Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR036C75474033920.0
KLLA0D09603g8202914093e-41
Kwal_33.154559142983971e-39
Scas_617.47912833524e-34
YGR196C (FYV8)8172813232e-30
CAGL0G09295g7673043089e-29
Scas_590.1469362684.9
AGR251C119330668.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR036C
         (740 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR036C [1084] [Homologous to ScYGR196C (FYV8) - SH] (423030..42...  1311   0.0  
KLLA0D09603g 811234..813696 weakly similar to sp|P46949 Saccharo...   162   3e-41
Kwal_33.15455                                                         157   1e-39
Scas_617.4                                                            140   4e-34
YGR196C (FYV8) [2146] chr7 complement(889736..892189) Protein of...   129   2e-30
CAGL0G09295g 887666..889969 similar to sp|P46949 Saccharomyces c...   123   9e-29
Scas_590.14                                                            31   4.9  
AGR251C [4562] [Homologous to ScYPR122W (AXL1) - SH] (1213377..1...    30   8.1  

>ACR036C [1084] [Homologous to ScYGR196C (FYV8) - SH]
           (423030..425294) [2265 bp, 754 aa]
          Length = 754

 Score = 1311 bits (3392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 657/740 (88%), Positives = 657/740 (88%)

Query: 1   MPDKVNRRKSQRWVSVSKGNYDGADWDSDYSGEELESSPTRQHETICKLPELPKLNLGGS 60
           MPDKVNRRKSQRWVSVSKGNYDGADWDSDYSGEELESSPTRQHETICKLPELPKLNLGGS
Sbjct: 1   MPDKVNRRKSQRWVSVSKGNYDGADWDSDYSGEELESSPTRQHETICKLPELPKLNLGGS 60

Query: 61  TEERGRPGSGDGLAPXXXXXXXXXXXXXXXXTPAHEVQTPRSGAAAQKFXXXXXXXXXXX 120
           TEERGRPGSGDGLAP                TPAHEVQTPRSGAAAQKF           
Sbjct: 61  TEERGRPGSGDGLAPRGAAEEEAASSGRGAATPAHEVQTPRSGAAAQKFSLTSSSRSVSS 120

Query: 121 MNKELDTLMDEISKEMTAGGSEPPLVETRQSPVDFNRVGVPALKPEGHLXXXXXXXXXXX 180
           MNKELDTLMDEISKEMTAGGSEPPLVETRQSPVDFNRVGVPALKPEGHL           
Sbjct: 121 MNKELDTLMDEISKEMTAGGSEPPLVETRQSPVDFNRVGVPALKPEGHLADDSSDSDGED 180

Query: 181 XXXXXXLSQSFEHLNMSLKTDTASGQAMPLSSPRGSSALPAGRDSLALKKGASPDRASEG 240
                 LSQSFEHLNMSLKTDTASGQAMPLSSPRGSSALPAGRDSLALKKGASPDRASEG
Sbjct: 181 AAGGSSLSQSFEHLNMSLKTDTASGQAMPLSSPRGSSALPAGRDSLALKKGASPDRASEG 240

Query: 241 SLSSRSEDLLAVDRTAGENTRLKXXXXXXXXXXXLPELITSDAKFRADGASGPARVVSSG 300
           SLSSRSEDLLAVDRTAGENTRLK           LPELITSDAKFRADGASGPARVVSSG
Sbjct: 241 SLSSRSEDLLAVDRTAGENTRLKTTNSSDDDTDSLPELITSDAKFRADGASGPARVVSSG 300

Query: 301 VETVIHRAIAPEVAPRLRITSKTDLSYRYDTSSEDDSEAYSGIEDDYLSYQPSPNISDAA 360
           VETVIHRAIAPEVAPRLRITSKTDLSYRYDTSSEDDSEAYSGIEDDYLSYQPSPNISDAA
Sbjct: 301 VETVIHRAIAPEVAPRLRITSKTDLSYRYDTSSEDDSEAYSGIEDDYLSYQPSPNISDAA 360

Query: 361 TFHGHRSRTGSPARAPHPLVEQEEHIELPVISDDDSTSKSSVRDNYYSEESDNTTSQALV 420
           TFHGHRSRTGSPARAPHPLVEQEEHIELPVISDDDSTSKSSVRDNYYSEESDNTTSQALV
Sbjct: 361 TFHGHRSRTGSPARAPHPLVEQEEHIELPVISDDDSTSKSSVRDNYYSEESDNTTSQALV 420

Query: 421 TQDNSSHDTIHDTIRERSFDKSTSGSVTHSIPVIKDDNEDWQNQLRQQSVHLGAWNPDTE 480
           TQDNSSHDTIHDTIRERSFDKSTSGSVTHSIPVIKDDNEDWQNQLRQQSVHLGAWNPDTE
Sbjct: 421 TQDNSSHDTIHDTIRERSFDKSTSGSVTHSIPVIKDDNEDWQNQLRQQSVHLGAWNPDTE 480

Query: 481 GKRGAFLTQASPMSTNKGMCGSQDEETTGDDQQLAEPCNDDSDSVWEGFPSVGEYEDLQS 540
           GKRGAFLTQASPMSTNKGMCGSQDEETTGDDQQLAEPCNDDSDSVWEGFPSVGEYEDLQS
Sbjct: 481 GKRGAFLTQASPMSTNKGMCGSQDEETTGDDQQLAEPCNDDSDSVWEGFPSVGEYEDLQS 540

Query: 541 VADIKTIYDNQTLYNVPGIITXXXXXXXXXXXXXELTSRQDTSIXXXXXXXXXXXXXXXM 600
           VADIKTIYDNQTLYNVPGIIT             ELTSRQDTSI               M
Sbjct: 541 VADIKTIYDNQTLYNVPGIITSSTSVPPLPSSMSELTSRQDTSILSESTSGSGLDSDSLM 600

Query: 601 RVVEGQRHAPKPSMFKENFGQTPEVQVEHLVNSPVPSLDICALIEGPQSHSFKRDKLNSH 660
           RVVEGQRHAPKPSMFKENFGQTPEVQVEHLVNSPVPSLDICALIEGPQSHSFKRDKLNSH
Sbjct: 601 RVVEGQRHAPKPSMFKENFGQTPEVQVEHLVNSPVPSLDICALIEGPQSHSFKRDKLNSH 660

Query: 661 IEDLNAYSSGAQTWIKYALKSTQSSSNITFDEYVISKHVQDAYAQAEEVSKKHSVTNAVN 720
           IEDLNAYSSGAQTWIKYALKSTQSSSNITFDEYVISKHVQDAYAQAEEVSKKHSVTNAVN
Sbjct: 661 IEDLNAYSSGAQTWIKYALKSTQSSSNITFDEYVISKHVQDAYAQAEEVSKKHSVTNAVN 720

Query: 721 QNVSQLRKKVFSHSMKEGAK 740
           QNVSQLRKKVFSHSMKEGAK
Sbjct: 721 QNVSQLRKKVFSHSMKEGAK 740

>KLLA0D09603g 811234..813696 weakly similar to sp|P46949
           Saccharomyces cerevisiae YGR196c singleton, start by
           similarity
          Length = 820

 Score =  162 bits (409), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 107/291 (36%), Positives = 154/291 (52%), Gaps = 35/291 (12%)

Query: 467 QQSVHLGAWNPDTEGKRGAFLTQASPMSTN-KGMCGSQDEE------TTGDDQQLAEPCN 519
           ++S++LG W PDT+  R  F+T+   ++   +G   ++D E       T  + Q      
Sbjct: 538 RESINLGKWKPDTDAFRSGFVTETIDINNPPEGYTVNEDGEIVEVNKNTTSNIQRNSSVA 597

Query: 520 DDSDSVWEGFPS--VGEYEDLQSVADIKTIYDNQTLYNVPGIITXXXXX------XXXXX 571
            D +S +  FP     + +DL+++AD KTIYDNQT+YNVP +I                 
Sbjct: 598 SDGESQFNAFPHDVASDDDDLKTIADTKTIYDNQTIYNVPALIANNASAPALPTNIQITN 657

Query: 572 XXXELTSRQDTSIXXXXXXXXXXXXXXXMRVVEGQRHAPK-PSMFKENFGQTPEVQVEHL 630
              +  S  DT                  + V G+  APK  S  KE F    +     +
Sbjct: 658 ESTDYVSSNDT----------------IFKHVNGE--APKGESKLKEAFSSEGDEIPSVV 699

Query: 631 VNSPVPSLDICALIEGPQSHSFKRDKLNSHIEDLNAYSSGAQTWIKYALKS-TQSSSNIT 689
             S VP+LD+  L+   + HS K  KLN++ E L  Y SG Q+WI+YALKS T S  +  
Sbjct: 700 HQSTVPNLDLVKLLSSNELHSQKLKKLNNYKEQLKEYDSGLQSWIQYALKSSTTSDKDFI 759

Query: 690 FDEYVISKHVQDAYAQAEEVSKKHSVTNAVNQNVSQLRKKVFSHSMKEGAK 740
           F +Y ++KHVQDAYAQA+ +SKK+SV N VNQNV+ L+KK+FS SM+E +K
Sbjct: 760 FKDYKVNKHVQDAYAQADILSKKNSVANTVNQNVTHLKKKMFSSSMREKSK 810

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 34/57 (59%), Gaps = 7/57 (12%)

Query: 1  MPDKVNRRKSQRWVSVSKGNYDGADWDSDYSGEELESSPTRQHETICKLPELPKLNL 57
          M D + R KSQRWVS SK NYDGADWD+  S  E E            +P+LP++N+
Sbjct: 15 MSDNITRHKSQRWVSASKANYDGADWDAYSSNSEDEG-------LTNNIPQLPQVNI 64

>Kwal_33.15455
          Length = 914

 Score =  157 bits (397), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 109/298 (36%), Positives = 158/298 (53%), Gaps = 28/298 (9%)

Query: 459 EDWQNQL---RQQSVHLGAWNPDTEGKRGAFLTQASPMSTNKGMCGSQDEE------TTG 509
           +D QN++    +QSV+LG W PDT+  R  FL QA P    +G    QD +      ++ 
Sbjct: 618 DDDQNKVGLNSRQSVNLGKWQPDTDAGRAEFLGQAKP-EVPEGYVVDQDGQLVNVNPSSM 676

Query: 510 DDQQLAEPCNDDSDSVWEGFP-SVGEYEDLQSVADIKTIYDNQTLYNVPGIITXXXXXXX 568
            D ++    ++ ++S W  FP S G   DL ++ D KTIYDNQT++NVPG+ T       
Sbjct: 677 RDARVVSTYSE-AESAWNAFPASAGNGGDLDTIYDTKTIYDNQTIHNVPGLATNNDSLPP 735

Query: 569 XXXXXXELTSRQDTSIXXXXXXXXXXXXXXXMRVVEGQRHAPKPSMFKENFG-QTPEVQV 627
                     R  T++                 +   +RH    S  KE+F   TP+ + 
Sbjct: 736 LP--------RDITAVDSSLSANVTDSDSILNHLNGVKRH--HYSNLKESFSVHTPDQEE 785

Query: 628 EHLVN-SPVPSLDICALIEGPQS-HSFKRDKLNSHIEDLNAYSSGAQTWIKYALKSTQSS 685
             LV    VP+ D+ ALI    + H+ K + LN H  +L  Y SG  TWI YALK++ S 
Sbjct: 786 IALVKQKAVPTADLDALITRKNTTHAAKINDLNKHFNELKDYDSGLHTWISYALKTSTSD 845

Query: 686 SNITFDEYVISKHVQDAYAQAEEVSKKHSVTNA---VNQNVSQLRKKVFSHSMKEGAK 740
            +  F  Y +S HV+DAY+ A+++SKK +V+N    VNQNVS L++KVFSH+MKE +K
Sbjct: 846 KDYIFQNYKVSTHVKDAYSHADDLSKKMTVSNTVANVNQNVSHLKRKVFSHTMKEKSK 903

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 41/68 (60%), Gaps = 11/68 (16%)

Query: 1  MPDKVNRRKSQRWVSVSKGNYDGADWDSD--------YSGEELES--SPTRQHETICKLP 50
          M   + R+KSQRWVSVSKG YDG +WDS         +  +E +S  SP R + T+ KLP
Sbjct: 1  MSVNMERKKSQRWVSVSKGTYDGKEWDSSEEDEPYGAWENDEGQSRKSPER-NGTVSKLP 59

Query: 51 ELPKLNLG 58
           LP L+ G
Sbjct: 60 PLPMLSYG 67

>Scas_617.4
          Length = 791

 Score =  140 bits (352), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 146/283 (51%), Gaps = 31/283 (10%)

Query: 469 SVHLGAWNPDTEGKRGAFLTQASPMSTNK----GMCGSQDEETTGDDQQLAEP----CND 520
           S++LG+W PDT+  R  F+       TNK    G    ++ +         +P       
Sbjct: 508 SINLGSWKPDTDAIRSGFV-----QDTNKRAPPGFVYDENGKLVDLTPSSMKPRVVSTYS 562

Query: 521 DSDSVWEGFPSVGE---YEDLQSVADIKTIYDNQTLYNVPGIITXXXXXXXXXXXXXELT 577
           + +S W  FPS G     EDL+++ D KT+YDN T++NVPGI+T              + 
Sbjct: 563 EMESTWAAFPSNGNPENNEDLETIKDTKTLYDNNTIFNVPGIMTNNENLPPLPKN---VN 619

Query: 578 SRQDTSIXXXXXXXXXXXXXXXMRVVEGQRHAPKPSMFKENFGQTPEVQVEHLVNSPVPS 637
             Q +                 ++ +    H+  PS+ K +  +  ++  +     P+P 
Sbjct: 620 IEQGSLPVARTLTAGSEVDKKSIKSI----HSEGPSVHKPDSYEMAKLSDQ----DPLPE 671

Query: 638 LDICALIEGPQSHSFKRDKLNSHIEDLNAYSSGAQTWIKYALK-STQSSSNITFDEYVIS 696
           LD+  LI    SH  K ++L ++ + L  Y SG QTWI Y LK S+++  +  FDEY  +
Sbjct: 672 LDLNELISSKASHLSKIEQLQAYSQSLADYDSGIQTWINYTLKSSSKADRDYLFDEYKKN 731

Query: 697 KHVQDAYAQAEEVSKKHSVTN---AVNQNVSQLRKKVFSHSMK 736
           +HV++AYA AE++S+K++V N   +VNQNVS LRKKVFSHSMK
Sbjct: 732 EHVREAYANAEDLSRKNTVINTVASVNQNVSHLRKKVFSHSMK 774

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 55/172 (31%), Positives = 71/172 (41%), Gaps = 29/172 (16%)

Query: 3   DKVNRRKSQRWVSVSKGNYDGADWDSDYSGEELESSPTRQHETICKLPELPKLN------ 56
           + V R+KS RW S S+  YDGADW+S  S E+   S       + KLP LPKLN      
Sbjct: 4   ENVGRKKSHRWASASQATYDGADWNSSDSDEDHAISNEEAQPNVTKLPSLPKLNYTSNEE 63

Query: 57  -----LGGSTEERGR-PGSGDGLAPXXXXXXXXXXXXXXXXTPAHEVQTPRSGAAAQKFX 110
                L  + EE G+ P S +   P                    E +T RS +  +   
Sbjct: 64  EEEGKLTDNAEENGKLPNSEEEERPTLHITT--------------EDETDRSSSNNESKS 109

Query: 111 XXXXXXXXXXM---NKELDTLMDEISKEMTAGGSEPPLVETRQSPVDFNRVG 159
                     M   N +LD LM +ISKEMT      P+   R SP   +R G
Sbjct: 110 SLNRTRRNSPMRGVNTDLDNLMLQISKEMTPKLENEPVFPPRDSPTSASREG 161

>YGR196C (FYV8) [2146] chr7 complement(889736..892189) Protein of
           unknown function [2454 bp, 817 aa]
          Length = 817

 Score =  129 bits (323), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 89/281 (31%), Positives = 135/281 (48%), Gaps = 12/281 (4%)

Query: 467 QQSVHLGAWNPDTEGKRGAFLTQASPMSTNKGMC----GSQDEETTGDDQQLAEPCNDDS 522
           + S  + +W PD+E  R  F+   +      G      G   + T    +        + 
Sbjct: 525 KDSTDVDSWKPDSEALRSGFVQDTANKKAPPGYVIDSNGKLVDLTPASMKPRVVSTYSEM 584

Query: 523 DSVWEGFPSVGEYEDLQSVADIKTIYDNQTLYNVPGIITXXXXXXXXXXXXXE-LTSRQD 581
           +S W+ FPS GE +DL+++ D KTIYDN T+YNVPG+I              E L +  D
Sbjct: 585 ESTWDAFPSKGEDDDLETIRDTKTIYDNNTIYNVPGLIGNQSNLPPLPMDAQEQLNAGND 644

Query: 582 TSIXXXXXXXXXXX--XXXXMRVVEGQRHAPKPSMFKENFGQTPEVQVEHLVNSPVPSLD 639
            S                         R   +  M   +   T E+      N+ +P LD
Sbjct: 645 NSTTDNDNSNNTANDLAARSASFKSENRTVSQGEMTSVHEPSTEEMAKLGQQNN-LPKLD 703

Query: 640 ICALIEGPQSHSFKRDKLNSHIEDLNAYSSGAQTWIKYALKSTQSS-SNITFDEYVISKH 698
           +  L+    SH+ K ++L ++  +L+ Y +G QTWI Y LKS+ +   +   +EY    H
Sbjct: 704 MNKLLNSKTSHAGKIEQLRNYKRELDEYDTGIQTWINYTLKSSSNKDKDFIAEEYKQHSH 763

Query: 699 VQDAYAQAEEVSKKHSVTN---AVNQNVSQLRKKVFSHSMK 736
           V++AYA A+++SKKH+V N   +VNQNV+ LR+KVF HSMK
Sbjct: 764 VREAYANADDLSKKHTVINTVASVNQNVTHLRRKVFQHSMK 804

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 4/58 (6%)

Query: 3  DKVNRRKSQRWVSVSKGNYDGADWDS----DYSGEELESSPTRQHETICKLPELPKLN 56
          ++V R+KS RWVS S+ +YDGA WDS    DYS E+         + I  LP LPKLN
Sbjct: 4  EQVGRKKSYRWVSASQASYDGAGWDSSDEYDYSSEDGTKGSEIHKQKISNLPSLPKLN 61

>CAGL0G09295g 887666..889969 similar to sp|P46949 Saccharomyces
           cerevisiae YGR196c, start by similarity
          Length = 767

 Score =  123 bits (308), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 91/304 (29%), Positives = 141/304 (46%), Gaps = 25/304 (8%)

Query: 445 GSVTHSIPVIKDDNEDWQNQL----RQQSVHLGAWNPDTEGKRGAFLTQAS---PMSTNK 497
            S T  +   K DN+D +N       + SV    W PDT+  R  F+ +     P    +
Sbjct: 464 ASDTEDVQESKADNDDTKNDAHVSSNRSSVTSEEWRPDTDALRDGFMQKTGDNPPPGFVR 523

Query: 498 GMCGSQDEETTGDDQQLAEPCNDDSDSVWEGFPSVGEYEDLQSVADIKTIYDNQTLYNVP 557
              G   + T    +        + +S W  FPS  + +DL+++ D KT+YDN TLYNVP
Sbjct: 524 DEKGELVDLTPASMKPRVVSTYSEIESTWNAFPS-EDADDLETIRDTKTLYDNSTLYNVP 582

Query: 558 GIITXXXXXXXXXXXXXELTSRQDTSIXXXXXXXXXXXXXXXMRVVEGQRHAPKPSMFKE 617
           GI+T                  +D S+                R     R   K  +   
Sbjct: 583 GIMTNNDALPPLP---------EDASLYRDSNQSDAVGSQDRARAASVTRKVSKEGV--- 630

Query: 618 NFGQTPEVQVEHLV-NSPVPSLDICALIEGPQSHSFKRDKLNSHIEDLNAYSSGAQTWIK 676
           N  Q    ++  L   + +P+ D+  +I    +H+ K + L  +   L+ + SG QTWI 
Sbjct: 631 NIAQPTSQEINKLSEQNTMPTRDLNKIISSNSTHAIKLENLRDYRNTLDNFDSGLQTWIA 690

Query: 677 YALK-STQSSSNITFDEYVISKHVQDAYAQAEEVSKKHSVTNA---VNQNVSQLRKKVFS 732
           Y LK S+++  +  F EY  + HV++AYA A+++S+K++V N    VNQNV+ LRKKV  
Sbjct: 691 YTLKSSSKTDRDFIFQEYKSNSHVREAYANADDLSRKNTVINTVTNVNQNVNHLRKKVLQ 750

Query: 733 HSMK 736
           HS+K
Sbjct: 751 HSLK 754

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 66/168 (39%), Gaps = 40/168 (23%)

Query: 4   KVNRRKSQRWVSVSKGNYDGADWDSDYSGEELESSPTRQHETICK----LPELPKLNLGG 59
           +V R+KS RWVS S+  YDGA WDS    E    + TR    + K    LP LPKLN   
Sbjct: 5   QVERKKSYRWVSASQATYDGAGWDSSSESE----TETRSQPKLGKLDESLPSLPKLNYDN 60

Query: 60  S----------------TEERGRPGSG----------DGLA---PXXXXXXXXXXXXXXX 90
           +                TE+ G  G+G          D +    P               
Sbjct: 61  TDVSQYKEEDDEDTDNRTEKAGEIGAGTLHSNSEIQNDVIVEDDPVIKQTPDMIDKDTLL 120

Query: 91  XTP-AHEVQTPRSGAAAQKFXXXXXXXXXXXMNKELDTLMDEISKEMT 137
            +P AH+  +P    +   F           +N+ LD LM EISKE+T
Sbjct: 121 TSPTAHKESSPSPNGSRHTF--SRRPLPNRAVNEHLDDLMLEISKELT 166

>Scas_590.14
          Length = 693

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 7/62 (11%)

Query: 408 SEESDNTTSQALVTQDNSSHD-------TIHDTIRERSFDKSTSGSVTHSIPVIKDDNED 460
           SEE   T   AL+  D+ +H+        IHDTI++RS + S   +  H++  I + + D
Sbjct: 143 SEELTKTALFALIQLDDLNHNKVTDLFNIIHDTIQQRSDNPSIQVAALHTLYAIHEKHTD 202

Query: 461 WQ 462
            +
Sbjct: 203 MK 204

>AGR251C [4562] [Homologous to ScYPR122W (AXL1) - SH]
           (1213377..1216958) [3582 bp, 1193 aa]
          Length = 1193

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 665 NAYSSGAQTWIKYALKSTQSSSNITFDEYV 694
           NA++SG QT   + L S+QSS ++ FD+ V
Sbjct: 101 NAHTSGEQTSFYFELPSSQSSDSLVFDQVV 130

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.308    0.125    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,652,889
Number of extensions: 970456
Number of successful extensions: 3327
Number of sequences better than 10.0: 77
Number of HSP's gapped: 3359
Number of HSP's successfully gapped: 102
Length of query: 740
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 631
Effective length of database: 12,822,747
Effective search space: 8091153357
Effective search space used: 8091153357
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 65 (29.6 bits)