Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR082C42241421470.0
Kwal_55.2160044243711771e-160
KLLA0F15972g45844911161e-150
YOR043W (WHI2)48647710281e-137
Scas_699.465125049741e-128
Scas_615.84474448651e-112
Sklu_1533.11921835333e-66
CAGL0L11572g81388711.1
Scas_666.2186420673.0
YBR180W (DTR1)57261655.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR082C
         (414 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR082C [1129] [Homologous to ScYOR043W (WHI2) - SH] (503954..50...   831   0.0  
Kwal_55.21600                                                         457   e-160
KLLA0F15972g complement(1481761..1483137) similar to sp|P12611 S...   434   e-150
YOR043W (WHI2) [4854] chr15 (410869..412329) Protein involved in...   400   e-137
Scas_699.46                                                           379   e-128
Scas_615.8                                                            337   e-112
Sklu_1533.1 YOR043W, Contig c1533 830-1408 reverse complement         209   3e-66
CAGL0L11572g 1234039..1236480 similar to sp|P38814 Saccharomyces...    32   1.1  
Scas_666.21                                                            30   3.0  
YBR180W (DTR1) [364] chr2 (589698..591416) Dityrosine transporte...    30   5.5  

>ACR082C [1129] [Homologous to ScYOR043W (WHI2) - SH]
           (503954..505222) [1269 bp, 422 aa]
          Length = 422

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/414 (96%), Positives = 401/414 (96%)

Query: 1   MSQPQSIITQVSPEQQLGGSQLMTEQIEPDYYDENTLIHLNIQGRHYYITREQLMSLPES 60
           MSQPQSIITQVSPEQQLGGSQLMTEQIEPDYYDENTLIHLNIQGRHYYITREQLMSLPES
Sbjct: 1   MSQPQSIITQVSPEQQLGGSQLMTEQIEPDYYDENTLIHLNIQGRHYYITREQLMSLPES 60

Query: 61  LLLCFFPSGVFMNREGQVITNLTPEDEVYIANFPPKCFESIMETYTTAQRDLENFPVGEF 120
           LLLCFFPSGVFMNREGQVITNLTPEDEVYIANFPPKCFESIMETYTTAQRDLENFPVGEF
Sbjct: 61  LLLCFFPSGVFMNREGQVITNLTPEDEVYIANFPPKCFESIMETYTTAQRDLENFPVGEF 120

Query: 121 GRRAPHAGPKGFLGLTPSQSQPMSESQILHEKPAIIVLREDLDYYCVPSVSLALEDGSRE 180
           GRRAPHAGPKGFLGLTPSQSQPMSESQILHEKPAIIVLREDLDYYCVPSVSLALEDGSRE
Sbjct: 121 GRRAPHAGPKGFLGLTPSQSQPMSESQILHEKPAIIVLREDLDYYCVPSVSLALEDGSRE 180

Query: 181 GQDILLEQLMAQVKNAAGSHLCQQRSVFKGLYSSNRVRRPDAQHQPDQLGPAEQHLMDML 240
           GQDILLEQLMAQVKNAAGSHLCQQRSVFKGLYSSNRVRRPDAQHQPDQLGPAEQHLMDML
Sbjct: 181 GQDILLEQLMAQVKNAAGSHLCQQRSVFKGLYSSNRVRRPDAQHQPDQLGPAEQHLMDML 240

Query: 241 CASGFREHSDWGNRSQEPGKTVISSLSLCRLMNETVQEFRDQVAAARRRYDEDHVTPDAA 300
           CASGFREHSDWGNRSQEPGKTVISSLSLCRLMNETVQEFRDQVAAARRRYDEDHVTPDAA
Sbjct: 241 CASGFREHSDWGNRSQEPGKTVISSLSLCRLMNETVQEFRDQVAAARRRYDEDHVTPDAA 300

Query: 301 SAPPSRDQKRKSRLSTFTDNVXXXXXXXXXXXXXAPREPSLYDLVPRPEINTKLLLFWKK 360
           SAPPSRDQKRKSRLSTFTDNV             APREPSLYDLVPRPEINTKLLLFWKK
Sbjct: 301 SAPPSRDQKRKSRLSTFTDNVRSRSSSRTRSSSRAPREPSLYDLVPRPEINTKLLLFWKK 360

Query: 361 PARKCWWGLETITVDVQLNGHYDSESGTLVLSRNSPLCVLTIPVNLHIRRVWTL 414
           PARKCWWGLETITVDVQLNGHYDSESGTLVLSRNSPLCVLTIPVNLHIRRVWTL
Sbjct: 361 PARKCWWGLETITVDVQLNGHYDSESGTLVLSRNSPLCVLTIPVNLHIRRVWTL 414

>Kwal_55.21600
          Length = 442

 Score =  457 bits (1177), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 247/437 (56%), Positives = 305/437 (69%), Gaps = 31/437 (7%)

Query: 5   QSIITQVSPEQQLGGSQLMTEQIEPDYYDENTLIHLNIQGRHYYITREQLMSLPESLLLC 64
           QS+ITQVS +Q  G   +M EQ + ++ D+++LIHLNIQ  HYYITR+QLMSLPESLLLC
Sbjct: 2   QSVITQVSADQ--GPIPVMQEQNQ-EFLDDDSLIHLNIQENHYYITRDQLMSLPESLLLC 58

Query: 65  FFPSGVFMNREGQVITNLTPEDEVYIANFPPKCFESIMETYTTAQRDLENFPVGEFGRRA 124
            FPSGVFMNR GQVITNLT +DEVYI NFPP CFE IME Y  AQ DL NFPV E   R 
Sbjct: 59  LFPSGVFMNRTGQVITNLTSQDEVYIGNFPPACFEYIMENYVRAQEDLLNFPVDEIFDRG 118

Query: 125 PHAGPKG---FLGLTPSQSQPM----SESQILHEKPAIIVLREDLDYYCVPSVSLAL-ED 176
             + PK    F G   S S        E++ILHEKP+IIVLREDLDYYCVP + LA   D
Sbjct: 119 -LSSPKEQSRFFGFPSSHSSMQNSSGGEAEILHEKPSIIVLREDLDYYCVPQMKLAYPPD 177

Query: 177 GSREGQDILLEQLMAQVKNAAGSHLCQQRSVFKGLYSSNRVRRPDAQHQPD---QLGPAE 233
             +E ++ LL+  MA+VK AAGS+L QQ SVF+GL SSNR++RP      +   +LGPAE
Sbjct: 178 TPQELRNELLDNFMAEVKLAAGSYLSQQTSVFQGLCSSNRLKRPQKNSNGENKQKLGPAE 237

Query: 234 QHLMDMLCASGFREHSDWGNRSQEPGKTVISSLSLCRLMNETVQEFRDQVAAARRRYDED 293
           QHLMDMLC+SGF + S WGNR+QEPGKTVISSLSLCRL NET Q+FRD+V AA+R+++++
Sbjct: 238 QHLMDMLCSSGFHDSSTWGNRAQEPGKTVISSLSLCRLANETTQDFRDKVDAAKRKHEDE 297

Query: 294 ------------HVTPDAASAPPSR--DQKRKSRLSTFTDNV--XXXXXXXXXXXXXAPR 337
                        +TP  + + PS   D KRKSRLS+  DNV                 +
Sbjct: 298 LKSLRGAQDSTYSLTPKGSRSSPSAQPDPKRKSRLSSLADNVRSRSASRNRSSSRQRVDQ 357

Query: 338 EPSLYDLVPRPEINTKLLLFWKKPARKCWWGLETITVDVQLNGHYDSESGTLVLSRNSPL 397
            P+LY+LVPRP+IN+KLLLFWKKPARKCWWG E  +++++L G  DS +G LVL ++ P+
Sbjct: 358 APTLYELVPRPDINSKLLLFWKKPARKCWWGEEDTSLELKLYGELDSSTGELVLRQSGPV 417

Query: 398 CVLTIPVNLHIRRVWTL 414
             L++PV LHIRRVWTL
Sbjct: 418 VSLSVPVKLHIRRVWTL 434

>KLLA0F15972g complement(1481761..1483137) similar to sp|P12611
           Saccharomyces cerevisiae YOR043w WHI2 growth regulation
           protein singleton, start by similarity
          Length = 458

 Score =  434 bits (1116), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 240/449 (53%), Positives = 291/449 (64%), Gaps = 42/449 (9%)

Query: 3   QPQSIITQVSPEQQL--------GGSQLMTEQIEPDYYDENTLIHLNIQGRHYYITREQL 54
           Q QSIITQV+P+            GS +  EQ    Y +E+TLIHLNIQ +HYYITR QL
Sbjct: 7   QTQSIITQVTPDGGGASGALLGQDGSYIDYEQ----YNEEDTLIHLNIQEKHYYITRTQL 62

Query: 55  MSLPESLLLCFFPSGVFMNREGQVITNLTPEDEVYIANFPPKCFESIMETYTTAQRDLEN 114
           MSLPESLLLC FPSGVFM+R+GQ+ITNLTP+DEVYI NF  +CFE IM+ Y  A  D  N
Sbjct: 63  MSLPESLLLCLFPSGVFMDRDGQIITNLTPDDEVYIPNFSTECFEYIMDVYNQAHTDYLN 122

Query: 115 FPVGE-FGRRAPHAGPKGFLGLTPSQSQPMS----ESQILHEKPAIIVLREDLDYYCVPS 169
           FPV E F R+  +    G        S   S    ES+ILHEKP IIVLREDLDYYCVP 
Sbjct: 123 FPVNEIFNRKGTNGSSSGGNNFFNFGSSNNSSSSQESEILHEKPGIIVLREDLDYYCVPQ 182

Query: 170 VSLALEDGSRE-GQDILLEQLMAQVKNAAGSHLCQQRSVFKGLYSSNRVRRPDAQHQPD- 227
           VS+   +GS +  ++ LL  LM Q+K AAGSHL +Q SVF GL SSNR ++P   +Q D 
Sbjct: 183 VSVEYPEGSSDMEKEELLHNLMVQIKLAAGSHLLKQTSVFLGLKSSNRAKKPTKSNQVDG 242

Query: 228 --------QLGPAEQHLMDMLCASGFREHSDWGNRSQEPGKTVISSLSLCRLMNETVQEF 279
                   +LG AEQHLMDMLC+SGF+  S WGNRSQE  KTVISSLSLCRL NET QEF
Sbjct: 243 TKSSTGTVKLGSAEQHLMDMLCSSGFKTESVWGNRSQEMDKTVISSLSLCRLANETTQEF 302

Query: 280 RDQVAAARRRYDEDH------VTPDAAS------APPSRDQKRKSRLSTFTDNV--XXXX 325
           RD VA A+ +YD+D       +T D +S       P   D KRKSRLS F++NV      
Sbjct: 303 RDAVAVAKAKYDDDQKSIASTMTNDTSSNMKLTPTPSRTDVKRKSRLSVFSENVRSRSRS 362

Query: 326 XXXXXXXXXAPREPSLYDLVPRPEINTKLLLFWKKPARKCWWGLETITVDVQLNGHYDSE 385
                    A   P+LY+LVP+P+INTKLLLFWKKPARKCWWG E + ++V     ++++
Sbjct: 363 RNRSASRQRANESPTLYELVPKPDINTKLLLFWKKPARKCWWGQELVDLEVDFPAIFEND 422

Query: 386 SGTLVLSRNSPLCVLTIPVNLHIRRVWTL 414
           + T +   NS +  L +PV +HIRRVWTL
Sbjct: 423 TLT-IFPDNSKIQKLKVPVKIHIRRVWTL 450

>YOR043W (WHI2) [4854] chr15 (410869..412329) Protein involved in
           growth regulation and stress response [1461 bp, 486 aa]
          Length = 486

 Score =  400 bits (1028), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 230/477 (48%), Positives = 283/477 (59%), Gaps = 71/477 (14%)

Query: 7   IITQVSPEQQLGGSQLMT---------EQIEPDYYDENTLIHLNIQGRHYYITREQLMSL 57
           IITQVSP+       L           E  E DY D  +LIHLNIQ  HY+ITR+QLMSL
Sbjct: 4   IITQVSPDNAESAPILQEQQQQQNSQYEGNEEDYGD--SLIHLNIQENHYFITRDQLMSL 61

Query: 58  PESLLLCFFPSGVFMNREGQVITNLTPEDEVYIANFPPKCFESIMETYTTAQRDLENFPV 117
           PESLLLC FPSGVF++R GQVITNLT +DEVYI NFPP CFE IME YT A  DL N PV
Sbjct: 62  PESLLLCLFPSGVFLDRCGQVITNLTRDDEVYIVNFPPDCFEYIMEIYTKAHDDLYNHPV 121

Query: 118 GEFGRRAPHA---GPKGFLGLTPSQSQPMS-ESQILHEKPAIIVLREDLDYYCVPSVSLA 173
            +F  R   +     KGF GL+ + S   + E  ILH+KPAIIVLREDLDYYCVP     
Sbjct: 122 EKFFDRPSSSFVSNAKGFFGLSSNNSISSNNEQDILHQKPAIIVLREDLDYYCVPQEEFQ 181

Query: 174 LEDGSREGQDILLEQLMAQVKNAAGSHLCQQRSVFKGLYSSNRVRRPDAQHQPDQ----- 228
            +  + E  + LL   MAQVK AAGS+L  + S+F+GLYSSNR+++   Q + ++     
Sbjct: 182 FDSTNEENNEDLLRHFMAQVKMAAGSYLTSKTSIFQGLYSSNRLKQQQQQQKIEKGSNSS 241

Query: 229 ---------LGPAEQHLMDMLCASGFREHSDWGNRSQEPGKTVISSLSLCRLMNETVQEF 279
                    LGPAEQHLMDMLC+SGF + + WGNR+QE GKTVISSLSLCRL NET + F
Sbjct: 242 SNTKSTSKKLGPAEQHLMDMLCSSGFTKETCWGNRTQETGKTVISSLSLCRLANETTEGF 301

Query: 280 RDQVAAARRRYDEDH-------VTP--------------------------DAASAPPSR 306
           R +   A+ +++ +H       +TP                            ++AP + 
Sbjct: 302 RQKFNEAKAKWEAEHKPSQDNFITPMQSNISINSLSASKSNSTISTARNLTSGSTAPATA 361

Query: 307 DQKRKSRLSTFTDNVXXXXXXXXXXXXXA--PREPSLYDLVPRPEINTKLLLFWKKPARK 364
             KRKSRLS   DNV             +  P  P LYDLVP+P IN KLLLFW+KPARK
Sbjct: 362 RDKRKSRLSKLADNVRSHSSSRHSSQTRSKPPELPKLYDLVPKPNINAKLLLFWRKPARK 421

Query: 365 CWWGLETITVDVQLNGHYDSESGT---LVLSRN----SPLCVLTIPVNLHIRRVWTL 414
           CWWG E I ++V++ G +  ES     L+L  N    + L  + +PV LHIRRVWTL
Sbjct: 422 CWWGEEDIELEVEVFGSWKDESKKIIELILPTNVDPEAELHKIIVPVRLHIRRVWTL 478

>Scas_699.46
          Length = 512

 Score =  379 bits (974), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 224/504 (44%), Positives = 290/504 (57%), Gaps = 95/504 (18%)

Query: 5   QSIITQVSPEQQ---LGGSQLMTEQIEPDYYDENT--------LIHLNIQGRHYYITREQ 53
           Q+IITQV PE       G+ L +      +YD ++        LIHLNIQ  HY+ITR+Q
Sbjct: 2   QNIITQV-PENNSTTTTGNPLTSSDQNTSFYDNDSNDKENGDSLIHLNIQENHYFITRDQ 60

Query: 54  LMSLPESLLLCFFPSGVFMNREGQVITNLTPEDEVYIANFPPKCFESIMETYTTAQRDLE 113
           LMSLPESLLLC FPSGVF++R GQVI+NL+P+DEVYI NFPP CFE IME YT AQ DL 
Sbjct: 61  LMSLPESLLLCLFPSGVFLDRSGQVISNLSPDDEVYIVNFPPDCFEYIMEVYTKAQDDLL 120

Query: 114 NFPVGEFGRRAPH----AGPKGFLGL----------------TPSQSQPMSESQILHEKP 153
           N+PV ++  +A +       KGF G                 T + +   SE  +LH+KP
Sbjct: 121 NYPVEKYFDKASNHKLINSAKGFFGFGSSNSLSNVNSNTSSGTAASTTTTSEHDLLHQKP 180

Query: 154 AIIVLREDLDYYCVPSVSLAL-EDGSREGQDILLEQLMAQVKNAAGSHLCQQRSVFKGLY 212
           AIIVLREDLDYYCVP  +    ++ S E  D LL   MAQVK AAGS+L ++ S+F+GL+
Sbjct: 181 AIIVLREDLDYYCVPQETFQFAKNESFENNDDLLHYFMAQVKIAAGSYLTKKTSIFEGLF 240

Query: 213 SSNRVR------------RPDAQHQPDQLGPAEQHLMDMLCASGFREHSDWGNRSQEPGK 260
           SSNR++            +   + +  +LGPAEQHLMDMLC+SGF + S WGNR+QE GK
Sbjct: 241 SSNRLKDSHRKTSQRNNGKNSHKSRRQKLGPAEQHLMDMLCSSGFGDRSIWGNRTQESGK 300

Query: 261 TVISSLSLCRLMNETVQEFRDQVAAARRRYDEDH-----------------------VTP 297
           TVISSL+LCRL NE+ QEFRD    A+ +++ +H                       + P
Sbjct: 301 TVISSLALCRLANESTQEFRDMYHRAKTKWELEHNVNQDQIDDVSSVSLQNNNTTNSIVP 360

Query: 298 DAASAPPS--------------RDQKRKSRLSTFTDNVXXXXXXXXXX-----XXXAPRE 338
             +S   +              R+ ++K+RL+T  DNV                  +   
Sbjct: 361 SRSSTSVNIASNSNSSSKQSGPRESRKKNRLATLADNVRSHSTSRNSSLTRLRSSKSLEL 420

Query: 339 PSLYDLVPRPEINTKLLLFWKKPARKCWWGLETITVDVQLNGHY-DSESGTLVLSR---- 393
           P LYDLVP+P+IN KLLLFW+KPARKCWWG E I V++++ GH+ D E   + L      
Sbjct: 421 PKLYDLVPKPDINAKLLLFWRKPARKCWWGEEDIEVEIEIYGHWVDQEKKIIKLQLPHED 480

Query: 394 ---NSPLCVLTIPVNLHIRRVWTL 414
                 L  + IPV LHIRRVWTL
Sbjct: 481 KDIEQQLNKIRIPVRLHIRRVWTL 504

>Scas_615.8
          Length = 447

 Score =  337 bits (865), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 196/444 (44%), Positives = 256/444 (57%), Gaps = 40/444 (9%)

Query: 5   QSIITQV-----SPEQQLGGSQLMTEQIEPDYYDENTLIHLNIQGRHYYITREQLMSLPE 59
           ++IITQV      P   +  S L  E +  +Y + N+L+HLNIQ  HY++TR+QLM+LPE
Sbjct: 2   ENIITQVPQNGAVPNGFINQSGLEQEDLS-NYDNGNSLVHLNIQENHYFLTRDQLMTLPE 60

Query: 60  SLLLCFFPSGVFMNREGQVITNLTPEDEVYIANFPPKCFESIMETYTTAQRDLENFPVGE 119
           SLLLC FPSGVF++R  QVITNLT EDEV+I NFP  CFE IME Y  A  DL NFPV E
Sbjct: 61  SLLLCLFPSGVFLDRADQVITNLTAEDEVFITNFPATCFEYIMEFYMKANDDLLNFPVLE 120

Query: 120 FGRRAPHAGPKGFLGLTPSQSQPMSESQILHEKPAIIVLREDLDYYCVPSVSLALE---D 176
                 +A         P   Q   +  ILHE P+IIVLREDLDYYCVP +    E   +
Sbjct: 121 QFPSIRNANNHTRYQ-HPQTQQQFEQDAILHENPSIIVLREDLDYYCVPQLEFEFEPLPE 179

Query: 177 G----SREGQDILLEQLMAQVKNAAGSHLCQQRSVFKGLYSSNRVRRPDAQHQP------ 226
           G     +  +D LL+  M+Q+K AAGS+L  Q S+F+GLY SN++ + +    P      
Sbjct: 180 GRPPLDQYMKDDLLQHCMSQLKVAAGSYLLNQTSIFQGLYLSNKIHQHEVSQVPLHGSGK 239

Query: 227 -DQLGPAEQHLMDMLCASGFREHSDWGNRSQEPGKTVISSLSLCRLMNETVQEFRDQVAA 285
              LGPAEQHLMDMLC+SGF   S WGNR+QE GKT+ISSLSLCRL NE+ ++FR+ V  
Sbjct: 240 SSTLGPAEQHLMDMLCSSGFLPESQWGNRTQEFGKTIISSLSLCRLYNESTEDFRNAVTR 299

Query: 286 ARRRYDEDHVTPDAA---SAPPSRDQKRKSRLSTFTDNVXXXXXXXXXXXXXAPREPSLY 342
             + + ++  + D     S P   D      +    DNV             +  +  +Y
Sbjct: 300 EMKNWKKNKDSNDGTKRFSMPIMEDGNSGRNID---DNVRNSVMIADDININSMPD-DVY 355

Query: 343 DLVPRPEINTKLLLFWKKPARKCWWGLETITVDVQLNGHYDSESGTLVLSRNSP------ 396
            LVP+P IN KLLLFW+KPARK WW  E + ++V++ G   + +G   +    P      
Sbjct: 356 KLVPKPTINNKLLLFWRKPARKSWWSAENVELEVEIYGSIVNVNGVNKVVLRVPQENANA 415

Query: 397 ------LCVLTIPVNLHIRRVWTL 414
                    + IP+ LHIRRVWTL
Sbjct: 416 NDNEFVTNTVKIPIKLHIRRVWTL 439

>Sklu_1533.1 YOR043W, Contig c1533 830-1408 reverse complement
          Length = 192

 Score =  209 bits (533), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 129/183 (70%), Gaps = 8/183 (4%)

Query: 30  DYYDENTLIHLNIQGRHYYITREQLMSLPESLLLCFFPSGVFMNREGQVITNLTPEDEVY 89
           +Y D+++LIHLNIQ  HYYITR+ LMSLPESLLLC FPSGVFM+R GQVITNLT +DEVY
Sbjct: 7   EYSDDDSLIHLNIQENHYYITRDHLMSLPESLLLCLFPSGVFMDRMGQVITNLTSDDEVY 66

Query: 90  IANFPPKCFESIMETYTTAQRDLENFPVGEFGRRAPHAGPKG-FLGL-TPSQSQPMSESQ 147
           I NFPP CFE IMETY+ AQ DL  +   E   + P+    G F G    S     +E+ 
Sbjct: 67  IGNFPPDCFEYIMETYSAAQEDLVKYTFDETFNKNPNDKEHGRFFGFSCSSAPSSSNEAD 126

Query: 148 ILHEKPAIIVLREDLDYYCV--PSVSLALEDGSREGQDILLEQLMAQVKNAAGSHLCQQR 205
           ILHEKP+IIVLREDLDYYCV  P V+ A    S E +D LL  LMA+VK AAGS+L  Q 
Sbjct: 127 ILHEKPSIIVLREDLDYYCVRQPEVTFA----SEEEKDTLLTHLMAEVKIAAGSYLSNQC 182

Query: 206 SVF 208
           S+F
Sbjct: 183 SIF 185

>CAGL0L11572g 1234039..1236480 similar to sp|P38814 Saccharomyces
           cerevisiae YHR103w SBE22 or sp|P42223 Saccharomyces
           cerevisiae YDR351w SBE2, start by similarity
          Length = 813

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 13/88 (14%)

Query: 109 QRDLENFPVGEFGRR-----------APHAGPKGFLGLTPSQSQPMSESQILHEKPAIIV 157
           Q+D  + P GEFG +            P+AG    L LTPSQ   + + Q  H    +I 
Sbjct: 228 QQDNRSVPNGEFGSKLYNLSNSTSAIIPNAGTGSKLALTPSQRYRLRKEQSEHALRDVIK 287

Query: 158 LREDLDYYCVPSVSLALEDGSREGQDIL 185
            +E L  Y      + L++G  +G  I 
Sbjct: 288 RKEKL--YDEQDGIIELQEGDIDGSFIF 313

>Scas_666.21
          Length = 864

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 14/20 (70%)

Query: 30  DYYDENTLIHLNIQGRHYYI 49
           DY DEN  I  NIQG++Y I
Sbjct: 160 DYIDENQFIERNIQGKNYKI 179

>YBR180W (DTR1) [364] chr2 (589698..591416) Dityrosine transporter,
           functions in maturation of the spore wall, member of the
           multidrug-resistance 12-spanner (DHA12) family of the
           major facilitator superfamily (MFS-MDR) [1719 bp, 572
           aa]
          Length = 572

 Score = 29.6 bits (65), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 4/61 (6%)

Query: 255 SQEPGKTVISSLSLCRLMNETVQEFRDQVAAARRRYDED--HVTPDAASAPPSRDQKRKS 312
           SQE G T  +  SL  L ++ + E  DQV   R   D D  H  PD  S+P    QK K+
Sbjct: 17  SQESGTTRSTFHSLEDLGDDVINESWDQVNQKRANIDHDVFHEHPD--SSPSLSAQKAKT 74

Query: 313 R 313
           +
Sbjct: 75  K 75

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,533,719
Number of extensions: 556806
Number of successful extensions: 1253
Number of sequences better than 10.0: 13
Number of HSP's gapped: 1245
Number of HSP's successfully gapped: 14
Length of query: 414
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 310
Effective length of database: 12,995,837
Effective search space: 4028709470
Effective search space used: 4028709470
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)