Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACR034W39737219750.0
KLLA0D09647g40237311461e-156
Kwal_33.1544939637411231e-152
YJR013W40337211011e-149
Scas_647.642338510521e-141
CAGL0B03905g43138310201e-136
KLLA0E17325g75481682.0
YMR251W36654672.3
AGR055C50267638.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR034W
         (390 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR034W [1082] [Homologous to ScYJR013W - SH] complement(420791....   765   0.0  
KLLA0D09647g complement(814829..816037) some similarities with s...   446   e-156
Kwal_33.15449                                                         437   e-152
YJR013W (YJR013W) [2916] chr10 (460296..461507) Protein with mod...   428   e-149
Scas_647.6                                                            409   e-141
CAGL0B03905g 385192..386487 similar to sp|P47088 Saccharomyces c...   397   e-136
KLLA0E17325g 1533054..1535318 gi|1351293|sp|P49381|TREA_KLULA Kl...    31   2.0  
YMR251W (YMR251W) [4205] chr13 (772914..774014) Protein of unkno...    30   2.3  
AGR055C [4365] [Homologous to NOHBY] (816615..818123) [1509 bp, ...    29   8.1  

>ACR034W [1082] [Homologous to ScYJR013W - SH]
           complement(420791..421984) [1194 bp, 397 aa]
          Length = 397

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/372 (100%), Positives = 372/372 (100%)

Query: 19  FFSYGIYQDAHFAVKYTDIDYHVFHDAARYVAQGNSPYLRDTYRYTPLLSWMLVPNHWLQ 78
           FFSYGIYQDAHFAVKYTDIDYHVFHDAARYVAQGNSPYLRDTYRYTPLLSWMLVPNHWLQ
Sbjct: 19  FFSYGIYQDAHFAVKYTDIDYHVFHDAARYVAQGNSPYLRDTYRYTPLLSWMLVPNHWLQ 78

Query: 79  WVHFGKFIFVLFDLLAGVMVMNLLGKCGRRRKLILASLWLLNPVVITVSTRGNAESVMAF 138
           WVHFGKFIFVLFDLLAGVMVMNLLGKCGRRRKLILASLWLLNPVVITVSTRGNAESVMAF
Sbjct: 79  WVHFGKFIFVLFDLLAGVMVMNLLGKCGRRRKLILASLWLLNPVVITVSTRGNAESVMAF 138

Query: 139 LIMWFLVHLRNRQFALSGFVYGVAIHFKIYPIIYALPISIYIRSSEGSRWFLRLLTMGIA 198
           LIMWFLVHLRNRQFALSGFVYGVAIHFKIYPIIYALPISIYIRSSEGSRWFLRLLTMGIA
Sbjct: 139 LIMWFLVHLRNRQFALSGFVYGVAIHFKIYPIIYALPISIYIRSSEGSRWFLRLLTMGIA 198

Query: 199 TLATLVGCGIGMYYIYGWEFLEHAYIYHFTRTDHRHNFSLWNMLLYLDSSGVVPTTINWA 258
           TLATLVGCGIGMYYIYGWEFLEHAYIYHFTRTDHRHNFSLWNMLLYLDSSGVVPTTINWA
Sbjct: 199 TLATLVGCGIGMYYIYGWEFLEHAYIYHFTRTDHRHNFSLWNMLLYLDSSGVVPTTINWA 258

Query: 259 EFAFLPQLFICAAVTYVLWEAPTFQNMQCVLFLQTFAFVTYNKVCTSQYFIWYLLFLPSF 318
           EFAFLPQLFICAAVTYVLWEAPTFQNMQCVLFLQTFAFVTYNKVCTSQYFIWYLLFLPSF
Sbjct: 259 EFAFLPQLFICAAVTYVLWEAPTFQNMQCVLFLQTFAFVTYNKVCTSQYFIWYLLFLPSF 318

Query: 319 LLDTTLSGAKGIFLIFLWVGTQAWWLYNGYLLEFEGKNMFYPRLFSACVTFFLANVYLLA 378
           LLDTTLSGAKGIFLIFLWVGTQAWWLYNGYLLEFEGKNMFYPRLFSACVTFFLANVYLLA
Sbjct: 319 LLDTTLSGAKGIFLIFLWVGTQAWWLYNGYLLEFEGKNMFYPRLFSACVTFFLANVYLLA 378

Query: 379 QFILDCRRRNYQ 390
           QFILDCRRRNYQ
Sbjct: 379 QFILDCRRRNYQ 390

>KLLA0D09647g complement(814829..816037) some similarities with
           sp|P47088 Saccharomyces cerevisiae YJR013w singleton,
           hypothetical start
          Length = 402

 Score =  446 bits (1146), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 217/373 (58%), Positives = 286/373 (76%), Gaps = 3/373 (0%)

Query: 19  FFSYGIYQDAHFAVKYTDIDYHVFHDAARYVAQGNSPYLRDTYRYTPLLSWMLVPNHWLQ 78
           FFSYGI+QD+HF VKYTDIDY VFHDAA YV  G SPYLRDTYRYTPLLS++L+PN++L+
Sbjct: 19  FFSYGIFQDSHFDVKYTDIDYFVFHDAAGYVNNGQSPYLRDTYRYTPLLSFLLLPNYYLK 78

Query: 79  WVHFGKFIFVLFDLLAGVMVMNLL-GKCGRRRKLILASLWLLNPVVITVSTRGNAESVMA 137
           W+H GK  FVLFDL+ GVM++ LL G C   ++LILAS+WLLNP+VIT+STRGNAESV+ 
Sbjct: 79  WIHMGKVFFVLFDLITGVMIIKLLQGSCQLTKQLILASIWLLNPIVITISTRGNAESVLC 138

Query: 138 FLIMWFLVHLRNRQFALSGFVYGVAIHFKIYPIIYALPISIYIRSSEGSRWFL-RLLTMG 196
           FLI+  L  L+  +  +SG  YG++IHFKIYPIIYALPI IY+  S  +R  + RL  +G
Sbjct: 139 FLIICALYFLKRDRLLISGLFYGLSIHFKIYPIIYALPIGIYLLLSSHNRNCIWRLFMIG 198

Query: 197 IATLATLVGCGIGMYYIYGWEFLEHAYIYHFTRTDHRHNFSLWNMLLYLDSSGV-VPTTI 255
           I+TL  +      MY +YG EF+EH+Y+YH TRTDHRHNFS+WN++L L+S+G+ +  +I
Sbjct: 199 ISTLIGITAPTYFMYKLYGSEFIEHSYMYHLTRTDHRHNFSIWNLVLLLESAGIHLSQSI 258

Query: 256 NWAEFAFLPQLFICAAVTYVLWEAPTFQNMQCVLFLQTFAFVTYNKVCTSQYFIWYLLFL 315
             ++ AF+PQL +CA + Y+LW++ TF+N+  VLF+QT+AFVT+NKVCTSQYFIWYL+  
Sbjct: 259 ELSKLAFVPQLTLCAVLPYLLWKSQTFENLMNVLFVQTYAFVTFNKVCTSQYFIWYLVLS 318

Query: 316 PSFLLDTTLSGAKGIFLIFLWVGTQAWWLYNGYLLEFEGKNMFYPRLFSACVTFFLANVY 375
           P +  +TT++  KG+  IFLW+ +QA WL   YLLEF+G+N+F+P LF   + FFL NVY
Sbjct: 319 PFYFANTTITWRKGVVCIFLWILSQAVWLSQAYLLEFKGQNVFFPNLFFGNIVFFLINVY 378

Query: 376 LLAQFILDCRRRN 388
           LL  FI D + R 
Sbjct: 379 LLGVFITDIKSRT 391

>Kwal_33.15449
          Length = 396

 Score =  437 bits (1123), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 217/374 (58%), Positives = 283/374 (75%), Gaps = 7/374 (1%)

Query: 19  FFSYGIYQDAHFAVKYTDIDYHVFHDAARYVAQGNSPYLRDTYRYTPLLSWMLVPNHWLQ 78
           FF YG+YQD HF VKYTDIDY VF+DAAR+V  G SPYLRDTYRYTPLLSW+LVPNH+L 
Sbjct: 21  FFLYGMYQDQHFDVKYTDIDYFVFNDAARFVFNGMSPYLRDTYRYTPLLSWLLVPNHYLN 80

Query: 79  WVHFGKFIFVLFDLLAGVMVMNLLGKCGRRRKLILASLWLLNPVVITVSTRGNAESVMAF 138
           W+HFGK +FV+ DLL GVM++ LL    +RR+LILASLWLLN +VIT+STRGNAESV+ F
Sbjct: 81  WIHFGKMVFVVMDLLTGVMILALLEIPNKRRRLILASLWLLNIMVITISTRGNAESVICF 140

Query: 139 LIMWFLVHLRNRQFALSGFVYGVAIHFKIYPIIYALPISIYI--RSSEGSRWFLRLLTMG 196
           L++  L  LR   + L+G V G+AIHFKIYPIIY LPI++YI  +  +G    + ++ +G
Sbjct: 141 LVLLSLYFLRFGNYVLAGAVLGLAIHFKIYPIIYTLPIAVYIYFQKKDG---LVSVVKIG 197

Query: 197 IATLATLVGCGIGMYYIYGWEFLEHAYIYHFTRTDHRHNFSLWNMLLYLDSSGVVPTTIN 256
           ++ +A L      MY+ YG E+LEHAY+YH  RTDHRHNFS+++MLLY +S+  +P    
Sbjct: 198 LSVIAALTFSSYLMYHKYGTEYLEHAYLYHVLRTDHRHNFSVFHMLLYFESA--LPAESY 255

Query: 257 WAEFAFLPQLFICAAVTYVLWEAPTFQNMQCVLFLQTFAFVTYNKVCTSQYFIWYLLFLP 316
           WA+ AFLPQ  I   V  + + + +F N+  VLF+QT+AFVTYNKVCTSQYFIWYL+FLP
Sbjct: 256 WAKLAFLPQAMITLGVVPLCFRSSSFNNLLSVLFIQTYAFVTYNKVCTSQYFIWYLIFLP 315

Query: 317 SFLLDTTLSGAKGIFLIFLWVGTQAWWLYNGYLLEFEGKNMFYPRLFSACVTFFLANVYL 376
            FL  TT++  +GI +  LW+ TQA+WL  GYLLEF+G+N+FYP LF A ++FFL+NV++
Sbjct: 316 FFLAHTTITARRGIAMGALWIATQAFWLLFGYLLEFKGQNVFYPGLFLASLSFFLSNVWI 375

Query: 377 LAQFILDCRRRNYQ 390
           + QFI D  +R+ Q
Sbjct: 376 IGQFINDINKRSLQ 389

>YJR013W (YJR013W) [2916] chr10 (460296..461507) Protein with
           moderate similarity to mannosyltransferase I
           (glycosylphosphatidylinositol mannosyltransferase I, rat
           Pigm), which transfers the first mannose to
           glycosylphosphatidylinositol (GPI) during the
           biosynthesis of GPI membrane anchors [1212 bp, 403 aa]
          Length = 403

 Score =  428 bits (1101), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 223/372 (59%), Positives = 281/372 (75%), Gaps = 5/372 (1%)

Query: 19  FFSYGIYQDAHFAVKYTDIDYHVFHDAARYVAQGNSPYLRDTYRYTPLLSWMLVPNHWLQ 78
           FF +GIYQDA+F V+YTDIDY VFHDAA+YV +G SPY RDTYRYTPLLSW+LVPNH+  
Sbjct: 19  FFLFGIYQDANFKVRYTDIDYFVFHDAAKYVYEGKSPYARDTYRYTPLLSWLLVPNHYFG 78

Query: 79  WVHFGKFIFVLFDLLAGVMVMNLLGKC-GRRRKLILASLWLLNPVVITVSTRGNAESVMA 137
           W H GK IFV+FDL+ G+++M LL +   R+R LIL S+WLLNP+VIT+STRGNAESV+ 
Sbjct: 79  WFHLGKVIFVIFDLVTGLIIMKLLNQAISRKRALILESIWLLNPMVITISTRGNAESVLC 138

Query: 138 FLIMWFLVHLRNRQFALSGFVYGVAIHFKIYPIIYALPISIYI---RSSEGSRWFL-RLL 193
            LIM+ L  L+  ++ L+G +YG++IHFKIYPIIY +PI+I+I   + ++G R  L  LL
Sbjct: 139 CLIMFTLFFLQKSRYTLAGILYGLSIHFKIYPIIYCIPIAIFIYYNKRNQGPRTQLTSLL 198

Query: 194 TMGIATLATLVGCGIGMYYIYGWEFLEHAYIYHFTRTDHRHNFSLWNMLLYLDSSGVVPT 253
            +G++TL TL+GCG  MY IYG+EFL+ AY+YH  RTDHRHNFS+WNMLLYLDS+     
Sbjct: 199 NIGLSTLTTLLGCGWAMYKIYGYEFLDQAYLYHLYRTDHRHNFSVWNMLLYLDSANKENG 258

Query: 254 TINWAEFAFLPQLFICAAVTYVLWEAPTFQNMQCVLFLQTFAFVTYNKVCTSQYFIWYLL 313
             N + +AF+PQL +      + W  PTF N+  VLF+QTFAFVTYNKVCTSQYF+WYL+
Sbjct: 259 ESNLSRYAFVPQLLLVLVTGCLEWWNPTFDNLLRVLFVQTFAFVTYNKVCTSQYFVWYLI 318

Query: 314 FLPSFLLDTTLSGAKGIFLIFLWVGTQAWWLYNGYLLEFEGKNMFYPRLFSACVTFFLAN 373
           FLP +L  T +   KG+ +  LWVGTQ  WL  GY LEFEGKN+FYP LF A V FF+ N
Sbjct: 319 FLPFYLSRTHIGWKKGLLMATLWVGTQGIWLSQGYYLEFEGKNVFYPGLFIASVLFFVTN 378

Query: 374 VYLLAQFILDCR 385
           V+LL QFI D +
Sbjct: 379 VWLLGQFITDIK 390

>Scas_647.6
          Length = 423

 Score =  409 bits (1052), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 208/385 (54%), Positives = 272/385 (70%), Gaps = 20/385 (5%)

Query: 19  FFSYGIYQDAHFAVKYTDIDYHVFHDAARYVAQ-----------GNSPYLRDTYRYTPLL 67
           F+ +GIYQDAHF V+YTDIDY VFHDAA YV +             SPY RDTYRYTPLL
Sbjct: 21  FYLFGIYQDAHFKVRYTDIDYFVFHDAAGYVYEKLINLNSNFPVNGSPYQRDTYRYTPLL 80

Query: 68  SWMLVPNHWLQWVHFGKFIFVLFDLLAGVMVMNLLGKCGRR----RKLILASLWLLNPVV 123
           SW+LVP+H+    H GKF+F++FDL  G+++M +L     +    +  +L+S+WLLNP+V
Sbjct: 81  SWLLVPDHYFDLFHLGKFLFMIFDLFTGIVIMKMLKNISPKISSLKLGLLSSIWLLNPMV 140

Query: 124 ITVSTRGNAESVMAFLIMWFLVHLRNRQFALSGFVYGVAIHFKIYPIIYALPISIYI--- 180
           IT+STRGNAES++ FL+M  L  L+ R++ L+G +YG++IHFKIYPIIY L ISIY+   
Sbjct: 141 ITISTRGNAESILCFLVMLSLYFLQKRRYWLAGIIYGLSIHFKIYPIIYCLAISIYLVCA 200

Query: 181 --RSSEGSRWFLRLLTMGIATLATLVGCGIGMYYIYGWEFLEHAYIYHFTRTDHRHNFSL 238
              ++  S     L+ +G  TL T+VG G  MY IYG+EFL+ AY YH  RTDHRHNFSL
Sbjct: 201 SHNNATVSSKLKNLIIVGATTLFTIVGLGTLMYSIYGFEFLDQAYFYHLYRTDHRHNFSL 260

Query: 239 WNMLLYLDSSGVVPTTINWAEFAFLPQLFICAAVTYVLWEAPTFQNMQCVLFLQTFAFVT 298
           WN+LLY DS+    +    ++F+F PQ+ I   +TY+ +  PTF N+  VLFLQTFAFVT
Sbjct: 261 WNILLYFDSASDPNSVSLLSKFSFAPQMLITIVLTYLEYLQPTFANLLNVLFLQTFAFVT 320

Query: 299 YNKVCTSQYFIWYLLFLPSFLLDTTLSGAKGIFLIFLWVGTQAWWLYNGYLLEFEGKNMF 358
           YNKVCTSQYF+WYL+FLP  L++TT+S  +G+ ++ +WVGTQA WL  GY LEFEG+N+F
Sbjct: 321 YNKVCTSQYFVWYLIFLPFSLINTTISMKRGVAMLLVWVGTQALWLSQGYYLEFEGRNVF 380

Query: 359 YPRLFSACVTFFLANVYLLAQFILD 383
           YP +F   V FF  NV+ L QFI D
Sbjct: 381 YPGIFFGAVAFFAGNVWTLGQFIDD 405

>CAGL0B03905g 385192..386487 similar to sp|P47088 Saccharomyces
           cerevisiae YJR013w, hypothetical start
          Length = 431

 Score =  397 bits (1020), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 206/383 (53%), Positives = 271/383 (70%), Gaps = 15/383 (3%)

Query: 19  FFSYGIYQDAHFAVKYTDIDYHVFHDAARYVAQGNSPYLRDTYRYTPLLSWMLVPNHWLQ 78
           FF +G+YQD HF VKYTDIDY VF+DAA +VA   SPY RDTYRYTPLLSW+L+PNH + 
Sbjct: 20  FFLFGVYQDEHFTVKYTDIDYQVFNDAAWFVAHRKSPYNRDTYRYTPLLSWLLLPNHMIP 79

Query: 79  WVHFGKFIFVLFDLLAGVMVMNLLGKC------GRRRKLILASLWLLNPVVITVSTRGNA 132
           W HFGK IFVL DL  GV+++ +L K       G  R  I+A++WLLNP+VIT+STRGNA
Sbjct: 80  WFHFGKLIFVLCDLATGVLILQMLKKLKSKYRYGTDRMTIMAAIWLLNPMVITISTRGNA 139

Query: 133 ESVMAFLIMWFLVHLRNRQFALSGFVYGVAIHFKIYPIIYALPISIYI------RSSEGS 186
           ESV+ FLI+ FL      Q+ L G ++G++IHFKIYPIIYALPI+IY+      ++    
Sbjct: 140 ESVLCFLILSFLYCFLCEQYLLGGLLFGLSIHFKIYPIIYALPIAIYVAAAHYNKTQSVF 199

Query: 187 RWFLRLLTMGIATLATLVGCGIGMYYIYGWEFLEHAYIYHFTRTDHRHNFSLWNMLLYLD 246
           +   +L  +G +TL  L+   + MY +YG +F++  Y+YH  RTDHRHNFS+WNMLLY +
Sbjct: 200 KSSFKLFLVGFSTLIVLILLTVFMYMLYGDKFIDQTYLYHIYRTDHRHNFSVWNMLLYFN 259

Query: 247 SSGVVPTTINWAEFAFLPQLFICAAVTYVLWEAPTFQNMQC-VLFLQTFAFVTYNKVCTS 305
           S+  +P T   ++F FLPQ+ I  A++      P+   + C VLFL+TFAFVT+NKVCTS
Sbjct: 260 SA--LPKTSELSKFVFLPQMIIVLAISLTQLRRPSSFPLLCNVLFLETFAFVTFNKVCTS 317

Query: 306 QYFIWYLLFLPSFLLDTTLSGAKGIFLIFLWVGTQAWWLYNGYLLEFEGKNMFYPRLFSA 365
           QYFIWYL+FLP  L +T +S  +GI ++ +WV TQA WL  GYLLEFEG+N+FYP LF A
Sbjct: 318 QYFIWYLIFLPFVLYNTRISMRRGIVMLVVWVATQALWLRQGYLLEFEGQNVFYPGLFCA 377

Query: 366 CVTFFLANVYLLAQFILDCRRRN 388
            V FF++N ++L QFI D   +N
Sbjct: 378 SVGFFVSNAWILGQFIEDTIIQN 400

>KLLA0E17325g 1533054..1535318 gi|1351293|sp|P49381|TREA_KLULA
           Kluyveromyces lactis NEUTRAL TREHALASE (ALPHA,
           ALPHA-TREHALASE) (ALPHA, ALPHA-TREHALOSE
           GLUCOHYDROLASE), start by similarity
          Length = 754

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 34/81 (41%), Gaps = 6/81 (7%)

Query: 289 LFLQTFAFVTYNKVCTSQYFIWYLLFLPSFLLDTTLSGAKGIFLIFLWVGTQAW-WLYNG 347
           LFL T AFV YN +   +Y +           +    GA      F  V T+ + W+ + 
Sbjct: 660 LFLMTKAFVDYNGIVVEKYDVTRGTDPHRVDAEYGNQGAD-----FKGVATEGFGWVNSS 714

Query: 348 YLLEFEGKNMFYPRLFSACVT 368
           YLL  +  N F  R    CVT
Sbjct: 715 YLLGMKYMNNFARRALGTCVT 735

>YMR251W (YMR251W) [4205] chr13 (772914..774014) Protein of unknown
           function, putative paralog of Ecm4p, a cell wall
           biogenesis protein [1101 bp, 366 aa]
          Length = 366

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 7/54 (12%)

Query: 188 WFLR-LLTMGIATLATLVGCGIGMYYI--YGWEFLEHAYIYHFTRTDHRHNFSL 238
           W  R L+T  +  LA ++GC +  +++   GW FLE        +T+ RH F +
Sbjct: 48  WAQRTLITRALKGLAPIIGCSVAHWHLDDKGWRFLEEG----DGKTNERHWFDI 97

>AGR055C [4365] [Homologous to NOHBY] (816615..818123) [1509 bp, 502
           aa]
          Length = 502

 Score = 28.9 bits (63), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 6/67 (8%)

Query: 299 YNKVCTSQYFIWYLLFLPSFLLDTTLSGAKGIFLIFLWVG------TQAWWLYNGYLLEF 352
           YN + + +      L LP ++L   LS  +G +L  +W G       +  W Y+ + LE 
Sbjct: 346 YNHMLSIRLPTLAFLGLPRYVLPIRLSETQGSWLARVWSGRISLPSEEVQWKYHEWTLEN 405

Query: 353 EGKNMFY 359
            G+ + Y
Sbjct: 406 NGRGIKY 412

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.333    0.145    0.491 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,284,492
Number of extensions: 525197
Number of successful extensions: 1705
Number of sequences better than 10.0: 13
Number of HSP's gapped: 1737
Number of HSP's successfully gapped: 13
Length of query: 390
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 286
Effective length of database: 12,995,837
Effective search space: 3716809382
Effective search space used: 3716809382
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)
S2: 62 (28.5 bits)