjct: 620 VDTVSFHPNGCY---VFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLAT 676

Query: 775 SS-NGCIFSWAPQSDQLLEQ 793
            S +G I  W   + + ++Q
Sbjct: 677 GSEDGVICLWDIGTGKRIKQ 696

>Scas_721.32
          Length = 822

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 730 IMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISS-NGCIFSW 783
           +   S+DK  R ++ +TG  ++ + GH+ PV+    + DG+ L+  S +G I  W
Sbjct: 648 VFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLW 702

>Kwal_27.11550
          Length = 407

 Score = 36.6 bits (83), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 4/79 (5%)

Query: 202 VIQQHSFGVANLKFHPSDSRVFMSLGQINDGFLHVWRLTSTNV-VLLGTNKNISSVTDVL 260
           ++  H   + N+KFHP+D  V +S     DG+++++ LT       L    N +S+    
Sbjct: 142 LVDSHHDDITNIKFHPTDPNVLLSGS--TDGYVNIYDLTQPEEDDALHQVINFASIHSSG 199

Query: 261 WCNSKFITYGVRHLKEWRI 279
           WC  K I Y + H++ + I
Sbjct: 200 WCAPKRI-YTLSHMETFGI 217

>Kwal_26.7736
          Length = 507

 Score = 36.6 bits (83), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 76/187 (40%), Gaps = 54/187 (28%)

Query: 88  QRFFCAYSAVQHEESAQSANVAKDLYGLCKQDQSILVKTGSWHENDNPDKVSFSSSSDLT 147
           QR++ AY + Q                L K+  S+   T      ++P+  + +SS   T
Sbjct: 24  QRYWRAYGSTQ----------------LVKEHNSV---TSIAFNPNHPNDFAITSS---T 61

Query: 148 PARLSPSKVKNRIKTIS-------CLNLSQDGRYMIVGEL--------GHKPRILVYSLA 192
             +L  S+ +  IKT S         +  QDG+ + +G+          + PR  + S+A
Sbjct: 62  RVQLFSSRTRQVIKTFSRFKDVVYSASFRQDGKLLAMGDATGRVSVYDSYNPRAQLVSIA 121

Query: 193 PDSNDFPVFVIQQHSFGVANLKFHPSDSRVFMSLGQINDGFLHVWRLTST---NVVLLGT 249
             S          H   VA  KFHP+DSR  ++    +D  + VW +T      V L G 
Sbjct: 122 ASS----------HPTHVA--KFHPADSRTLVTAS--DDRVVRVWDITQAQEPQVELTGA 167

Query: 250 NKNISSV 256
           +  + SV
Sbjct: 168 SDYVRSV 174

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 63/142 (44%), Gaps = 13/142 (9%)

Query: 637 YVASADRSITKYRFEYTDDDLLIYKEKILSIKSAPIN-IHLFDDRFLISTNDKQLLIYDK 695
           YVA ADR+     +   D     Y+    +  + PIN I    D   +++  +   +   
Sbjct: 28  YVAVADRTAICV-YSVGDGGCARYE----TTHTEPINDICWSPDSACVASGSEDFTVEIT 82

Query: 696 ALEKSRYLKLLSDTDDPVIIDNLYLNLRNCKQEEIMCSSADKVLRCYNFTTGKLMKQYFG 755
            LE  R  KL   +  PV+       + NCK   +  +S D+ ++ ++  +G L+K    
Sbjct: 83  HLEYGRLHKLRGHSA-PVL-----SVVFNCKGNLLCTASVDESIKQWDVLSGTLLKTMSA 136

Query: 756 HSEPVVGL-VPARDGKLLSISS 776
           HS+PVV +  P  D  +LS  S
Sbjct: 137 HSDPVVSIDTPDCDATILSSGS 158

>YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associated
           protein essential for the G1/S transition, member of WD
           (WD-40) repeat family [1383 bp, 460 aa]
          Length = 460

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 35/63 (55%), Gaps = 1/63 (1%)

Query: 728 EEIMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCIFSWAPQS 787
           + I+  S D ++R ++ + G + KQY GHS P+  +    + +L+S  ++  +  W  ++
Sbjct: 116 KHIISGSYDGIVRTWDLS-GNVQKQYSGHSGPIRAVKYISNTRLVSAGNDRTLRLWKTKN 174

Query: 788 DQL 790
           D L
Sbjct: 175 DDL 177

>YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing
           five WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has a region of low
           similarity to a region of S. cerevisiae Sec27p, which a
           coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles [3447 bp, 1148 aa]
          Length = 1148

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 4/88 (4%)

Query: 174 YMIVGELGHKPRILVYSLAPDSNDFPVFVIQQHSFGVANLKFHPSDSRVFMSLGQINDGF 233
           Y IV     K   ++++LA  S++   FV+  HS  + ++ F+P    V  +     D +
Sbjct: 83  YWIVSTSNQK--AIIWNLAKSSSNAIEFVLHGHSRAITDINFNPQHPDVLATCSV--DTY 138

Query: 234 LHVWRLTSTNVVLLGTNKNISSVTDVLW 261
           +H W + S +     T+   S+ + V W
Sbjct: 139 VHAWDMRSPHRPFYSTSSWRSAASQVKW 166

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 11/112 (9%)

Query: 677 FDDRFLIS-TNDKQLLIYDKALEKSRYLKLLSDTDDPVIIDNLYLNLRNCKQEEIMCSSA 735
           F+ R L + + D  + I+D  L   + ++ LS   D V    LY + R     +++  S 
Sbjct: 310 FNYRLLFTGSYDSTIGIWD--LFTGKLIRRLSGHSDGV--KTLYFDDR-----KLITGSL 360

Query: 736 DKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCIFSWAPQS 787
           DK +R +N+ TG+ +  Y GHS+ V+  V +    ++S S++  +  W  +S
Sbjct: 361 DKTIRVWNYITGECISTYRGHSDSVLS-VDSYQKVIVSGSADKTVKVWHVES 411

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 729 EIMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCIFSWAPQSD 788
            ++    D  ++ ++  TGK ++  FGH E V   + A + +++S S +G I  W  QS 
Sbjct: 524 HLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWD-IAADNFRIISGSHDGSIKVWDLQSG 582

Query: 789 QLLE 792
           + + 
Sbjct: 583 KCMH 586

>YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein
           required in ubiquitin proteolysis and found complexed
           with Cdc48p, has WD (WD-40) repeats [2148 bp, 715 aa]
          Length = 715

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 40/192 (20%), Positives = 84/192 (43%), Gaps = 21/192 (10%)

Query: 618 TLSDNKGNVIKMIHDDNVVYVASADRSITKYRFEYTDDDLLIYKEKI--LSIKSAPINIH 675
           TL  ++GNV  +   D VV   S D++   ++     +  L+Y  +    S+  A + + 
Sbjct: 94  TLIGHQGNVCSLSFQDGVVISGSWDKTAKVWK-----EGSLVYNLQAHNASVWDAKV-VS 147

Query: 676 LFDDRFLISTNDKQLLIYDKALEKSRYLKLLSDTDDPVIIDNLYLNLRNCKQEEIMCSSA 735
             +++FL ++ DK +    K  +  + +K  S   + V+      +L        +  S 
Sbjct: 148 FSENKFLTASADKTI----KLWQNDKVIKTFSGIHNDVV-----RHLAVVDDGHFISCSN 198

Query: 736 DKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCIFSWAPQSDQLLEQRQ 795
           D +++  +  TG +++ Y GH   V  +    +G ++S   +  +  W+ ++  L +   
Sbjct: 199 DGLIKLVDMHTGDVLRTYEGHESFVYCIKLLPNGDIVSCGEDRTVRIWSKENGSLKQ--- 255

Query: 796 FFIPLTGISVNS 807
             I L  IS+ S
Sbjct: 256 -VITLPAISIWS 266

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 720 LNLRNCKQEEIMCS-SADKVLRCYNFTTGKLMKQYFGHSEPVVGL-VPARDGKLLS 773
           L+L    +  ++CS S D+ ++ ++  TG L+K    HSEPVV + +P  D  +LS
Sbjct: 101 LSLVYTSKGNLLCSASMDESIKIWDVLTGTLLKTISAHSEPVVSIDMPVCDPSILS 156

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 724 NCKQEEIMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGL-VPARDGKLLSISSN 777
           N K   +  SS D+ ++ ++  TG +MK    HSEPVV + +   DG +LS  S+
Sbjct: 105 NNKGNLLFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLSDNDGSILSSGSH 159

>Scas_704.40
          Length = 608

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 58/112 (51%), Gaps = 11/112 (9%)

Query: 677 FDDRFLIS-TNDKQLLIYDKALEKSRYLKLLSDTDDPVIIDNLYLNLRNCKQEEIMCSSA 735
           F+ R L + + D  + I+D  L  ++ ++ LS   D V    LY +     + +++  S 
Sbjct: 261 FNYRLLFTGSYDSTVAIWD--LCSNKLIRRLSGHTDGV--KTLYFD-----EAKLVTGSL 311

Query: 736 DKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCIFSWAPQS 787
           DK +R +N+ TG+ +  Y GH++ V+  V A    ++S S++  +  W  +S
Sbjct: 312 DKTIRVWNYKTGECISTYRGHTDSVMS-VDAFKKIIVSGSADKTVKIWHVES 362

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 729 EIMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCIFSWAPQSD 788
            ++  S D  ++ ++  TG+ ++  FGH E V   + A + +++S S +G I  W  QS 
Sbjct: 479 HLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWD-IAADNFRIISGSHDGSIKIWDLQSG 537

Query: 789 QLLE 792
           + + 
Sbjct: 538 KCMH 541

>KLLA0F10791g complement(991642..993279) similar to sp|P26309
           Saccharomyces cerevisiae YGL116w CDC20 cell division
           control protein, hypothetical start
          Length = 545

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 2/69 (2%)

Query: 196 NDFPVFVIQQHSFGVANLKFHPSDSRVFMSLGQINDGFLHVWRLTSTNVVLLGTNKNISS 255
           N+ P++  + H   V  + +HP  + +  + G   D  +H W  T+ N   LGT    S 
Sbjct: 365 NNDPIWTKRNHKAAVKAISWHPEITNLLATGGGSLDKHIHFWNTTTGN--RLGTIDTGSQ 422

Query: 256 VTDVLWCNS 264
           V+ + W  S
Sbjct: 423 VSSLHWGQS 431

>ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH]
           complement(140589..143003) [2415 bp, 804 aa]
          Length = 804

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 59/142 (41%), Gaps = 12/142 (8%)

Query: 524 LGSESSIGAAEMFLNTAGTVSLAVGTGNGDLLIYEYSNSKTKKVLDTKAHTSKINDIVCL 583
           +G+      A+ +L T    ++A G G    L               KAH +++  +  +
Sbjct: 32  IGANRQTKVADFYLPTK---TVAFGAGKCIALWNPLDEHNAGVYCTLKAHNAEVTSVKFI 88

Query: 584 QTGTKTKVDVLVSIGRDRIVQVFLRTEERWELQQTLSDNKGNVIKMIHDDNVVYVASADR 643
             G +    +LVS   D  + V+ R +ERWEL QTL   K +V  +     ++    AD 
Sbjct: 89  --GAE---KLLVSASADATINVW-RGDERWELAQTLEGPKSSVTSLAVAAGLIVAGFADG 142

Query: 644 SITKYRFEYTDDDLLIYKEKIL 665
           +++ +      DD  +   + L
Sbjct: 143 TLSVWS---EHDDAFVLSSQFL 161

>Kwal_23.5035
          Length = 744

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 720 LNLRNCKQEE---IMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISS 776
           + +  C Q E   ++  + DK++R Y+  T K + Q  GH   V  L    DG L+S S+
Sbjct: 370 MKIVTCLQFEDDYVITGADDKMIRVYDAKTEKFITQLSGHDGGVWALKYGHDGILVSGST 429

Query: 777 NGCIFSWAPQS 787
           +  +  W  +S
Sbjct: 430 DRSVRVWNIKS 440

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 9/85 (10%)

Query: 677 FDDRFLIS-TNDKQLLIYDKALEKSRYLKLLSDTDDPVIIDNLYLNLRNCKQEEIMCSSA 735
           F+D ++I+  +DK + +YD   EK  ++  LS  D  V        L+      ++  S 
Sbjct: 378 FEDDYVITGADDKMIRVYDAKTEK--FITQLSGHDGGV------WALKYGHDGILVSGST 429

Query: 736 DKVLRCYNFTTGKLMKQYFGHSEPV 760
           D+ +R +N  +GK    + GH+  V
Sbjct: 430 DRSVRVWNIKSGKCTHVFKGHTSTV 454

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 731 MCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGL-VPARDGKLLSISSNGCIFSWAPQSD 788
           + +S DK LR +N  TG    ++ GH+  V+ + + A   K++S S +  I  W    D
Sbjct: 82  VSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGD 140

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 57/112 (50%), Gaps = 11/112 (9%)

Query: 677 FDDRFLISTN-DKQLLIYDKALEKSRYLKLLSDTDDPVIIDNLYLNLRNCKQEEIMCSSA 735
           F+ R L + + D  + I+D  L   + ++ L+   D V    LY +      ++++  S 
Sbjct: 342 FNYRLLFTGSYDTTVAIWD--LFTGKLIRRLTGHSDGV--KTLYFD-----DQKLITGSL 392

Query: 736 DKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCIFSWAPQS 787
           DK +R +N+ TG+ +  Y GH++ V+  V +    ++S S++  +  W  +S
Sbjct: 393 DKTIRVWNYITGECISTYRGHTDSVMS-VDSHKKIIVSGSADKTVKVWHVES 443

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 2/95 (2%)

Query: 729 EIMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCIFSWAPQSD 788
            ++  + D  ++ +   +G+ ++  FGH E V   + A + +++S S +G I  W  QS 
Sbjct: 554 HLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWD-IAADNFRIISGSHDGSIKIWDLQSG 612

Query: 789 QLLEQRQFFIPLTGISVNSTLRESLDEQPVSARAA 823
           + +        L G  VN++     DE+  SA  A
Sbjct: 613 KCMHTFHGR-KLKGSDVNTSSNPDHDERTKSAPVA 646

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 33.9 bits (76), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 731 MCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGL-VPARDGKLLSISSNGCIFSWAPQSD 788
           + +S DK LR ++  +GK +K++ GH   V+ + +  R  +++S S +  +  W    D
Sbjct: 97  LSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWNTVGD 155

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 33.9 bits (76), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 60/131 (45%), Gaps = 8/131 (6%)

Query: 728 EEIMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGL-VPARDGKLLSISSNGCIFSWAPQ 786
           E  +  S D  ++ ++  TGKL     GH   V  + V  R   L S+S +  +  W  +
Sbjct: 153 EWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLE 212

Query: 787 SDQLLEQRQFFIPLTGISVNSTLRESLDEQPVSARAARPETIAPRTQYTTVSPVKLPYKC 846
            +Q++  R ++  L+G+   S +  +LD    + R +  +    RT+   ++ V   +K 
Sbjct: 213 KNQII--RDYYGHLSGVRTVS-IHPTLDLIATAGRDSVIKLWDMRTRIPVITLVG--HKG 267

Query: 847 PDSRADSACSP 857
           P ++    C+P
Sbjct: 268 PINQVQ--CTP 276

>Scas_693.22
          Length = 1145

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 37/77 (48%), Gaps = 2/77 (2%)

Query: 185 RILVYSLAPDSNDFPVFVIQQHSFGVANLKFHPSDSRVFMSLGQINDGFLHVWRLTSTNV 244
           + L+++LA  S+D    V+  HS  + ++ F+P +  +  +     D ++H W + S + 
Sbjct: 95  KALIWNLARTSSDAIDHVLHGHSRAITDINFNPENPDILATCSV--DTYVHAWDMRSPHR 152

Query: 245 VLLGTNKNISSVTDVLW 261
               T+   S  + V W
Sbjct: 153 PFYTTSAWRSGASQVKW 169

>Scas_679.28
          Length = 815

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 726 KQEEIMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLL-SISSNGCIFSWA 784
           KQ +++ S AD +++ ++ +TG  +K   GH   +  L    DG ++ S  ++G    W 
Sbjct: 586 KQLQLVSSGADGLIKIWDCSTGDCLKTLDGHDNRIWALTEINDGDMIVSADADGVFQFWK 645

Query: 785 PQSDQLLEQRQ 795
             ++  LE+ Q
Sbjct: 646 DCTE--LEKEQ 654

>ABL043W [549] [Homologous to ScYMR092C (AIP1) - SH]
           complement(314672..316492) [1821 bp, 606 aa]
          Length = 606

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 65/311 (20%), Positives = 129/311 (41%), Gaps = 44/311 (14%)

Query: 505 HGEQISELDLSLEPDLPYPLGSESSIGAAEM-FLNTAGTVSLAVGTGNGDLLIYEYSNSK 563
           +G   S +  SL+ D+        S     + F   AG+  +  G   G ++++ Y   +
Sbjct: 35  YGSGKSAIVKSLDSDIVVQFTGHGSANVTVVRFSPVAGSQYVVSGDDAGRIMVWSYFEDE 94

Query: 564 TKKVLDTKAHT------SKINDIVCLQTGTKTKVDVLVSIGRDRIVQVFLRTEERWELQQ 617
            K  ++TK  +        + DI     G +  V   V  GRDR    F+     W+   
Sbjct: 95  EKGQVETKLRSEFQVLAGAVADISWDFEGRRLCV---VGAGRDRY-GAFIS----WDTGN 146

Query: 618 TLSDNKGNVIKMIHDDNVVYVASADRSITKYRFEYTDDD--LLIYKEKILSIKSAPINIH 675
           +L +  G+ + +    N  ++    R     R     DD  ++ YK        +    H
Sbjct: 147 SLGEVTGHALNV----NACHI----RQARPMRAATVSDDGSMVFYKGPPFQFSCSDHTHH 198

Query: 676 -----LFDDRF-------LIST-NDKQLLIYDKALEKSRYLKLLS-DTDDPVIIDNLYLN 721
                + D RF       L+S  +D+++++YD   +   ++K +  D+++     +L   
Sbjct: 199 ANGKFVRDVRFSPAKGAYLVSVGSDRKIVLYDG--DSGEFIKYIGEDSEECGGFFSLAWV 256

Query: 722 LRNCKQEEIMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVP---ARDGKLLSISSNG 778
               K   I+ +SAD V+R ++    +L+K++   +E     V     RD  ++S+S +G
Sbjct: 257 DDGDKSNRIVTASADGVVRLWDVEANRLLKRWELGTEVAQQQVGVVVTRDSNIISVSLDG 316

Query: 779 CIFSWAPQSDQ 789
            +  ++ +SD+
Sbjct: 317 TLNVFSIESDK 327

>Kwal_56.23685
          Length = 1102

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 36/77 (46%), Gaps = 2/77 (2%)

Query: 185 RILVYSLAPDSNDFPVFVIQQHSFGVANLKFHPSDSRVFMSLGQINDGFLHVWRLTSTNV 244
           + L+++L+ +S+D    V+  HS  + ++ FHP+   +  +     D ++H W + S   
Sbjct: 92  KALLWNLSRNSSDAIEHVLHGHSRAITDINFHPTHPEILATCSI--DAYVHAWDMRSPRR 149

Query: 245 VLLGTNKNISSVTDVLW 261
                +   +  + V W
Sbjct: 150 AYYSASVWSAGASQVKW 166

>CAGL0F07337g complement(714870..716735) similar to sp|P26309
           Saccharomyces cerevisiae YGL116w CDC20 cell division
           control protein, hypothetical start
          Length = 621

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 2/67 (2%)

Query: 198 FPVFVIQQHSFGVANLKFHPSDSRVFMSLGQINDGFLHVWRLTSTNVVLLGTNKNISSVT 257
            P FV + HS  V  L + P+++ +  S G   D  +H W   ST    L T    S V+
Sbjct: 410 MPQFVKKDHSAAVKALAWSPTNAGLLASGGGQTDQQIHFW--NSTTGAKLHTINTGSQVS 467

Query: 258 DVLWCNS 264
            + W  S
Sbjct: 468 SLHWGQS 474

>Sklu_2321.2 YLR015W, Contig c2321 7098-8594 reverse complement
          Length = 498

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%)

Query: 683 ISTNDKQLLIYDKALEKSRYLKLLSDTDDPVIIDNLYLNLRNCKQEEIMCSS 734
           I TN KQLL +DK  +  R +K L +  D  + D +  ++ +  + E +C S
Sbjct: 446 IVTNTKQLLYWDKVKQDKRDVKCLDEIYDEQVADEIVWDIIDEVEAEFLCGS 497

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 728 EEIMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCIFSWAPQS 787
           ++++ +S DK +R +N+ TG  +  Y GH + V+  V +    ++S S++  +  W  +S
Sbjct: 363 QKMITASLDKTIRVWNYITGSCISTYRGHQDSVLS-VDSYKKIIVSASADKTVKVWHVES 421

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 30/56 (53%)

Query: 726 KQEEIMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCIF 781
           KQ++++ + AD +++ ++  +G  +K   GHS  +  L    DG L+  +    +F
Sbjct: 590 KQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIWALSVLEDGDLIISADADSVF 645

>Sklu_2226.6 YNL035C, Contig c2226 6858-8054 reverse complement
          Length = 398

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 9/117 (7%)

Query: 168 LSQDGRYMIVG---EL-GHKPRILVYSLAPDSNDFPVFVIQQHSFGVANLKFHPSDSRVF 223
           LS D R+ ++    EL G    + +Y +   S     FV   H   + + KFHP D  V 
Sbjct: 105 LSLDSRHDMLACGTELSGVDAELHIYDIKKLSKPLRSFVDSHHD-DITDTKFHPGDPGVL 163

Query: 224 MSLGQINDGFLHVWRLTSTNVV-LLGTNKNISSVTDVLWCNSKFITYGVRHLKEWRI 279
           MS     DG+++++ LT+++    L    N +SV    W   + I Y + H++ + I
Sbjct: 164 MSGS--TDGYVNIYDLTNSDEEDALHQVINFASVHSCGWLAPRRI-YTLSHMETFAI 217

>CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein, start by similarity
          Length = 457

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 730 IMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCIFSWAPQSD 788
           I   S D V+R +N + GK+ KQY GH+  V  +    + +++S  ++  +  W  ++D
Sbjct: 118 IYSGSYDGVVRTWNMS-GKVEKQYSGHTGAVKAVKYISNTRIVSAGNDRSLRLWKTKND 175

>Kwal_26.7570
          Length = 218

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 728 EEIMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGL-VPARDGKLLSISSNGCIFSW 783
           E  + +S DK +R +   TGK ++++ GH   V+ + +  R  +++S S +  +  W
Sbjct: 78  EYALSASWDKTVRLWELATGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVW 134

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 53/116 (45%), Gaps = 10/116 (8%)

Query: 672 INIHLFDDRFLISTNDKQLLIYDKALEKSRYLKLLSDTDDPVIIDNLYLNLRNCKQEEIM 731
           +++ L +   L  + D  + I+D  L   + ++ LS   D V              ++++
Sbjct: 263 LSLQLTNKLLLTGSYDSTVAIWD--LATGKLIRRLSGHTDGVKALRF-------DDQKLI 313

Query: 732 CSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCIFSWAPQS 787
             S DK +R +N+ TG  +  Y GH + V+ +   R   ++S S++  +  W  +S
Sbjct: 314 TGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRK-LIVSGSADKTVKVWHVES 368

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 46/106 (43%), Gaps = 10/106 (9%)

Query: 545 LAVGTGNGDLLIYEYSNSKTKKVLDTKAHTSKINDIVCLQTGTKTKVDVLVSIGRDRIVQ 604
           LA    +G + +++  N  T+  L   AH     D+       K     LVS G DR+V 
Sbjct: 355 LATAGADGTVRVWDIRNVGTESAL--LAHQVAALDVKF----KKNNGTFLVSCGHDRLVN 408

Query: 605 VFLRTEERWELQQTLSDNKGNV--IKMIHDDNVVYVASADRSITKY 648
           +F    + W+   +L  +   V  + +  D + +Y    DRS+ ++
Sbjct: 409 IF--NADNWQKLASLEGHTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

>Kwal_23.5769
          Length = 627

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 46/88 (52%), Gaps = 10/88 (11%)

Query: 677 FDDRFLISTN-DKQLLIYDKALEKSRYLKLLSDTDDPVIIDNLYLNLRNCKQEEIMCSSA 735
           F+ R L + + D  + I+D  L   + ++ L+   D V    +Y +      ++++  S 
Sbjct: 325 FNYRLLFTGSYDSTVAIWD--LATGKLVRRLTGHRDGV--KAIYFD-----GQKLITGSL 375

Query: 736 DKVLRCYNFTTGKLMKQYFGHSEPVVGL 763
           D+++R +N+ TG  +  Y GHS+ V+ +
Sbjct: 376 DRMIRVWNYVTGACVAAYPGHSDSVLSV 403

>CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces
           cerevisiae YBR103w SIF2 SIR4P interacting protein, start
           by similarity
          Length = 535

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 49/106 (46%), Gaps = 9/106 (8%)

Query: 679 DRFLISTNDKQLLIYDKALEKSRYLKLLSDTDDPVIIDNLYLNLRNCKQEEIMCSSAD-K 737
           D+F+I      LL+Y   +  SR +  L        I  L  N     + +++ S+AD  
Sbjct: 330 DKFVIPGPGGNLLVY--TMSDSRPIGKL--VGHRGTISQLEFN----SETKLLASAADDN 381

Query: 738 VLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCIFSW 783
            +R ++   G  +  ++GH++ +V L    +  L+S S +G +  W
Sbjct: 382 TIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLW 427

>AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH]
           (409496..411169) [1674 bp, 557 aa]
          Length = 557

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/102 (21%), Positives = 44/102 (43%), Gaps = 7/102 (6%)

Query: 163 ISCLNLSQDGRYMIVGELGHKPRILVYSLAPDSNDFPVFVIQQHSFGVANLKFHPSDSRV 222
           +  +   QDG  +  G  G+   ++++    D    P++V + H+  V  + +HP    +
Sbjct: 350 VCGIKFRQDGLQLASG--GNDNTVMIWDTRQDE---PLWVKRNHNAAVKAITWHPDVVNL 404

Query: 223 FMSLGQINDGFLHVWRLTSTNVVLLGTNKNISSVTDVLWCNS 264
             + G   D  +H W  T+     +G+    S V+ + W  S
Sbjct: 405 LATGGGSLDRHIHFWNTTTG--ARIGSINTGSQVSSLHWGQS 444

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 724 NCKQEEIMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGL-VPARDGKLLSISS 776
           N K   +  SS D+ ++ ++   G LMK    HSE VV + VP  D  +LS  S
Sbjct: 105 NRKGNLLFTSSMDESIKIWDTLNGSLMKTISAHSEAVVSVDVPMNDSSILSSGS 158

>Kwal_27.12239
          Length = 316

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 730 IMCS-SADKVLRCYNFTTGKLMKQYFGHSEPVVGL-VPARDGKLLS 773
           ++CS S D+ ++ ++  +G L++    HSEPVV + +P  D  +LS
Sbjct: 113 LLCSCSMDESIKIWDILSGTLLRTLSAHSEPVVSIDLPPFDPSILS 158

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 107/252 (42%), Gaps = 59/252 (23%)

Query: 541 GTVSLAVGTGNGDLLIYEYSNSKTKKVLDT--KAHTSKINDIVCLQTGTKTKVDVLVSIG 598
           G + + +GT NG+L +++ ++S    +LDT   AH + I  +     G +     LV+  
Sbjct: 441 GGLLVILGTRNGELQLFDLASSS---LLDTIEDAHDAAIWSLDLTSDGKR-----LVTGS 492

Query: 599 RDRIVQVFLRTEERWELQQTLSDNKGN----VIKMIHDDNVVYVASADRSITKYRFEYTD 654
            D+ V+ +      ++++ +L     N    V+K+ HD  +               E TD
Sbjct: 493 ADKTVKFW-----DFKVENSLVPGTKNKFLPVLKLHHDTTL---------------ELTD 532

Query: 655 DDLLIYKEKILSIKSAPINIHLFDDRFL-ISTNDKQLLIYDKALEKSRYLKLLSDTDDPV 713
           D        IL ++ +P      DDR+L IS  D  + ++   L+  ++   L     PV
Sbjct: 533 D--------ILCVRVSP------DDRYLAISLLDNTVKVF--FLDSMKFYLSLYGHKLPV 576

Query: 714 IIDNLYLNLRNCKQEEIMCSSADKVLRCYNFTTGKLMKQYFGHSEPV--VGLVPARDGKL 771
           +  ++  +      + I+ SSADK ++ +    G   K  F H + +  V  +P +    
Sbjct: 577 LSIDISFD-----SKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP-QSHNF 630

Query: 772 LSISSNGCIFSW 783
            S S +  +  W
Sbjct: 631 FSCSKDAVVKYW 642

>KLLA0E08415g 759718..760986 similar to sp|P53962 Saccharomyces
           cerevisiae YNL035c singleton, start by similarity
          Length = 422

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 10/82 (12%)

Query: 203 IQQHSFGVANLKFHPSDSRVFMSLGQINDGFLHVWRLTSTNVV-LLGTNKNISSVTDVLW 261
           +  H   + ++KFHP DS + MS     DG+++++ LT  +    L    N +S+    W
Sbjct: 143 VDSHHDDITDIKFHPCDSNLLMSGS--TDGYVNIYDLTQDDEEDALHQVINFASIHSCGW 200

Query: 262 CNSKFI-------TYGVRHLKE 276
              K I       T+G+  L +
Sbjct: 201 LGPKRIWSLSHMETFGIHELND 222

>AGL359C [3953] [Homologous to ScYER187W - NSH] (29052..30179) [1128
           bp, 375 aa]
          Length = 375

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 18/76 (23%)

Query: 104 QSANVAKDLYGLCKQDQSILVKTGSW-----HENDNPDKVSFSSSSDLTPARLSPSKVKN 158
           QS  +A+DLYG            G W     H   N +K S S+ +  T + LS +++K+
Sbjct: 130 QSLAIAQDLYG------------GEWKITQPHPPYNNNKRSLSNYAFETASELS-TQIKS 176

Query: 159 RIKTISCLNLSQDGRY 174
           R  T++ LN++  GR+
Sbjct: 177 RADTLAALNINLVGRF 192

>AGR067W [4377] [Homologous to ScYDR128W - SH]
           complement(842182..845559) [3378 bp, 1125 aa]
          Length = 1125

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 35/77 (45%), Gaps = 2/77 (2%)

Query: 185 RILVYSLAPDSNDFPVFVIQQHSFGVANLKFHPSDSRVFMSLGQINDGFLHVWRLTSTNV 244
           + +V++LA  S++     +  H+  + ++ FHP    +  +     D ++H W +  +  
Sbjct: 92  KAIVWNLARSSSNAVEHELHGHTRAITDINFHPIHPELLATCSI--DTYVHAWDMRCSQR 149

Query: 245 VLLGTNKNISSVTDVLW 261
              GT+   S  + V W
Sbjct: 150 PFYGTSDWSSGASQVKW 166

>Kwal_27.11542
          Length = 791

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 3/69 (4%)

Query: 768 DGKLLSISSNGCIFSWAPQSDQLLEQRQFFIPLTGISVNSTLRESLDEQPVSA---RAAR 824
           DG  ++ S N  +    P   Q ++Q     P T I   + L+E +  QP SA   R +R
Sbjct: 369 DGAAMNGSINNYVPVLKPHQAQPVQQNYRSDPFTSIDRRTVLQEKIPLQPASADFQRLSR 428

Query: 825 PETIAPRTQ 833
            +T  P T+
Sbjct: 429 AQTFVPVTK 437

>YLR222C (UTP13) [3622] chr12 complement(579320..581773) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis,
           overproduction causes chromosome instability and
           increased mitotic recombination, contains WD (WD-40)
           repeats [2454 bp, 817 aa]
          Length = 817

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/59 (23%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 726 KQEEIMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLL-SISSNGCIFSW 783
           KQ++++   AD +++ ++ ++G+ +K   GH+  +  L    DG ++ S  ++G    W
Sbjct: 586 KQKQLISCGADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFW 644

>CAGL0A03454g 349192..350652 similar to tr|Q07979 Saccharomyces
           cerevisiae YLR033w, hypothetical start
          Length = 486

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 37/75 (49%), Gaps = 5/75 (6%)

Query: 697 LEKSRYLKLLSD-TDDPVIIDNLYLNLRNCKQEEIMCSSADKVLRCYNFTTGKLMKQYFG 755
           L KSR  K L + TDD     NLY   R    +EIM S  D+ L+  N T+  +++  + 
Sbjct: 413 LRKSRIAKRLREPTDDE---RNLYFKAR-LLLKEIMLSKTDQPLKLSNHTSFPIVQVNYN 468

Query: 756 HSEPVVGLVPARDGK 770
            + PVV   P +  K
Sbjct: 469 GTIPVVRTQPVKKKK 483

>ADL218C [1523] [Homologous to ScYNL035C - SH] (319676..320887)
           [1212 bp, 403 aa]
          Length = 403

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 203 IQQHSFGVANLKFHPSDSRVFMSLGQINDGFLHVWRL-TSTNVVLLGTNKNISSVTDVLW 261
           +  H   V ++KFHP+DS + +S     DG+++V+ L  S     L    N +S+    W
Sbjct: 143 VDSHHDDVTDVKFHPTDSNLLLS--GSTDGYVNVYDLKQSEEDEALHQVINFASIHSCGW 200

Query: 262 CNSKFITYGVRHLKEWRI 279
            + K I + + H++ + I
Sbjct: 201 LSPKRI-WSLSHMETFAI 217

>Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement
          Length = 509

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/68 (22%), Positives = 33/68 (48%)

Query: 724 NCKQEEIMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCIFSW 783
           N   + ++ +S DK LR +          ++GH++ +       D +L+S S +G +  W
Sbjct: 345 NSDNKLLLSASDDKTLRTWRGGNANSSNCFYGHTQSITYADWLDDDRLISTSMDGSVRVW 404

Query: 784 APQSDQLL 791
           + + + L+
Sbjct: 405 SVKQNALV 412

>Scas_713.50
          Length = 983

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 65/148 (43%), Gaps = 19/148 (12%)

Query: 639 ASADRSITKYRFEYTDDDLLIYKEKILSIKSAPINIHLFDDRFL-ISTNDKQLLIYDKAL 697
            ++D+ + K    +  D  L   + ILS++ +P      +D+FL +S  D  + ++   L
Sbjct: 549 GTSDKFVPKLGLHH--DTTLELSDDILSVRVSP------EDKFLAVSLLDNTVKVF--FL 598

Query: 698 EKSRYLKLLSDTDDPVIIDNLYLNLRNCKQEEIMCSSADKVLRCYNFTTGKLMKQYFGHS 757
           +  ++   L     PV+  ++  +      + I+ SSADK ++ +    G   K  F H 
Sbjct: 599 DSMKFFLSLYGHKLPVLSIDISFD-----SKMIITSSADKNIKIWGLDFGDCHKSLFAHQ 653

Query: 758 EPV--VGLVPARDGKLLSISSNGCIFSW 783
           + +  V  VP       S S +G I  W
Sbjct: 654 DSIMNVKFVP-ESHNFFSCSKDGIIKYW 680

>CAGL0B02013g 184252..187614 highly similar to tr|Q03897
           Saccharomyces cerevisiae YDR128w, start by similarity
          Length = 1120

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 2/77 (2%)

Query: 185 RILVYSLAPDSNDFPVFVIQQHSFGVANLKFHPSDSRVFMSLGQINDGFLHVWRLTSTNV 244
           + L+++LA  S D    V+  HS  + ++ F+     +  +     D ++H W L ST+ 
Sbjct: 92  KALIWNLARPSTDAIEHVLHSHSRAITDINFNFQHPDILATCSI--DTYVHAWDLRSTSR 149

Query: 245 VLLGTNKNISSVTDVLW 261
               T+   S  + V W
Sbjct: 150 PFYTTSAWRSGASQVKW 166

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 13/63 (20%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 728 EEIMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKL-LSISSNGCIFSWAPQ 786
           ++++ + AD +++ ++ +TG+ ++    H+  +  L  A DG+L ++  ++G    W   
Sbjct: 585 KQLVSTGADGLVKIWDCSTGECVRTLDAHNNRIWALAVANDGQLIITADADGVFQFWEDN 644

Query: 787 SDQ 789
           S++
Sbjct: 645 SEE 647

>AER110W [2615] [Homologous to ScYLR425W (TUS1) - SH]
           complement(842596..846513) [3918 bp, 1305 aa]
          Length = 1305

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 47/92 (51%), Gaps = 15/92 (16%)

Query: 658 LIYKEKILSIKSAPINIHLFDDRFLISTNDKQLLIYDKALEKSRYLKLLSDTDDPVIIDN 717
           ++YK++ L +   P+ I L D+ FLI+       I  K  EK   L     T+ P+ +D 
Sbjct: 727 VVYKKRELWLDPVPVYIVLLDNYFLITE------IVTKGNEKKYKL-----TERPIPLD- 774

Query: 718 LYLNLRNCKQEEIMCSSADKVLRCYNFTTGKL 749
            YL+L   ++E++  +SA+K +   N  +  +
Sbjct: 775 -YLSLE--RKEDLKANSAEKEVTLMNVNSNNI 803

>Sklu_2365.2 YPL051W, Contig c2365 827-1420 reverse complement
          Length = 197

 Score = 29.6 bits (65), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 45/107 (42%), Gaps = 7/107 (6%)

Query: 714 IIDNLYLNLRNCKQEEIMCSSADKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLS 773
           ++  LY N    KQ  I+    D   +     T  L K+Y  HS+P+  + P     + +
Sbjct: 4   LVKGLYNNWNRKKQFSILILGLDNAGKTTFLET--LKKEYSLHSKPLEKITPTVGQNVAT 61

Query: 774 ISSNGCIFS-WAPQSDQLLEQ--RQFFIPLTGI--SVNSTLRESLDE 815
           I    C+   W     + L     +++    GI   V+ST R+ LDE
Sbjct: 62  IPVQDCVLKFWDVGGQETLRSLWAEYYSQAHGIIFVVDSTDRDRLDE 108

>KLLA0D03344g 279652..281364 similar to sp|P32891 Saccharomyces
           cerevisiae YDL174c DLD1 D-lactate ferricytochrome C
           oxidoreductase (D-LCR), start by similarity
          Length = 570

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 48/100 (48%), Gaps = 12/100 (12%)

Query: 657 LLIYKEKILSIKSAPINIHLFDDRFLISTNDKQ---LLIYDKALEK-SRYLKLLSDTDDP 712
           LLI +E+ LS K   ++ H F++  L    D +   +++Y +  E  S+ +KL  +   P
Sbjct: 89  LLIVQEQDLSFKKGDLDDHSFNNYTLHKPKDNERPYVIVYPRDTEHISQIMKLCYEFGVP 148

Query: 713 VI-------IDNLYLNLRNCKQE-EIMCSSADKVLRCYNF 744
           VI       I+  +++ RN   + E +C   D V    +F
Sbjct: 149 VIPFAGGTSIEGQFISTRNINSDKECICEHQDTVTVMLDF 188

>Sklu_1880.3 YDR364C, Contig c1880 4293-5708
          Length = 471

 Score = 30.0 bits (66), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 28/60 (46%), Gaps = 2/60 (3%)

Query: 200 VFVIQQHSFGVANLKFHPSDSRVFMSLGQINDGFLHVWRLTSTNVVLLGTNKNISSVTDV 259
           ++  + H  G   LKF P    +F+S G  ND  +++W +     +L     +  +V D+
Sbjct: 171 IYTFKGHVNGTTKLKFLPETGHLFLSGG--NDNVINIWDMYHERTLLRDYRGHRKAVRDI 228

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,952,731
Number of extensions: 1314013
Number of successful extensions: 4032
Number of sequences better than 10.0: 73
Number of HSP's gapped: 4129
Number of HSP's successfully gapped: 79
Length of query: 937
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 826
Effective length of database: 12,753,511
Effective search space: 10534400086
Effective search space used: 10534400086
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)