Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR083C37536816670.0
YOR042W (CUE5)4113223582e-38
Kwal_55.215874644043373e-35
KLLA0F15994g4272383223e-33
CAGL0L09933g4083452898e-29
Scas_699.454503412713e-26
YDR273W (DON1)365421421e-09
Scas_615.8d581591048e-05
CAGL0M08580g19754937e-04
Sklu_2397.5435134629.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR083C
         (368 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR083C [1130] [Homologous to ScYOR042W - SH; ScYDR273W (DON1) -...   646   0.0  
YOR042W (CUE5) [4853] chr15 (408424..409659) Protein containing ...   142   2e-38
Kwal_55.21587                                                         134   3e-35
KLLA0F15994g complement(1484383..1485666) weakly similar to sgd|...   128   3e-33
CAGL0L09933g 1067488..1068714 similar to tr|Q08412 Saccharomyces...   115   8e-29
Scas_699.45                                                           108   3e-26
YDR273W (DON1) [1104] chr4 (1010168..1011265) Component of the p...    59   1e-09
Scas_615.8d                                                            45   8e-05
CAGL0M08580g complement(855443..856036) weakly similar to tr|Q08...    40   7e-04
Sklu_2397.5 YML097C, Contig c2397 5882-7189                            28   9.2  

>ACR083C [1130] [Homologous to ScYOR042W - SH; ScYDR273W (DON1) -
           SH] (505794..506921) [1128 bp, 375 aa]
          Length = 375

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/368 (89%), Positives = 328/368 (89%)

Query: 1   MVVVENVPDTTLSKATDADGAKNSGRELQSASSASTKIEDGPKEAPAKPVLPSEDQGATT 60
           MVVVENVPDTTLSKATDADGAKNSGRELQSASSASTKIEDGPKEAPAKPVLPSEDQGATT
Sbjct: 1   MVVVENVPDTTLSKATDADGAKNSGRELQSASSASTKIEDGPKEAPAKPVLPSEDQGATT 60

Query: 61  GSDGDAKASEDPAANSEARTGQKLQSQPSAEREQTLPKENSILSELKAAFPNVEEKIVKA 120
           GSDGDAKASEDPAANSEARTGQKLQSQPSAEREQTLPKENSILSELKAAFPNVEEKIVKA
Sbjct: 61  GSDGDAKASEDPAANSEARTGQKLQSQPSAEREQTLPKENSILSELKAAFPNVEEKIVKA 120

Query: 121 VIIASQGILDPAFSALLFLSDPTFEEEXXXXXXXXXXXXXXVPISQLQQDEMLARQLDEQ 180
           VIIASQGILDPAFSALLFLSDPTFEEE              VPISQLQQDEMLARQLDEQ
Sbjct: 121 VIIASQGILDPAFSALLFLSDPTFEEEAALPTQAAPAAQATVPISQLQQDEMLARQLDEQ 180

Query: 181 FNKKDLXXXXXXXXXXXXXXXXXXXXXXXXXXSEYGGYGSEDDEDFIDVLNRGLQETSKK 240
           FNKKDL                          SEYGGYGSEDDEDFIDVLNRGLQETSKK
Sbjct: 181 FNKKDLRAERAARERRIREREEEFQRKQQRLRSEYGGYGSEDDEDFIDVLNRGLQETSKK 240

Query: 241 VGKWWDGIKKNFNEELDGPDARASAGPPRARQQRFNSFGARDDETYPTEQQLRGVSLHDE 300
           VGKWWDGIKKNFNEELDGPDARASAGPPRARQQRFNSFGARDDETYPTEQQLRGVSLHDE
Sbjct: 241 VGKWWDGIKKNFNEELDGPDARASAGPPRARQQRFNSFGARDDETYPTEQQLRGVSLHDE 300

Query: 301 HDDEPAPRLPPRRTSTGPLPARPDGPNVERKRWQPLPPEPVSAPTKVTAGGRNHAQNKKR 360
           HDDEPAPRLPPRRTSTGPLPARPDGPNVERKRWQPLPPEPVSAPTKVTAGGRNHAQNKKR
Sbjct: 301 HDDEPAPRLPPRRTSTGPLPARPDGPNVERKRWQPLPPEPVSAPTKVTAGGRNHAQNKKR 360

Query: 361 DPDQDDYL 368
           DPDQDDYL
Sbjct: 361 DPDQDDYL 368

>YOR042W (CUE5) [4853] chr15 (408424..409659) Protein containing a
           CUE domain, has low similarity to uncharacterized C.
           albicans Orf6.1738p [1236 bp, 411 aa]
          Length = 411

 Score =  142 bits (358), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 116/322 (36%), Positives = 154/322 (47%), Gaps = 65/322 (20%)

Query: 98  KENSILSELKAAFPNVEEKIVKAVIIASQGILDPAFSALLFLSDPTFEEEXXXXXXXXXX 157
           KEN IL ELK AFPN+EEK +KAVIIASQG+L PAF+ALLFLSDP    E          
Sbjct: 97  KENPILQELKDAFPNLEEKYIKAVIIASQGVLSPAFNALLFLSDP----ESGKDIELPTQ 152

Query: 158 XXXXVP-------ISQLQQDEMLARQLDEQFN---------KKDLXXXXXXXXXXXXXXX 201
                P        +QL+QDE+LARQLDEQFN          +                 
Sbjct: 153 PVRKNPEAPARRRQTQLEQDELLARQLDEQFNSSHSRRRNRDRATRSMHEQRRRRHNPNE 212

Query: 202 XXXXXXXXXXXSEYGGYGSEDDEDFIDVLNRGLQETSKKVGKWW-DGIKKNF---NEELD 257
                        +  +  +D  +  D   R LQ+T+ KV  W  D  ++NF   NE+ D
Sbjct: 213 REQHHEDSEEEDSWSQFVEKDLPELTDRAGRSLQDTANKVSNWISDAYRRNFASGNEQND 272

Query: 258 GPDAR-----------------ASAGPPRARQQRFNSFGAR--DDETYPTEQQLRGVSLH 298
                                  ++ P +  ++RFNSFG +  DD       +  G++LH
Sbjct: 273 NQHGHQDQQEWEPEIVDLSQGGKNSRPQQPERRRFNSFGVQVGDDSL-----ESHGITLH 327

Query: 299 DE---HDDEPAPRLPPRRT----STGPLPARP---DGPNVE-RKRWQPLPPEPV-SAPTK 346
           +E    DDE  P   P RT    STG + A     D P+ E +K+WQPLPPEP+ + PTK
Sbjct: 328 NEDGFEDDEDVPPQLPTRTKSGESTGKVVAETTYIDTPDTETKKKWQPLPPEPLDTTPTK 387

Query: 347 VTAGGRNHAQNKKRDPDQDDYL 368
           V A  RN     K++PD+D++L
Sbjct: 388 VNAVSRN-----KKNPDEDEFL 404

>Kwal_55.21587
          Length = 464

 Score =  134 bits (337), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 124/404 (30%), Positives = 167/404 (41%), Gaps = 83/404 (20%)

Query: 42  PKEAPAKPVLPSEDQGATTGSDGDAKASEDPAANSEARTGQKLQSQPSAEREQTLPKENS 101
           PKE P KP   +E + AT  ++      E P A ++      L   P  +       EN 
Sbjct: 60  PKETPDKPQEETE-KSATEANEPQENTKEAPVAPNDEEVRPAL---PKRKTSTQNVHENP 115

Query: 102 ILSELKAAFPNVEEKIVKAVIIASQGILDPAFSALLFLSDPTFEEEXXX-----XXXXXX 156
           IL++L  AFP ++ K VKAV+IASQG LDPAF+ALLFLSDP+FE E              
Sbjct: 116 ILAQLTEAFPGIDAKYVKAVLIASQGALDPAFNALLFLSDPSFEAEATVPTAVPQSSQSG 175

Query: 157 XXXXXVPISQLQQDEMLARQLDEQFNKKDLXXXXXXXXXXXXXXXXXXXXXXXXXXSEYG 216
                  +SQLQQDE+LARQLD QFNK                                 
Sbjct: 176 NSRSPTAVSQLQQDEILARQLDAQFNKGHARRGAPRSMDDERRARERRIRERQREFERRT 235

Query: 217 GYGS------------------EDDEDFIDVL------------NRGLQETSKKVGKWWD 246
            +G+                  ++D DF+  L             R +QET +KV  W  
Sbjct: 236 AHGAGPLSPEEQRRYERMEAEDQEDNDFLSQLVDKDLPELREKVGRQVQETGRKVNDWLS 295

Query: 247 GIKKNFNEELDGPDARAS---------------------------AGPPRARQQRFNSFG 279
           G +KN+ ++       +                               P  R  RFNSFG
Sbjct: 296 GFRKNWAQDQSSQQQSSQYPEFSDRQQSQRRDTSSRRSSDSEFEDYTRPEHRTARFNSFG 355

Query: 280 AR---DDETYPTEQQLRGVSLH--------DEHDDEPAPRLPPRRTS--TGPLPARPDGP 326
           A+   D  T   +    G+SL+        DE D + AP+LP R  +    P     D P
Sbjct: 356 AKVGDDSTTSSAKLASHGISLYNKGDKDVEDESDADIAPQLPSRNKAKDIQPETTYIDTP 415

Query: 327 NV-ERKRWQPLPPEPVSA-PTKVTAGGRNHAQNKKRDPDQDDYL 368
               RK+WQPLPPEP++  P+KV A    + +N   D + DD+L
Sbjct: 416 EAGTRKKWQPLPPEPINVTPSKVNATASKNKRNS--DVNDDDFL 457

>KLLA0F15994g complement(1484383..1485666) weakly similar to
           sgd|S0005568 Saccharomyces cerevisiae YOR042w, start by
           similarity
          Length = 427

 Score =  128 bits (322), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 117/238 (49%), Gaps = 46/238 (19%)

Query: 98  KENSILSELKAAFPNVEEKIVKAVIIASQGILDPAFSALLFLSDPTFEEEXXXXXXXXXX 157
           KEN +L +LK AFPN+EEK VKAV+IASQG LDPAF+ALLF+SDP FE+E          
Sbjct: 90  KENPMLKQLKEAFPNIEEKYVKAVLIASQGQLDPAFNALLFISDPDFEKEAPLPTRPVQA 149

Query: 158 XXXXV---PISQLQQDEMLARQLDEQFNKKDLXXXXXXXXXXXXXXXXXXXXXXXXXXSE 214
               V   P +QL+QDE LARQLD++FNK                               
Sbjct: 150 PTRGVRREPKTQLEQDEELARQLDKKFNKH------GNSASERTARERRIRQRERDYERR 203

Query: 215 YG-------------GYGSEDDE-------DFIDV--------LNRGLQETSKKVGKWWD 246
           YG             GY + +D+       +F+D         LNR +QET KK+  W+ 
Sbjct: 204 YGAGAIPPKGRRDSDGYDNFEDDGEDDVFSNFVDKELPQIRENLNRNIQETGKKISTWFS 263

Query: 247 GIKKNFNEELDGPDARASAGPPRARQQRFNSFGAR-----DDETYPTEQQLRGVSLHD 299
           GI KN  ++    D   S   P+  Q RFNSFG R     D+    T+ Q  G+SLH+
Sbjct: 264 GITKNLVDD----DPNYSESRPKYSQSRFNSFGDRYRDGNDNVDGQTKLQNAGISLHN 317

>CAGL0L09933g 1067488..1068714 similar to tr|Q08412 Saccharomyces
           cerevisiae YOR042w, hypothetical start
          Length = 408

 Score =  115 bits (289), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 110/345 (31%), Positives = 152/345 (44%), Gaps = 94/345 (27%)

Query: 99  ENSILSELKAAFPNVEEKIVKAVIIASQGILDPAFSALLFLSDPTFEEEXXXXXXXXXXX 158
           EN +L +LK AFPN+EE+ VKAVIIASQG LDPAF+ALLFLSDP   ++           
Sbjct: 76  ENPLLLQLKEAFPNIEEQYVKAVIIASQGALDPAFNALLFLSDPESGKDIELPREPVQQN 135

Query: 159 XXXVPI---SQLQQDEMLARQLDEQFNKKDLXXXXXXXXXXXXXXXXXXXXXXXXXXSEY 215
               P    +QL+QDEMLARQLD+++N+K                              Y
Sbjct: 136 PSLPPRRKQTQLEQDEMLARQLDKEYNRK--------------RRGERRHHNEREAGRNY 181

Query: 216 GGYGSED----------DEDFIDVLNRG---LQETSKKVGKWWDGIKKNF---NEELD-- 257
             Y ++D          ++D  ++  R    LQET+ KVG W++G+KKNF    EE D  
Sbjct: 182 ERYNNDDLEEDSWSQFVEKDLPEITARAKGSLQETATKVGTWFNGVKKNFIGEGEENDSA 241

Query: 258 -------GPDARASAGPPRARQQ------------------------RFNSFGARDDETY 286
                  G D     G    +Q+                        RFNSFGA   +  
Sbjct: 242 YYQDDSHGRDLDEDYGTYVEQQERRQRRGVQDPGYRRGDEQRLNARHRFNSFGASATDDV 301

Query: 287 PTEQQLRGVSLHDEHDDEPAPRLPPRRTS---------TGPLPARPDGPNVE-------- 329
                LR     ++ D+E  P+LP R  S           P   + D    E        
Sbjct: 302 EGGISLRDEEFGEDEDEEVPPQLPSRARSNDSKKDSEEVKPQEGKKDKVVAETTYIDTPE 361

Query: 330 -----RKRWQPLPPEPVSA-PTKVTAGGRNHAQNKKRDPDQDDYL 368
                +++WQPLPPEP++A PTKV A  +     K ++  +D++L
Sbjct: 362 NKEKTKRKWQPLPPEPLNATPTKVNASTK-----KNKNESEDEFL 401

>Scas_699.45
          Length = 450

 Score =  108 bits (271), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 106/341 (31%), Positives = 146/341 (42%), Gaps = 79/341 (23%)

Query: 99  ENSILSELKAAFPNVEEKIVKAVIIASQGILDPAFSALLFLSDPTFEEEXXX-XXXXXXX 157
           EN IL +LK AFPN+EEK VK V+IASQG LDPAF ALLFLSDP   ++           
Sbjct: 111 ENPILKQLKEAFPNIEEKYVKTVLIASQGALDPAFEALLFLSDPNSSKDIELPTKPIAAN 170

Query: 158 XXXXVP----ISQLQQDEMLARQLDEQFNK---------KDLXXXXXXXXXXXXXXXXXX 204
               +P    ++QL+QD +LARQL+E++NK         +D                   
Sbjct: 171 ATPALPQRRKLTQLEQDALLARQLNEEYNKAHDPPRGAVRDNGRRTRPQQQRRQRTANDD 230

Query: 205 XXXXXXXXSEYGGYGSEDDEDFIDVLNRGLQETSKKVGKWWD---------------GIK 249
                     +  +  +D  D        LQET+ KVG W+                G+ 
Sbjct: 231 DLDFSQEDDSWAQFVEKDLPDITARAKGSLQETAMKVGSWFSKNVIGEEDPNQPQPQGM- 289

Query: 250 KNFNEELDGPD-------------ARASAGPPRARQQRFNSFGARDDETYPTEQQLRGVS 296
            N N   D  D              +   GP    ++RFNSFGA+  E      +  G++
Sbjct: 290 NNRNGNSDFTDEQIKQQQKEWSYYQKQKKGPENPERRRFNSFGAQVGEDS---LESHGIA 346

Query: 297 LHD-----EHDDEPAPRLPPRRTSTGP--------LPARP-------------DGPNVER 330
           LHD     + D++  P+LP R  S             A P             D P    
Sbjct: 347 LHDNENLSDEDEDVPPQLPTREKSVDSNTQNDETNATATPKDKAKVVAQTTFIDTPEGSA 406

Query: 331 K-RWQPLPPEPVS-APTKVTAGGRNHAQNKKRDPDQD-DYL 368
           K +WQP+ PEP++  PTK+ A G    Q K ++PD+D D+L
Sbjct: 407 KPKWQPVAPEPLNGTPTKINASG----QAKIKNPDEDEDFL 443

>YDR273W (DON1) [1104] chr4 (1010168..1011265) Component of the
           prospore membrane [1098 bp, 365 aa]
          Length = 365

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 23/42 (54%), Positives = 35/42 (83%)

Query: 101 SILSELKAAFPNVEEKIVKAVIIASQGILDPAFSALLFLSDP 142
            +L ELK AFP V++ ++KA++IASQG+L+PAF++LL+ S P
Sbjct: 85  CVLKELKIAFPEVDDTLIKAILIASQGVLEPAFNSLLYYSSP 126

>Scas_615.8d
          Length = 581

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 39/59 (66%), Gaps = 1/59 (1%)

Query: 83  KLQSQPSAEREQTLPKENSILSELKAAFPNVEEKIVKAVIIASQGILDPAFSALLFLSD 141
           K+ S   AE  + L   ++I  EL  AFP+V+  ++K+++ AS+G + PAF ALLFL++
Sbjct: 265 KICSLTLAELSEILDTHSNI-PELAKAFPSVDINVIKSLLFASEGEVLPAFHALLFLTN 322

>CAGL0M08580g complement(855443..856036) weakly similar to tr|Q08412
           Saccharomyces cerevisiae YOR042w, hypothetical start
          Length = 197

 Score = 40.4 bits (93), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 36/54 (66%), Gaps = 5/54 (9%)

Query: 87  QPSAEREQTLPKENSILSELKAAFPNVEEKIVKAVIIASQGILDPAFSALLFLS 140
           Q + E EQ +  E     +L  AFP V++ I++A+++A++G L PAF+ALL L+
Sbjct: 20  QLNTEVEQNVHYE-----KLVKAFPTVDKLIIRAILLAARGDLAPAFNALLSLT 68

>Sklu_2397.5 YML097C, Contig c2397 5882-7189
          Length = 435

 Score = 28.5 bits (62), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 58/134 (43%), Gaps = 30/134 (22%)

Query: 27  ELQSASSASTKIEDGPKEAPAKPVLPSEDQGAT-------------------TGSDGDAK 67
           EL+  S+++ KIE     +P++ +L   D+ A                    TG D  + 
Sbjct: 313 ELKKTSASTKKIEKVHSPSPSQYLLRPLDEAANSMFSKFSELLSSPLNKPSPTGHDTGS- 371

Query: 68  ASEDPAANSEARTGQKLQSQPSAEREQTLPKENSILSELKAAFPNVEEKIVKAVIIASQG 127
            S+D   ++ A   Q+++ +      +TL          +A FP++++ I++ V IA + 
Sbjct: 372 YSDDIDDSTAAALAQRMEREEHKNTSETL----------QAMFPDLDKDIIEDVCIAKKY 421

Query: 128 ILDPAFSALLFLSD 141
            L     ALL L +
Sbjct: 422 RLGVCVDALLALCN 435

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.307    0.128    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,045,644
Number of extensions: 534183
Number of successful extensions: 2141
Number of sequences better than 10.0: 112
Number of HSP's gapped: 2103
Number of HSP's successfully gapped: 128
Length of query: 368
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 265
Effective length of database: 13,030,455
Effective search space: 3453070575
Effective search space used: 3453070575
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 62 (28.5 bits)