Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR081C96954203e-55
Scas_699.46d18855710.040
Kwal_55.2160316418690.074
YOR044W15728601.1
CAGL0L09999g13427601.1
Kwal_26.7154121330592.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR081C
         (95 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR081C [1128] [Homologous to ScYOR044W - SH] (503388..503678) [...   166   3e-55
Scas_699.46d                                                           32   0.040
Kwal_55.21603                                                          31   0.074
YOR044W (YOR044W) [4855] chr15 (413006..413479) Protein of unkno...    28   1.1  
CAGL0L09999g 1072123..1072527 some similarities with tr|Q08416 S...    28   1.1  
Kwal_26.7154                                                           27   2.2  

>ACR081C [1128] [Homologous to ScYOR044W - SH] (503388..503678)
          [291 bp, 96 aa]
          Length = 96

 Score =  166 bits (420), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 86/95 (90%), Positives = 86/95 (90%)

Query: 1  MDVSLHALTDCYWXXXXXXXXXRQVCKVLAWLLLGPLVAVYAYDFCLYVLRLARSLVLRP 60
          MDVSLHALTDCYW         RQVCKVLAWLLLGPLVAVYAYDFCLYVLRLARSLVLRP
Sbjct: 1  MDVSLHALTDCYWAVLAAAAVARQVCKVLAWLLLGPLVAVYAYDFCLYVLRLARSLVLRP 60

Query: 61 RTRALCNPRWLRRRLTKDETAALVVTGVCIVTSDR 95
          RTRALCNPRWLRRRLTKDETAALVVTGVCIVTSDR
Sbjct: 61 RTRALCNPRWLRRRLTKDETAALVVTGVCIVTSDR 95

>Scas_699.46d
          Length = 188

 Score = 32.0 bits (71), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 26 CKVLAWLLLGPLVAVYAYDFCLYVLRLARSLVLRPRTRALCNPRWLRRRLTKDET 80
          C +   +LL P V  Y++D  LY+ RL +  +       L   R   +RL K+ET
Sbjct: 24 CYIGIVILLIPFVGFYSFDLFLYIYRLLQYFI-----ECLIYKRNQNKRLGKEET 73

>Kwal_55.21603
          Length = 164

 Score = 31.2 bits (69), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 16/18 (88%)

Query: 35 GPLVAVYAYDFCLYVLRL 52
          GP++A+YAYDF LY+ R+
Sbjct: 35 GPVIALYAYDFGLYMWRV 52

>YOR044W (YOR044W) [4855] chr15 (413006..413479) Protein of
          unknown function [474 bp, 157 aa]
          Length = 157

 Score = 27.7 bits (60), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 17/28 (60%)

Query: 25 VCKVLAWLLLGPLVAVYAYDFCLYVLRL 52
          +C+     LL P + +YA+D  LYV R+
Sbjct: 19 ICRTCIAFLLIPFLGLYAFDLFLYVYRM 46

>CAGL0L09999g 1072123..1072527 some similarities with tr|Q08416
          Saccharomyces cerevisiae YOR044w, start by similarity
          Length = 134

 Score = 27.7 bits (60), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 26 CKVLAWLLLGPLVAVYAYDFCLYVLRL 52
          C     LLL P + +YA+D  LYV RL
Sbjct: 21 CYAAVALLLIPFLGLYAFDLFLYVYRL 47

>Kwal_26.7154
          Length = 1213

 Score = 27.3 bits (59), Expect = 2.2,   Method: Composition-based stats.
 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 2/30 (6%)

Query: 44   DFCLYVLR--LARSLVLRPRTRALCNPRWL 71
            D C+ ++R  L RS+  RP    +CN +WL
Sbjct: 1182 DDCIALIRKILNRSVSKRPSIDEICNHKWL 1211

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.333    0.141    0.477 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,276,565
Number of extensions: 60202
Number of successful extensions: 133
Number of sequences better than 10.0: 6
Number of HSP's gapped: 133
Number of HSP's successfully gapped: 6
Length of query: 95
Length of database: 16,596,109
Length adjustment: 66
Effective length of query: 29
Effective length of database: 14,311,321
Effective search space: 415028309
Effective search space used: 415028309
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 54 (25.4 bits)