Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR035W24624212870.0
Sklu_1267.227324210751e-150
KLLA0D09625g24524210481e-146
Kwal_33.1545324524210381e-144
Scas_647.724624210231e-142
YGR195W (SKI6)24624210061e-140
CAGL0G09317g24624210011e-139
Scas_716.302281401333e-09
KLLA0D14993g2251591308e-09
Sklu_1989.12231381291e-08
YGR095C (RRP46)2231511272e-08
Sklu_1879.12381441253e-08
KLLA0F18304g2361401202e-07
AFR109W2371391166e-07
Kwal_23.39692241361131e-06
Scas_621.172391291132e-06
CAGL0G03113g2331381085e-06
YGR232W (NAS6)22865720.27
Kwal_47.1719355559710.39
CAGL0E03223g248125700.44
AAR035C25297700.51
YGR158C (MTR3)250128690.60
Sklu_2413.917759615.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR035W
         (242 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR035W [1083] [Homologous to ScYGR195W (SKI6) - SH] complement(...   500   0.0  
Sklu_1267.2 YGR195W, Contig c1267 529-1350                            418   e-150
KLLA0D09625g complement(813773..814510) highly similar to sp|P46...   408   e-146
Kwal_33.15453                                                         404   e-144
Scas_647.7                                                            398   e-142
YGR195W (SKI6) [2145] chr7 (888885..889625) Component of the exo...   392   e-140
CAGL0G09317g complement(890158..890898) highly similar to sp|P46...   390   e-139
Scas_716.30                                                            56   3e-09
KLLA0D14993g complement(1266752..1267429) similar to sp|P53256 S...    55   8e-09
Sklu_1989.1 YGR095C, Contig c1989 348-1019                             54   1e-08
YGR095C (RRP46) [2055] chr7 complement(675673..676344) Protein c...    54   2e-08
Sklu_1879.1 YGR158C, Contig c1879 329-1045 reverse complement          53   3e-08
KLLA0F18304g complement(1689187..1689897) similar to sp|P48240 S...    51   2e-07
AFR109W [3301] [Homologous to ScYGR158C (MTR3) - SH] complement(...    49   6e-07
Kwal_23.3969                                                           48   1e-06
Scas_621.17                                                            48   2e-06
CAGL0G03113g complement(289747..290448) similar to sp|P53256 Sac...    46   5e-06
YGR232W (NAS6) [2180] chr7 (953961..954647) Protein interacting ...    32   0.27 
Kwal_47.17193                                                          32   0.39 
CAGL0E03223g complement(297800..298546) similar to sp|P48240 Sac...    32   0.44 
AAR035C [221] [Homologous to ScYGR095C (RRP46) - SH] (406091..40...    32   0.51 
YGR158C (MTR3) [2112] chr7 complement(805272..806024) Protein in...    31   0.60 
Sklu_2413.9 YPR046W, Contig c2413 24913-25446 reverse complement       28   5.7  

>ACR035W [1083] [Homologous to ScYGR195W (SKI6) - SH]
           complement(422233..422973) [741 bp, 246 aa]
          Length = 246

 Score =  500 bits (1287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/242 (100%), Positives = 242/242 (100%)

Query: 1   MFKTEIYSPEGLRLDGRRWNELRRFECSINTHPTAADGSSYLEQGNNKLITLVTGPHEPA 60
           MFKTEIYSPEGLRLDGRRWNELRRFECSINTHPTAADGSSYLEQGNNKLITLVTGPHEPA
Sbjct: 1   MFKTEIYSPEGLRLDGRRWNELRRFECSINTHPTAADGSSYLEQGNNKLITLVTGPHEPA 60

Query: 61  LRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERRILEMQTALVRTFEKNVMLQLYPRT 120
           LRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERRILEMQTALVRTFEKNVMLQLYPRT
Sbjct: 61  LRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERRILEMQTALVRTFEKNVMLQLYPRT 120

Query: 121 AIDVQVHVLQNDGGVLGSMINGITLALIDAGIAMYEYISGISVGLYDTTPLLDLNRLEEQ 180
           AIDVQVHVLQNDGGVLGSMINGITLALIDAGIAMYEYISGISVGLYDTTPLLDLNRLEEQ
Sbjct: 121 AIDVQVHVLQNDGGVLGSMINGITLALIDAGIAMYEYISGISVGLYDTTPLLDLNRLEEQ 180

Query: 181 AMSCFTLGVVGKSEKLSLLLVEDKVPLDRLESVMSLGIAGTHRVRDMMDKVLRQHGKIRL 240
           AMSCFTLGVVGKSEKLSLLLVEDKVPLDRLESVMSLGIAGTHRVRDMMDKVLRQHGKIRL
Sbjct: 181 AMSCFTLGVVGKSEKLSLLLVEDKVPLDRLESVMSLGIAGTHRVRDMMDKVLRQHGKIRL 240

Query: 241 EN 242
           EN
Sbjct: 241 EN 242

>Sklu_1267.2 YGR195W, Contig c1267 529-1350
          Length = 273

 Score =  418 bits (1075), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 194/242 (80%), Positives = 219/242 (90%)

Query: 1   MFKTEIYSPEGLRLDGRRWNELRRFECSINTHPTAADGSSYLEQGNNKLITLVTGPHEPA 60
           M + EIYSPEGLRLDGRRWNELRRF+CSINTHP AADGSSYLEQGNNK+ITLV GP EPA
Sbjct: 28  MSRLEIYSPEGLRLDGRRWNELRRFDCSINTHPNAADGSSYLEQGNNKIITLVNGPQEPA 87

Query: 61  LRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERRILEMQTALVRTFEKNVMLQLYPRT 120
           LRSQ NPS AT+ VTVN+TKF+  ERSK+ HKNERR+LEMQT+LVRTFEKNVMLQLYPRT
Sbjct: 88  LRSQTNPSHATMNVTVNITKFSKMERSKSSHKNERRVLEMQTSLVRTFEKNVMLQLYPRT 147

Query: 121 AIDVQVHVLQNDGGVLGSMINGITLALIDAGIAMYEYISGISVGLYDTTPLLDLNRLEEQ 180
            ID+Q+HVLQ DGG++G++INGITLALIDAGIAMY+YISG+S+GLYDTTPLLDLN LEE 
Sbjct: 148 LIDIQIHVLQQDGGIMGALINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSLEEN 207

Query: 181 AMSCFTLGVVGKSEKLSLLLVEDKVPLDRLESVMSLGIAGTHRVRDMMDKVLRQHGKIRL 240
           AMS  TLGVVGKSEKLSLLLVEDKVPLDR ESV+++GIAG H +RD+MDK LR+HG+ RL
Sbjct: 208 AMSSITLGVVGKSEKLSLLLVEDKVPLDRFESVLAIGIAGAHIIRDLMDKELRRHGEKRL 267

Query: 241 EN 242
            N
Sbjct: 268 TN 269

>KLLA0D09625g complement(813773..814510) highly similar to sp|P46948
           Saccharomyces cerevisiae YGR195w SKI6 3 -5
           exoribonuclease required for 3 end formation of 5.8S
           rRNA singleton, start by similarity
          Length = 245

 Score =  408 bits (1048), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 188/242 (77%), Positives = 216/242 (89%)

Query: 1   MFKTEIYSPEGLRLDGRRWNELRRFECSINTHPTAADGSSYLEQGNNKLITLVTGPHEPA 60
           M + EIYSPEGLR+DGRRWNELR F CSINTHP AADGSSYLEQGNNK+ITLV GP EP+
Sbjct: 1   MSRFEIYSPEGLRVDGRRWNELRSFNCSINTHPNAADGSSYLEQGNNKIITLVAGPQEPS 60

Query: 61  LRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERRILEMQTALVRTFEKNVMLQLYPRT 120
            RSQVN  +ATL+VT+N+TKFA  ERSK+ HKNERR LE Q +LVRTFEKN+ML LYPRT
Sbjct: 61  SRSQVNTKQATLSVTINLTKFAKMERSKSSHKNERRTLEWQASLVRTFEKNLMLHLYPRT 120

Query: 121 AIDVQVHVLQNDGGVLGSMINGITLALIDAGIAMYEYISGISVGLYDTTPLLDLNRLEEQ 180
           +IDVQVH LQ DGG+LG+M+NGITLALIDAGIAMY+++SG+SVGLYDTTPLLDLN LEE 
Sbjct: 121 SIDVQVHALQLDGGILGAMLNGITLALIDAGIAMYDFVSGVSVGLYDTTPLLDLNSLEEN 180

Query: 181 AMSCFTLGVVGKSEKLSLLLVEDKVPLDRLESVMSLGIAGTHRVRDMMDKVLRQHGKIRL 240
           AMS  T+G +GKSEKLSLL+VEDKVPLDRLESVM++GIAGTHR+RD+MDK LR+HGK R+
Sbjct: 181 AMSSVTIGTIGKSEKLSLLMVEDKVPLDRLESVMAIGIAGTHRIRDLMDKELRKHGKTRV 240

Query: 241 EN 242
           EN
Sbjct: 241 EN 242

>Kwal_33.15453
          Length = 245

 Score =  404 bits (1038), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 185/242 (76%), Positives = 219/242 (90%)

Query: 1   MFKTEIYSPEGLRLDGRRWNELRRFECSINTHPTAADGSSYLEQGNNKLITLVTGPHEPA 60
           M + EIYSPEGLR+DGRRWNELRR EC+INTH  A+DGSSYLEQGNNK+ITLV GP EP 
Sbjct: 1   MSRLEIYSPEGLRVDGRRWNELRRLECAINTHANASDGSSYLEQGNNKIITLVNGPQEPK 60

Query: 61  LRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERRILEMQTALVRTFEKNVMLQLYPRT 120
           LRSQ+N ++ATL+V VN+T+F+  ERSK+ HKNERR+LEMQTALVRTFEKNVML LYPRT
Sbjct: 61  LRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERRVLEMQTALVRTFEKNVMLHLYPRT 120

Query: 121 AIDVQVHVLQNDGGVLGSMINGITLALIDAGIAMYEYISGISVGLYDTTPLLDLNRLEEQ 180
            ID+Q+HVLQ DGG++GS+INGITLALIDAGIAMY+YISG+S+GLYDTTPLLDLN +EE 
Sbjct: 121 QIDIQIHVLQQDGGLMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSVEEN 180

Query: 181 AMSCFTLGVVGKSEKLSLLLVEDKVPLDRLESVMSLGIAGTHRVRDMMDKVLRQHGKIRL 240
           AMS  TLGVVGKSEKLSLLLVEDK+PLDRLESV+++GIAG+HR+R++MD+ LR+HG+ RL
Sbjct: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLESVLAIGIAGSHRIRELMDQELRKHGEKRL 240

Query: 241 EN 242
            N
Sbjct: 241 AN 242

>Scas_647.7
          Length = 246

 Score =  398 bits (1023), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 183/242 (75%), Positives = 216/242 (89%)

Query: 1   MFKTEIYSPEGLRLDGRRWNELRRFECSINTHPTAADGSSYLEQGNNKLITLVTGPHEPA 60
           M + EIYSPEGLRLDGRRWNELRRFECSINTH  A+DGSSYLEQGNNK+ITLV GP EP 
Sbjct: 1   MSRLEIYSPEGLRLDGRRWNELRRFECSINTHSHASDGSSYLEQGNNKVITLVKGPKEPT 60

Query: 61  LRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERRILEMQTALVRTFEKNVMLQLYPRT 120
           LRSQ++  KA L ++VN+T+F+  ERSK+ HKNERR+LEMQTAL+RTFEKNVML +YPRT
Sbjct: 61  LRSQMDTEKAILKISVNITQFSKFERSKSSHKNERRVLEMQTALIRTFEKNVMLNIYPRT 120

Query: 121 AIDVQVHVLQNDGGVLGSMINGITLALIDAGIAMYEYISGISVGLYDTTPLLDLNRLEEQ 180
            ID++VHVLQ DGG++GS+INGITLALIDAGIAMY+YISG+S+GLYDTTPLLD+N LEE 
Sbjct: 121 LIDIEVHVLQQDGGIMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDVNSLEEN 180

Query: 181 AMSCFTLGVVGKSEKLSLLLVEDKVPLDRLESVMSLGIAGTHRVRDMMDKVLRQHGKIRL 240
           AMS  TLGVVGKSEKLSLLLVEDK+PLDRLE+V+++GIAG HRVRD+MD+ LR+H + R+
Sbjct: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLETVLAIGIAGAHRVRDLMDEELRKHAEKRV 240

Query: 241 EN 242
            N
Sbjct: 241 AN 242

>YGR195W (SKI6) [2145] chr7 (888885..889625) Component of the
           exosome 3'-5' exoribonuclease complex involved in 3'
           processing of ribosomal 5.8S rRNA, of snoRNAs and of U4
           snRNA, and in degradation of poly(A)- mRNAs, confers
           antiviral activity by repressing replication of
           double-stranded RNA viruses [741 bp, 246 aa]
          Length = 246

 Score =  392 bits (1006), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 181/242 (74%), Positives = 215/242 (88%)

Query: 1   MFKTEIYSPEGLRLDGRRWNELRRFECSINTHPTAADGSSYLEQGNNKLITLVTGPHEPA 60
           M + EIYSPEGLRLDGRRWNELRRFE SINTHP AADGSSY+EQGNNK+ITLV GP EP 
Sbjct: 1   MSRLEIYSPEGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKIITLVKGPKEPR 60

Query: 61  LRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERRILEMQTALVRTFEKNVMLQLYPRT 120
           L+SQ++ SKA L V+VN+TKF+  ERSK+ HKNERR+LE+QT+LVR FEKNVML +YPRT
Sbjct: 61  LKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQTSLVRMFEKNVMLNIYPRT 120

Query: 121 AIDVQVHVLQNDGGVLGSMINGITLALIDAGIAMYEYISGISVGLYDTTPLLDLNRLEEQ 180
            ID+++HVL+ DGG++GS+INGITLALIDAGI+M++YISGISVGLYDTTPLLD N LEE 
Sbjct: 121 VIDIEIHVLEQDGGIMGSLINGITLALIDAGISMFDYISGISVGLYDTTPLLDTNSLEEN 180

Query: 181 AMSCFTLGVVGKSEKLSLLLVEDKVPLDRLESVMSLGIAGTHRVRDMMDKVLRQHGKIRL 240
           AMS  TLGVVGKSEKLSLLLVEDK+PLDRLE+V+++GIAG HRVRD+MD+ LR+H + R+
Sbjct: 181 AMSTVTLGVVGKSEKLSLLLVEDKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRV 240

Query: 241 EN 242
            N
Sbjct: 241 SN 242

>CAGL0G09317g complement(890158..890898) highly similar to sp|P46948
           Saccharomyces cerevisiae YGR195w SKI6 3-5
           exoribonuclease required for 3 end formation of 5.8S
           rRNA, start by similarity
          Length = 246

 Score =  390 bits (1001), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 177/242 (73%), Positives = 214/242 (88%)

Query: 1   MFKTEIYSPEGLRLDGRRWNELRRFECSINTHPTAADGSSYLEQGNNKLITLVTGPHEPA 60
           M + EIYSPEGLRLDGRRWNELRRFE +INTHP AADGSSYLEQGNNK+ITLV GP EP 
Sbjct: 1   MSRVEIYSPEGLRLDGRRWNELRRFESAINTHPHAADGSSYLEQGNNKVITLVKGPKEPT 60

Query: 61  LRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERRILEMQTALVRTFEKNVMLQLYPRT 120
           L+SQ++  KA L VTVN+TKF+  ERSK+ HKNERR+LEMQTALVRTFEKNVML +YPRT
Sbjct: 61  LKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERRVLEMQTALVRTFEKNVMLHVYPRT 120

Query: 121 AIDVQVHVLQNDGGVLGSMINGITLALIDAGIAMYEYISGISVGLYDTTPLLDLNRLEEQ 180
            ID+++HVLQ DGG++G+++NGI+LALIDAGIAMY+Y+SGISVGLYDTTPLLD+N LEE 
Sbjct: 121 LIDIEIHVLQQDGGIMGTLLNGISLALIDAGIAMYDYVSGISVGLYDTTPLLDINSLEEN 180

Query: 181 AMSCFTLGVVGKSEKLSLLLVEDKVPLDRLESVMSLGIAGTHRVRDMMDKVLRQHGKIRL 240
           AMS  TLGVVGKSEKLSLL +EDK+PLDR+E+V+++GIAG HR+RD+M++ +R H + R+
Sbjct: 181 AMSAVTLGVVGKSEKLSLLQIEDKIPLDRIENVLAIGIAGAHRIRDLMEQEIRAHAEKRV 240

Query: 241 EN 242
            N
Sbjct: 241 AN 242

>Scas_716.30
          Length = 228

 Score = 55.8 bits (133), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 62/140 (44%), Gaps = 20/140 (14%)

Query: 34  TAADGSSYLEQGNNKLITLVTGPHEPALRSQVNPSKATLTVTVNMTKFAAAERSKTGHKN 93
           T  DGSS +E    K+I  VTGP EP  R ++ P++  L + +         R   G  N
Sbjct: 11  TKVDGSSLIESKQTKIICSVTGPIEPKSRQEL-PTQLALEIII---------RPAAGVPN 60

Query: 94  ERRILEMQTALVRTFEKNVMLQLYPRTAIDVQVHVLQNDGGV--------LGSMINGITL 145
            R  L M+  L       +   LYPR    + + +L N G          L + IN   +
Sbjct: 61  TREKL-MEDKLRAVITPIITRYLYPRQLCQITLQIL-NSGESELEFAQRELATCINATLI 118

Query: 146 ALIDAGIAMYEYISGISVGL 165
           ALIDAGIA+    + + + L
Sbjct: 119 ALIDAGIALNSMCACVPIAL 138

>KLLA0D14993g complement(1266752..1267429) similar to sp|P53256
           Saccharomyces cerevisiae YGR095c RRP46 involved in rRNA
           processing singleton, hypothetical start
          Length = 225

 Score = 54.7 bits (130), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 72/159 (45%), Gaps = 17/159 (10%)

Query: 37  DGSSYLEQGNNKLITLVTGPHEPALRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERR 96
           DGSS +     K+I  V+GP EP  R ++ P++  L + V   +   + R K      R 
Sbjct: 12  DGSSVVSNSGTKVICSVSGPMEPKSRQEL-PTQLALEIIVKPAEGVQSTREKLMEDQIRS 70

Query: 97  ILEMQTALVRTFEKNVMLQLYPRTAIDVQVHVLQ----NDGGV--LGSMINGITLALIDA 150
           +L   T ++  +       L+PR  + + + VL+     D  V  +   +N   LAL+DA
Sbjct: 71  VL---TPVLARY-------LHPRQFVQICLQVLEAGESRDYTVKEVSVCVNAAVLALVDA 120

Query: 151 GIAMYEYISGISVGLYDTTPLLDLNRLEEQAMSCFTLGV 189
           G+ +    SG  +G+      L +N  E Q   C ++ V
Sbjct: 121 GVPLLSMCSGTCIGITTEGKQLVVNPTESQLAKCESVHV 159

>Sklu_1989.1 YGR095C, Contig c1989 348-1019
          Length = 223

 Score = 54.3 bits (129), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 61/138 (44%), Gaps = 18/138 (13%)

Query: 37  DGSSYLEQGNNKLITLVTGPHEPALRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERR 96
           DGSS +E    K+I  VTGP EP  R ++ P++  L + V  +K     R K      R 
Sbjct: 13  DGSSQVECSATKVICSVTGPVEPKARQEL-PTQLALEIVVRPSKGVPNTREKLMEDKIRG 71

Query: 97  ILEMQTALVRTFEKNVMLQLYPRTAIDVQVHVLQNDGG-------VLGSMINGITLALID 149
           +L     LVR         LYPR    +   VL++           LG  IN   LAL+D
Sbjct: 72  VLT--PVLVRY--------LYPRQLCQLTFQVLESGESEEQYTVKELGCCINAAYLALVD 121

Query: 150 AGIAMYEYISGISVGLYD 167
           AGIA+      + + + +
Sbjct: 122 AGIALKSSFVSVPICILE 139

>YGR095C (RRP46) [2055] chr7 complement(675673..676344) Protein
           component of the exosome 3'-5' exoribonuclease complex
           involved in 3'end processing of multiple small RNA
           species [672 bp, 223 aa]
          Length = 223

 Score = 53.5 bits (127), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 18/151 (11%)

Query: 37  DGSSYLEQGNNKLITLVTGPHEPALRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERR 96
           DGSS     + K+I  VTGP EP  R ++ P++  L + V   K  A  R K      R 
Sbjct: 14  DGSSEFVSQDTKVICSVTGPIEPKARQEL-PTQLALEIIVRPAKGVATTREKVLEDKLRA 72

Query: 97  ILEMQTALVRTFEKNVMLQLYPRTAIDVQVHVLQNDGG-------VLGSMINGITLALID 149
           +L   T L+           YPR    +   +L++           L   IN   LAL+D
Sbjct: 73  VL---TPLITR-------HCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVD 122

Query: 150 AGIAMYEYISGISVGLYDTTPLLDLNRLEEQ 180
           AGIA+    + I + +   T  + ++   EQ
Sbjct: 123 AGIALNSMCASIPIAIIKDTSDIIVDPTAEQ 153

>Sklu_1879.1 YGR158C, Contig c1879 329-1045 reverse complement
          Length = 238

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 70/144 (48%), Gaps = 33/144 (22%)

Query: 36  ADGSSYLE-------QGNNKLITLVTGPHEPALRSQVNPSKATLTVT---VNMTKFAAAE 85
           ++GSSYLE       Q +  LIT V GP    +R     S+A+LT+    V + KF   E
Sbjct: 51  SNGSSYLEVTDENKTQYHALLITSVYGPR--PIRGSFT-SRASLTIQFKEVTLEKFTTGE 107

Query: 86  RSKTGHKNERRILEMQTALVRTFEKNVMLQLYPRTAIDVQVHVLQND---------GGVL 136
                      I E+   L   F   V L+ YP++ ID+ ++++Q+            V+
Sbjct: 108 -----------IKEVCNFLTNIFNAVVNLERYPKSGIDIFLNLIQHSSTDNQETDIASVI 156

Query: 137 GSMINGITLALIDAGIAMYEYISG 160
            + INGITLAL +AGI + + +S 
Sbjct: 157 PTCINGITLALTNAGIEILDMVSA 180

>KLLA0F18304g complement(1689187..1689897) similar to sp|P48240
           Saccharomyces cerevisiae YGR158c MTR3 involved in mRNA
           transport singleton, start by similarity
          Length = 236

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 67/140 (47%), Gaps = 22/140 (15%)

Query: 34  TAADGSSYLE--QGNNKLITLVTGPHEP-ALRSQVNPSKATLTVTVNMTKFAAAERSKTG 90
           T A+GSSYLE   G +  + +++    P  LR     SKA++++                
Sbjct: 53  TNANGSSYLEYMDGTSDQVLVMSSVFGPRPLRGSFQ-SKASVSIQFKEVTLE-------- 103

Query: 91  HKNERRILEMQTALVRTFEKNVMLQLYPRTAIDVQVHVLQNDGG----------VLGSMI 140
           H N   I E+ T L   F   + ++ YP++ ID+ + ++Q+             +L + I
Sbjct: 104 HLNTGEIKEICTFLTNVFNAVINVEKYPKSGIDIFIDLIQHSNSNPTEEANIVNILPTCI 163

Query: 141 NGITLALIDAGIAMYEYISG 160
           N IT+AL+DAGI + + +S 
Sbjct: 164 NSITMALVDAGIEIIDLVSA 183

>AFR109W [3301] [Homologous to ScYGR158C (MTR3) - SH]
           complement(632965..633678) [714 bp, 237 aa]
          Length = 237

 Score = 49.3 bits (116), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 67/139 (48%), Gaps = 25/139 (17%)

Query: 36  ADGSSYLE----QGNNKLITLVTGPHEPALRSQVNPSKATLTVTVNMTKFAAAERSKTGH 91
           A+GSSYLE      N  L+T   GP    +R     S+A ++V     K    ER  +G 
Sbjct: 54  ANGSSYLEVKAETHNTLLVTTAYGPR--PIRGSFT-SRAAISVHF---KEVTLERWDSGE 107

Query: 92  KNERRILEMQTALVRTFEKNVMLQLYPRTAIDVQVHVLQ----------NDGGVLGSMIN 141
                + EM   L   F   + ++ YP++ ID+ ++++Q          N   VL   I+
Sbjct: 108 -----VTEMCNFLNTVFSAAINVERYPKSGIDIFLNLIQHSNVRDDKTLNLAEVLPDCIS 162

Query: 142 GITLALIDAGIAMYEYISG 160
           GITLAL+DAGI + + ++ 
Sbjct: 163 GITLALMDAGIELKDVVAA 181

>Kwal_23.3969
          Length = 224

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 59/136 (43%), Gaps = 18/136 (13%)

Query: 37  DGSSYLEQGNNKLITLVTGPHEPALRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERR 96
           DGS  ++ G   ++  VTGP EP  R ++ PS+  L + V   K     R K      R 
Sbjct: 13  DGSCKIQCGETSVLCSVTGPIEPKARQEL-PSQLALEIVVRPCKGVPNTREKLLEDQIRG 71

Query: 97  ILEMQTALVRTFEKNVMLQLYPRTAIDVQVHVLQN-------DGGVLGSMINGITLALID 149
           +L   T ++  +       LYPR    +   +L++           L S IN   LALID
Sbjct: 72  VL---TPILARY-------LYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLALID 121

Query: 150 AGIAMYEYISGISVGL 165
           +GI +    + + + +
Sbjct: 122 SGIGLQSSFASVCLSV 137

>Scas_621.17
          Length = 239

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 66/129 (51%), Gaps = 15/129 (11%)

Query: 36  ADGSSYLEQGNNKLITLVTGPHEPALRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNER 95
            +GS+ +E     L+T V GP   ++R     S+ T+T+ +   K    E  +T      
Sbjct: 56  CNGSTLIESSKFSLLTSVYGPK--SIRGSFT-SQGTITIQL---KNGVVENYQT-----T 104

Query: 96  RILEMQTALVRTFEKNVMLQLYPRTAIDVQVHVLQNDGGVLGSMIN----GITLALIDAG 151
            + E+ + LV  F   V L+ YP++ ID+ V+++ +  G +  +I     GI LAL+D G
Sbjct: 105 ELKEVSSWLVGIFNSVVNLENYPKSGIDIFVNLIIDKQGDISKLIPFLIMGICLALVDGG 164

Query: 152 IAMYEYISG 160
           I + + ++G
Sbjct: 165 IEIIDIVTG 173

>CAGL0G03113g complement(289747..290448) similar to sp|P53256
           Saccharomyces cerevisiae YGR095c RRP46 involved in rRNA
           processing, hypothetical start
          Length = 233

 Score = 46.2 bits (108), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 62/138 (44%), Gaps = 18/138 (13%)

Query: 37  DGSSYLEQGNNKLITLVTGPHEPALRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERR 96
           DGS+ L   +  ++  VTGP EP  R ++ P++  L V V   K     R K      R 
Sbjct: 16  DGSAKLLMNSTNVLCAVTGPVEPKARQEL-PTEMALEVIVRPAKGVPTPREKYLEDKIRA 74

Query: 97  ILEMQTALVRTFEKNVMLQLYPRTAIDVQVHVLQ-------NDGGVLGSMINGITLALID 149
           I    T L+   +       YPR    +   +++       ++   L + +N   LAL++
Sbjct: 75  IF---TPLITRHK-------YPRQLCQITCQIMEAGENEQLHNQKELSACVNSALLALVN 124

Query: 150 AGIAMYEYISGISVGLYD 167
           AG+A+ +  + +++ + D
Sbjct: 125 AGVALNDLAAAVTIAVID 142

>YGR232W (NAS6) [2180] chr7 (953961..954647) Protein interacting
           with regulatory particle of the 26S proteasome [687 bp,
           228 aa]
          Length = 228

 Score = 32.3 bits (72), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 11/65 (16%)

Query: 165 LYDTTPLLDLNRLEEQAMSCFTLGVVGKSEKLSLLLVE-----------DKVPLDRLESV 213
           LYD     DLN++  Q ++C  L V  K  ++S  L+E           +++PL R  SV
Sbjct: 91  LYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASV 150

Query: 214 MSLGI 218
            SL +
Sbjct: 151 GSLKL 155

>Kwal_47.17193
          Length = 555

 Score = 32.0 bits (71), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%)

Query: 148 IDAGIAMYEYISGISVGLYDTTPLLDLNRLEEQAMSCFTLGVVGKSEKLSLLLVEDKVP 206
           IDA I  Y++I+G S    +    L     +E A   F   VVG + K+S   V+++VP
Sbjct: 457 IDAKINEYQWITGCSPMDLEQPRALYEKVYDESAKQRFIDNVVGHTSKISAPHVKERVP 515

>CAGL0E03223g complement(297800..298546) similar to sp|P48240
           Saccharomyces cerevisiae YGR158c MTR3 involved in mRNA
           transport, start by similarity
          Length = 248

 Score = 31.6 bits (70), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 56/125 (44%), Gaps = 30/125 (24%)

Query: 49  LITLVTGPHEPALRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERRILEMQTALVRTF 108
           LIT V GP   ++R     S+A+L++ +   K    E+ ++     R + E+   L   F
Sbjct: 71  LITSVYGPK--SVRGSFT-SQASLSIQL---KNGLLEKYES-----RELKEVANFLTSIF 119

Query: 109 EKNVMLQLYPRTAIDVQVHVL-------------------QNDGGVLGSMINGITLALID 149
              + L+ YP++ ID+ +++                     N   +L   I+ IT+ALID
Sbjct: 120 NSVINLKRYPKSGIDIFIYITYEKSLENFKEQEPAAPVRKSNIYKILPHCISSITMALID 179

Query: 150 AGIAM 154
           A I +
Sbjct: 180 ADIEI 184

>AAR035C [221] [Homologous to ScYGR095C (RRP46) - SH]
           (406091..406849) [759 bp, 252 aa]
          Length = 252

 Score = 31.6 bits (70), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 38/97 (39%), Gaps = 11/97 (11%)

Query: 37  DGSSYLEQGNNKLITLVTGPHEPALRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERR 96
           DGSS         I  V+GP EP  R ++ P    L V V         R K      R 
Sbjct: 48  DGSSKFSTAAASAICGVSGPIEPKARQEI-PQHLALDVIVRPAAGPPTTREKLLEDKVRA 106

Query: 97  ILEMQTALVRTFEKNVMLQLYPRTAIDVQVHVLQNDG 133
            +   T +V TF       L+PR    + + VL++ G
Sbjct: 107 TI---TPVVETF-------LHPRQLCQITLQVLKSVG 133

>YGR158C (MTR3) [2112] chr7 complement(805272..806024) Protein
           involved in mRNA transport, component of the exosome
           complex responsible for 3'-5' degradation of mRNA and
           for 3'-end processing of multiple small RNA species [753
           bp, 250 aa]
          Length = 250

 Score = 31.2 bits (69), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 58/128 (45%), Gaps = 31/128 (24%)

Query: 49  LITLVTGPHEPALRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERRILEMQTALVRTF 108
           LIT V GP   ++R     S+ T+++ +   K    E+  T   NE +  E+ + L+  F
Sbjct: 73  LITAVYGPR--SIRGSFT-SQGTISIQL---KNGLLEKYNT---NELK--EVSSFLMGIF 121

Query: 109 EKNVMLQLYPRTAIDVQVHVL---------QND-----------GGVLGSMINGITLALI 148
              V L  YP++ ID+ V++          Q+D             ++   I  ITLAL 
Sbjct: 122 NSVVNLSRYPKSGIDIFVYLTYDKDLTNNPQDDDSQSKMMSSQISSLIPHCITSITLALA 181

Query: 149 DAGIAMYE 156
           DAGI + +
Sbjct: 182 DAGIELVD 189

>Sklu_2413.9 YPR046W, Contig c2413 24913-25446 reverse complement
          Length = 177

 Score = 28.1 bits (61), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 5/59 (8%)

Query: 56  PHEPALRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERRILEMQTALVRTFEKNVML 114
           P +P L   +   +++LT+T+ M K  A      GH+N     E+ T L +  E+N  L
Sbjct: 35  PLDPTLLETLKQFQSSLTMTLPMLKTVAHGAGNEGHEN-----ELDTRLFKLMEENYKL 88

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,152,133
Number of extensions: 279459
Number of successful extensions: 714
Number of sequences better than 10.0: 26
Number of HSP's gapped: 701
Number of HSP's successfully gapped: 26
Length of query: 242
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 143
Effective length of database: 13,168,927
Effective search space: 1883156561
Effective search space used: 1883156561
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)