Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR080C58572858e-36
Kwal_55.2160657571763e-19
Scas_699.47*61601522e-15
YOR045W (TOM6)61601226e-11
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR080C
         (57 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR080C [1127] [Homologous to ScYOR045W (TOM6) - SH] (503127..50...   114   8e-36
Kwal_55.21606                                                          72   3e-19
Scas_699.47*                                                           63   2e-15
YOR045W (TOM6) [4856] chr15 (413851..414036) Mitochondrial integ...    52   6e-11

>ACR080C [1127] [Homologous to ScYOR045W (TOM6) - SH]
          (503127..503303) [177 bp, 58 aa]
          Length = 58

 Score =  114 bits (285), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 57/57 (100%), Positives = 57/57 (100%)

Query: 1  MNGAYGIPGAGASAPKKQSMFQQFRDSPAYPVVVNLALFGVGVAFVQSSLMDMMAPQ 57
          MNGAYGIPGAGASAPKKQSMFQQFRDSPAYPVVVNLALFGVGVAFVQSSLMDMMAPQ
Sbjct: 1  MNGAYGIPGAGASAPKKQSMFQQFRDSPAYPVVVNLALFGVGVAFVQSSLMDMMAPQ 57

>Kwal_55.21606
          Length = 57

 Score = 72.4 bits (176), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 1/57 (1%)

Query: 1  MNGAYGIPGAGASAPKKQSMFQQFRDSPAYPVVVNLALFGVGVAFVQSSLMDMMAPQ 57
          M+  +  PGAGA A KK S F+QFR +PA+PV+VNL LF  GVAF+QS LM+MMAPQ
Sbjct: 1  MSARFTAPGAGAPA-KKASRFEQFRQTPAFPVIVNLGLFVAGVAFIQSPLMEMMAPQ 56

>Scas_699.47*
          Length = 61

 Score = 63.2 bits (152), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 45/60 (75%), Gaps = 3/60 (5%)

Query: 1  MNGAYGIPGAGAS--APKK-QSMFQQFRDSPAYPVVVNLALFGVGVAFVQSSLMDMMAPQ 57
          M+  +G+PG GA+  AP K +S F+QFR++P + V++N  LF  GVAF+QS LMDM+APQ
Sbjct: 1  MSAMFGMPGLGATGGAPTKPKSRFEQFRETPVFTVLLNGTLFVAGVAFIQSPLMDMLAPQ 60

>YOR045W (TOM6) [4856] chr15 (413851..414036) Mitochondrial
          integral outer membrane protein associated with the
          protein translocation complex and the general import
          complex [186 bp, 61 aa]
          Length = 61

 Score = 51.6 bits (122), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 3/60 (5%)

Query: 1  MNGAYGIPGAGA---SAPKKQSMFQQFRDSPAYPVVVNLALFGVGVAFVQSSLMDMMAPQ 57
          M+G + +PGA A   S  + +S FQ F++SP Y + +N A F  GVAF+QS LMDM+APQ
Sbjct: 1  MDGMFAMPGAAAGAASPQQPKSRFQAFKESPLYTIALNGAFFVAGVAFIQSPLMDMLAPQ 60

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.133    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 1,521,765
Number of extensions: 39162
Number of successful extensions: 90
Number of sequences better than 10.0: 4
Number of HSP's gapped: 89
Number of HSP's successfully gapped: 4
Length of query: 57
Length of database: 16,596,109
Length adjustment: 30
Effective length of query: 27
Effective length of database: 15,557,569
Effective search space: 420054363
Effective search space used: 420054363
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)