Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR084C29328815710.0
Sklu_1159.12822729861e-135
KLLA0F16016g2832769741e-133
Scas_699.442822779211e-125
Kwal_55.215822842759181e-125
YOR040W (GLO4)2852789011e-122
CAGL0I00924g2742698491e-114
YDR272W (GLO2)2742718431e-114
Kwal_47.1755425533634.3
ADR414C78436644.4
KLLA0A10197g26966635.1
YOL164W64654627.1
Sklu_2330.2809127627.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR084C
         (288 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR084C [1131] [Homologous to ScYOR040W (GLO4) - SH; ScYDR272W (...   609   0.0  
Sklu_1159.1 YOR040W, Contig c1159 273-1121                            384   e-135
KLLA0F16016g complement(1486406..1487257) similar to sp|Q12320 S...   379   e-133
Scas_699.44                                                           359   e-125
Kwal_55.21582                                                         358   e-125
YOR040W (GLO4) [4852] chr15 (407063..407920) Glyoxalase-II [858 ...   351   e-122
CAGL0I00924g complement(75399..76223) similar to sp|Q05584 Sacch...   331   e-114
YDR272W (GLO2) [1103] chr4 (1009002..1009826) Glyoxalase-II [825...   329   e-114
Kwal_47.17554                                                          29   4.3  
ADR414C [2154] [Homologous to ScYAL056W (KRH1) - SH; ScYOR371C (...    29   4.4  
KLLA0A10197g complement(895418..896227) similar to sp|Q04868 Sac...    29   5.1  
YOL164W (YOL164W) [4661] chr15 (6175..8115) Member of the metall...    28   7.1  
Sklu_2330.2 YML076C, Contig c2330 2931-5360                            28   7.9  

>ACR084C [1131] [Homologous to ScYOR040W (GLO4) - SH; ScYDR272W
           (GLO2) - SH] (507338..508219) [882 bp, 293 aa]
          Length = 293

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/288 (100%), Positives = 288/288 (100%)

Query: 1   MCPACCKAHRSSSFMYRQLRKMHVKAIKMRWLTGGVNYSYLVSTQDKKASWLIDPAEALE 60
           MCPACCKAHRSSSFMYRQLRKMHVKAIKMRWLTGGVNYSYLVSTQDKKASWLIDPAEALE
Sbjct: 1   MCPACCKAHRSSSFMYRQLRKMHVKAIKMRWLTGGVNYSYLVSTQDKKASWLIDPAEALE 60

Query: 61  VLPALSHDEKQSIRAIVNTHHHYDHAGGNLAIRAALKREGVAVPVIAGSTTSPVSTDIPE 120
           VLPALSHDEKQSIRAIVNTHHHYDHAGGNLAIRAALKREGVAVPVIAGSTTSPVSTDIPE
Sbjct: 61  VLPALSHDEKQSIRAIVNTHHHYDHAGGNLAIRAALKREGVAVPVIAGSTTSPVSTDIPE 120

Query: 121 HLQKYTLGDSVEVLCIRTPCHTQDSICYFMRDTKTGQQALFTGDTLFTAGCGRFFEGTAE 180
           HLQKYTLGDSVEVLCIRTPCHTQDSICYFMRDTKTGQQALFTGDTLFTAGCGRFFEGTAE
Sbjct: 121 HLQKYTLGDSVEVLCIRTPCHTQDSICYFMRDTKTGQQALFTGDTLFTAGCGRFFEGTAE 180

Query: 181 EMDAALNSRLLEHVQDHAATKVYPGHEYTKGNVHFIRSAIYMSEGDNPAFDRLESFANAN 240
           EMDAALNSRLLEHVQDHAATKVYPGHEYTKGNVHFIRSAIYMSEGDNPAFDRLESFANAN
Sbjct: 181 EMDAALNSRLLEHVQDHAATKVYPGHEYTKGNVHFIRSAIYMSEGDNPAFDRLESFANAN 240

Query: 241 AVTTGQFTLQDETEYNPFMRLDDPTIRRRVGDLHRTWARADVMAKLRS 288
           AVTTGQFTLQDETEYNPFMRLDDPTIRRRVGDLHRTWARADVMAKLRS
Sbjct: 241 AVTTGQFTLQDETEYNPFMRLDDPTIRRRVGDLHRTWARADVMAKLRS 288

>Sklu_1159.1 YOR040W, Contig c1159 273-1121
          Length = 282

 Score =  384 bits (986), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 182/272 (66%), Positives = 217/272 (79%), Gaps = 4/272 (1%)

Query: 19  LRKMHVKAIKMRWLTGGVNYSYLVSTQDKKASWLIDPAEALEVLPALSHDEKQSIRAIVN 78
           +R MHVKAIKMRWLTGGVNYSYL+STQDK  SWLIDPAE LEVLP L+  E  SI A+VN
Sbjct: 6   IRSMHVKAIKMRWLTGGVNYSYLLSTQDKTKSWLIDPAEPLEVLPKLTDKEIGSIEAVVN 65

Query: 79  THHHYDHAGGNLAIRAALKREGV-AVPVIAGSTTSPVSTDIPEHLQKYTLGDSVEVLCIR 137
           THHHYDH+GGN+ + AALK+ G  AV VI GS TSP +T++P+ LQKY LGD +EVLCIR
Sbjct: 66  THHHYDHSGGNIPVIAALKKAGQNAVSVICGSHTSPGATEVPQDLQKYKLGD-LEVLCIR 124

Query: 138 TPCHTQDSICYFMRDTKTGQQALFTGDTLFTAGCGRFFEGTAEEMDAALNSRLLEHV--Q 195
           TPCHTQDS+CYF++D  TG++ +FTGDTLFTAGCGRFFEGT EEMD ALN  LLEH   +
Sbjct: 125 TPCHTQDSVCYFVKDFDTGERCIFTGDTLFTAGCGRFFEGTGEEMDRALNRNLLEHTGEE 184

Query: 196 DHAATKVYPGHEYTKGNVHFIRSAIYMSEGDNPAFDRLESFANANAVTTGQFTLQDETEY 255
           + + TKVYPGHEYTK NV F+R+AIY + G+N AFD+LE F + N VTTG FTL+DE ++
Sbjct: 185 NWSTTKVYPGHEYTKSNVEFVRAAIYKTPGENKAFDKLEHFCDKNEVTTGCFTLKDELDF 244

Query: 256 NPFMRLDDPTIRRRVGDLHRTWARADVMAKLR 287
           NPFMRL+ P +R+ VGD    W +A VM KLR
Sbjct: 245 NPFMRLNCPMVRKSVGDAQGAWPKARVMDKLR 276

>KLLA0F16016g complement(1486406..1487257) similar to sp|Q12320
           Saccharomyces cerevisiae YOR040w GLO4 glyoxalase II
           (hydroxyacylglutathione hydrolase), start by similarity
          Length = 283

 Score =  379 bits (974), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 179/276 (64%), Positives = 216/276 (78%), Gaps = 5/276 (1%)

Query: 17  RQLRKMHVKAIKMRWLTGGVNYSYLVSTQDKKASWLIDPAEALEVLPALSHDEKQSIRAI 76
           + +RKMHVKAIKMRWLTGGVNYSYL+STQDKK SWLIDPAE LEV+  L  DE +SI A+
Sbjct: 4   QSIRKMHVKAIKMRWLTGGVNYSYLLSTQDKKKSWLIDPAETLEVMNDLGSDEAKSIEAL 63

Query: 77  VNTHHHYDHAGGNLAIRAALKREGVAVP-VIAGSTTSPVSTDIPEHLQKYTLGDSVEVLC 135
           VNTHHHYDHAGGN++  AAL  +G  +  VIAGS  SP++ DIP++L +YTLG+ +++LC
Sbjct: 64  VNTHHHYDHAGGNVSTLAALNEKGNNISRVIAGSQRSPIANDIPDNLHEYTLGN-LKILC 122

Query: 136 IRTPCHTQDSICYFMRDTKTGQQALFTGDTLFTAGCGRFFEGTAEEMDAALNSRLLEHVQ 195
           IRTPCHTQDS CY++RD +T +QA+FTGDTLFT GCGRFFEGTAEEMD ALN RLL +  
Sbjct: 123 IRTPCHTQDSTCYYVRDPETKEQAIFTGDTLFTGGCGRFFEGTAEEMDDALNFRLLGNTG 182

Query: 196 DHA---ATKVYPGHEYTKGNVHFIRSAIYMSEGDNPAFDRLESFANANAVTTGQFTLQDE 252
           D +     KVYPGHEYT GNV FIR+ IY+ + DN  F++LESF   + VTTG FT+ DE
Sbjct: 183 DTSNWKNVKVYPGHEYTAGNVSFIRNYIYLKKSDNDHFNKLESFTKEHEVTTGHFTIADE 242

Query: 253 TEYNPFMRLDDPTIRRRVGDLHRTWARADVMAKLRS 288
             +NPFMRLDDP +RR+VGD    W RA VM KLR+
Sbjct: 243 LSFNPFMRLDDPIVRRQVGDSQGCWTRAQVMDKLRN 278

>Scas_699.44
          Length = 282

 Score =  359 bits (921), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 168/277 (60%), Positives = 210/277 (75%), Gaps = 5/277 (1%)

Query: 15  MYRQLRKMHVKAIKMRWLTGGVNYSYLVSTQDKKASWLIDPAEALEVLPALSHDEKQSIR 74
           M RQ+ KM+VK IKMRW TGGVNYSYL+S+QDK+ SWLIDPAE+ EV+P L   E+ +IR
Sbjct: 1   MLRQVGKMYVKPIKMRWSTGGVNYSYLLSSQDKEHSWLIDPAESDEVIPHLDPQERLNIR 60

Query: 75  AIVNTHHHYDHAGGNLAIRAALKREGVA--VPVIAGSTTSPVSTDIPEHLQKYTLGDSVE 132
           AIVNTHHHYDH+ GN+++   LK++G    V +IAGS +SP  ++IP HLQKY LG+ +E
Sbjct: 61  AIVNTHHHYDHSDGNISMINELKQDGNQHIVKIIAGSKSSPGVSEIPTHLQKYQLGN-LE 119

Query: 133 VLCIRTPCHTQDSICYFMRDTKTGQQALFTGDTLFTAGCGRFFEGTAEEMDAALNSRLLE 192
           V+C+RTPCHTQDSICY+++D+ T +Q LFTGDTLFT GCGRFFEG  +EMD ALN  +LE
Sbjct: 120 VVCLRTPCHTQDSICYYVKDSDTNEQCLFTGDTLFTGGCGRFFEGNGQEMDQALNKTILE 179

Query: 193 HV--QDHAATKVYPGHEYTKGNVHFIRSAIYMSEGDNPAFDRLESFANANAVTTGQFTLQ 250
            V   +   T+VYPGHEYTK NV FIR  +Y   GDN A D+LE F  ++ VTTG+FTL 
Sbjct: 180 GVGEPNWNMTRVYPGHEYTKDNVKFIRKFVYQELGDNEALDKLEKFCKSHEVTTGEFTLD 239

Query: 251 DETEYNPFMRLDDPTIRRRVGDLHRTWARADVMAKLR 287
           DE ++NPFMRLDDP +R+ VGD    W R+ VM  LR
Sbjct: 240 DELKFNPFMRLDDPIVRKAVGDAEEKWERSKVMETLR 276

>Kwal_55.21582
          Length = 284

 Score =  358 bits (918), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 168/275 (61%), Positives = 211/275 (76%), Gaps = 4/275 (1%)

Query: 16  YRQLRKMHVKAIKMRWLTGGVNYSYLVSTQDKKASWLIDPAEALEVLPALSHDEKQSIRA 75
           + Q R MHVKAIKMRWLTGGVNY YL+STQDK  SWLIDPAE LEV+ AL  +E  +++A
Sbjct: 5   FVQTRSMHVKAIKMRWLTGGVNYCYLLSTQDKTKSWLIDPAEPLEVMTALKAEEANTVQA 64

Query: 76  IVNTHHHYDHAGGNLAIRAALKREGVA-VPVIAGSTTSPVSTDIPEHLQKYTLGDSVEVL 134
           +VNTHHHYDH+GGN AI   L++ GV+ + VI GS TSP +T IP++LQ+Y+LGD +++ 
Sbjct: 65  VVNTHHHYDHSGGNSAIVGELRKMGVSHLDVICGSNTSPGATKIPKNLQEYSLGD-LKIK 123

Query: 135 CIRTPCHTQDSICYFMRDTKTGQQALFTGDTLFTAGCGRFFEGTAEEMDAALNSRLLEHV 194
           CIRTPCHTQDS+CY++ D  TG++ +FTGDTLFTAGCGRFFEGT EEMD ALN  +L+ V
Sbjct: 124 CIRTPCHTQDSVCYYVSDPNTGEKCIFTGDTLFTAGCGRFFEGTGEEMDVALNRSILDGV 183

Query: 195 QDHA--ATKVYPGHEYTKGNVHFIRSAIYMSEGDNPAFDRLESFANANAVTTGQFTLQDE 252
            +     TKVYPGHEYTK NV F+R A+Y + G+N + DRLE   N + VTTG FT+ DE
Sbjct: 184 GEPNWDITKVYPGHEYTKSNVKFVRKAVYKTPGENSSLDRLEHVCNKHDVTTGMFTIHDE 243

Query: 253 TEYNPFMRLDDPTIRRRVGDLHRTWARADVMAKLR 287
             YNPFMRLDDPT+R  + D + + +RA VM +LR
Sbjct: 244 LAYNPFMRLDDPTVRDAIKDSNGSLSRAQVMDQLR 278

>YOR040W (GLO4) [4852] chr15 (407063..407920) Glyoxalase-II [858 bp,
           285 aa]
          Length = 285

 Score =  351 bits (901), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 167/278 (60%), Positives = 209/278 (75%), Gaps = 5/278 (1%)

Query: 14  FMYRQLRKMHVKAIKMRWLTGGVNYSYLVSTQDKKASWLIDPAEALEVLPALSHDEKQSI 73
           F+ +Q+R MHVK IKMRWLTGGVNYSYL+ST+D++ SWLIDPAE LEV P LS +EK+SI
Sbjct: 3   FLLQQIRNMHVKPIKMRWLTGGVNYSYLLSTEDRRNSWLIDPAEPLEVSPKLSAEEKKSI 62

Query: 74  RAIVNTHHHYDHAGGNLAIRAALKRE--GVAVPVIAGSTTSPVSTDIPEHLQKYTLGDSV 131
            AIVNTHHHYDH+GGNLA+ + L +E  G  + +I GS +SP  T++P++LQ+Y LG+ +
Sbjct: 63  DAIVNTHHHYDHSGGNLALYSILCQENSGHDIKIIGGSKSSPGVTEVPDNLQQYHLGN-L 121

Query: 132 EVLCIRTPCHTQDSICYFMRDTKTGQQALFTGDTLFTAGCGRFFEGTAEEMDAALNSRLL 191
            V CIRTPCHT+DSICY+++D +TG+Q +FTGDTLF AGCGRFFEGT  +MD ALN  +L
Sbjct: 122 RVTCIRTPCHTKDSICYYIKDLETGEQCIFTGDTLFIAGCGRFFEGTGRDMDMALNQIML 181

Query: 192 EHV--QDHAATKVYPGHEYTKGNVHFIRSAIYMSEGDNPAFDRLESFANANAVTTGQFTL 249
             V   +    K+YPGHEYTKGNV FIR+ IY   G N  FD LE +  +N  TTG FTL
Sbjct: 182 RAVGETNWNKVKIYPGHEYTKGNVSFIRAKIYSDIGQNKEFDALEQYCKSNECTTGHFTL 241

Query: 250 QDETEYNPFMRLDDPTIRRRVGDLHRTWARADVMAKLR 287
           +DE  YNPFMRLDD  +R  VGD   T+ R+ VM +LR
Sbjct: 242 RDELGYNPFMRLDDRAVRLAVGDTAGTYPRSVVMQELR 279

>CAGL0I00924g complement(75399..76223) similar to sp|Q05584
           Saccharomyces cerevisiae YDR272w GLO2 glyoxalase II,
           start by similarity
          Length = 274

 Score =  331 bits (849), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 162/269 (60%), Positives = 192/269 (71%), Gaps = 4/269 (1%)

Query: 22  MHVKAIKMRWLTGGVNYSYLVSTQDKKASWLIDPAEALEVLPALSHDEKQSIRAIVNTHH 81
           MHVK IKMRW TGGVNYSYLVS QD+  SWLIDPAE  EV P LS  E++S+ A+VNTHH
Sbjct: 1   MHVKPIKMRWHTGGVNYSYLVSNQDQTTSWLIDPAEPHEVWPELSESERESVVALVNTHH 60

Query: 82  HYDHAGGNLAIRAALKRE-GVAVPVIAGSTTSPVSTDIPEHLQKYTLGDSVEVLCIRTPC 140
           HYDHAGGN ++    K   G  + VI GS      T IP H QK  +G+ ++V CIRTPC
Sbjct: 61  HYDHAGGNTSLLKQFKETVGKPLQVIGGSEECDNVTLIPTHSQKLKIGN-LDVTCIRTPC 119

Query: 141 HTQDSICYFMRDTKTGQQALFTGDTLFTAGCGRFFEGTAEEMDAALNSRLLEHV--QDHA 198
           HTQDS+CY++RD +T ++ +FTGDTLFTAGCGRFFEGT EEMDAALN  +LE V   + +
Sbjct: 120 HTQDSVCYYIRDPETDERCIFTGDTLFTAGCGRFFEGTGEEMDAALNKYILEGVGKNNWS 179

Query: 199 ATKVYPGHEYTKGNVHFIRSAIYMSEGDNPAFDRLESFANANAVTTGQFTLQDETEYNPF 258
           +T VYPGHEYTK NV F+RS IY +   N  FD LE F N + VTTG+FTL DE  +NPF
Sbjct: 180 STLVYPGHEYTKSNVKFVRSKIYPTTNVNSRFDELERFCNEHEVTTGKFTLADELLFNPF 239

Query: 259 MRLDDPTIRRRVGDLHRTWARADVMAKLR 287
           M+LDDP +R  VGD    W  A VM KLR
Sbjct: 240 MKLDDPIVRAAVGDSENQWTSAAVMDKLR 268

>YDR272W (GLO2) [1103] chr4 (1009002..1009826) Glyoxalase-II [825
           bp, 274 aa]
          Length = 274

 Score =  329 bits (843), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 159/271 (58%), Positives = 196/271 (72%), Gaps = 6/271 (2%)

Query: 22  MHVKAIKMRWLTGGVNYSYLVSTQDKKASWLIDPAEALEVLPALSHDEKQSIRAIVNTHH 81
           M VK+IKMRW +GGVNY YL+S    K SWLIDPAE  EVLP L+ DEK S+ AIVNTHH
Sbjct: 1   MQVKSIKMRWESGGVNYCYLLSDSKNKKSWLIDPAEPPEVLPELTEDEKISVEAIVNTHH 60

Query: 82  HYDHAGGNLAIRAALKREG--VAVPVIAGSTTSPVSTDIPEHLQKYTLGDSVEVLCIRTP 139
           HYDHA GN  I   LK +     V VI GS   P  T IPE+L+K  LGD +E+ CIRTP
Sbjct: 61  HYDHADGNADILKYLKEKNPTSKVEVIGGSKDCPKVTIIPENLKKLHLGD-LEITCIRTP 119

Query: 140 CHTQDSICYFMRDTKTGQQALFTGDTLFTAGCGRFFEGTAEEMDAALNSRLLEHV--QDH 197
           CHT+DSICY+++D  T ++ +FTGDTLFTAGCGRFFEGT EEMD ALN+ +LE V  Q+ 
Sbjct: 120 CHTRDSICYYVKDPTTDERCIFTGDTLFTAGCGRFFEGTGEEMDIALNNSILETVGRQNW 179

Query: 198 AATKVYPGHEYTKGNVHFIRSAIYMSEGDNPAFDRLESFANANAVTTGQFTLQDETEYNP 257
           + T+VYPGHEYT  NV F+R  IY   G+N A D LE F + + VT G+FTL+DE E+NP
Sbjct: 180 SKTRVYPGHEYTSDNVKFVRK-IYPQVGENKALDELEQFCSKHEVTAGRFTLKDEVEFNP 238

Query: 258 FMRLDDPTIRRRVGDLHRTWARADVMAKLRS 288
           FMRL+DP +++  GD + +W RA +M KLR+
Sbjct: 239 FMRLEDPKVQKAAGDTNNSWDRAQIMDKLRA 269

>Kwal_47.17554
          Length = 255

 Score = 28.9 bits (63), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 18/33 (54%)

Query: 160 LFTGDTLFTAGCGRFFEGTAEEMDAALNSRLLE 192
           +F G T F A  G F E   EE DA L ++ L+
Sbjct: 219 VFKGLTKFNAAYGEFLESIREEADAHLKTKELD 251

>ADR414C [2154] [Homologous to ScYAL056W (KRH1) - SH; ScYOR371C
           (KRH2) - SH] (1450333..1452687) [2355 bp, 784 aa]
          Length = 784

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 1   MCPACCKAHRSSSFMYRQLRKMHVKAIKMR-WLTGG 35
           + P  C AHR S+  Y  L  + V AI+ + WL GG
Sbjct: 716 ISPLDCSAHRDSTQHYTHLLSVSVLAIRGQLWLVGG 751

>KLLA0A10197g complement(895418..896227) similar to sp|Q04868
           Saccharomyces cerevisiae YMR312w subunit of RNA
           polymerase II elongator complex singleton, start by
           similarity
          Length = 269

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 4/66 (6%)

Query: 105 VIAGSTTSPVSTDIPEHLQKYTLGDSVEVLCIRTPCHTQDSICYFMRDTKTGQQALFTGD 164
           +I  ++      D PEHL K    D+VE +   T C  +  +   +R   TG+    TG 
Sbjct: 178 LIVVNSVESFDNDFPEHLGK----DTVEFVRFTTSCFHKSFLVLSVRPLDTGKAKDVTGT 233

Query: 165 TLFTAG 170
              T G
Sbjct: 234 LAITRG 239

>YOL164W (YOL164W) [4661] chr15 (6175..8115) Member of the
           metallo-beta-lactamase family [1941 bp, 646 aa]
          Length = 646

 Score = 28.5 bits (62), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 67  HDEKQSIRAIVNTHHHYDHAGGNLAI--RAALKREGVAVPVIAGSTTSPVSTDI 118
           H  ++ +R ++ TH H DH GG   I   A +K   V +    G   S V+ +I
Sbjct: 149 HRPQKPVRTVIYTHSHSDHYGGVKGIVKEADVKSGEVQIIAPVGFMESVVAENI 202

>Sklu_2330.2 YML076C, Contig c2330 2931-5360
          Length = 809

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 45/127 (35%), Gaps = 19/127 (14%)

Query: 151 RDTKTGQQALFTGDTLFTAGCGRFFEGTAEEMDAALNSRLLEHVQDHA------------ 198
            D K G  +L   D + +AG G     TA   D  +NS   E++Q +             
Sbjct: 681 EDLKNGSNSL-KNDMIASAGSGPALSSTAYHQDRKINSYNNENIQSNVIGETTTNIIANP 739

Query: 199 ------ATKVYPGHEYTKGNVHFIRSAIYMSEGDNPAFDRLESFANANAVTTGQFTLQDE 252
                 A+ +  G          I S +  S    P+ D     A+ N++  G   L DE
Sbjct: 740 ILHPLLASDLLQGQPPIMSYQSGIPSNVRPSNNTTPSEDMTNYLADINSLEFGYNALNDE 799

Query: 253 TEYNPFM 259
              + FM
Sbjct: 800 FWTDVFM 806

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.133    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,165,566
Number of extensions: 367407
Number of successful extensions: 940
Number of sequences better than 10.0: 16
Number of HSP's gapped: 918
Number of HSP's successfully gapped: 16
Length of query: 288
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 187
Effective length of database: 13,099,691
Effective search space: 2449642217
Effective search space used: 2449642217
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)