Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACL128C93923656e-47
Sklu_1420.2102921322e-11
Kwal_33.15524102911313e-11
Scas_463.5138891239e-10
YGR206W101931201e-09
CAGL0K00869g11252790.002
KLLA0E16467g10696680.053
ABR004C43932610.83
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL128C
         (92 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL128C [921] [Homologous to ScYGR206W - SH] (126718..126999) [2...   145   6e-47
Sklu_1420.2 YGR206W, Contig c1420 627-935 reverse complement           55   2e-11
Kwal_33.15524                                                          55   3e-11
Scas_463.5                                                             52   9e-10
YGR206W (YGR206W) [2156] chr7 (910435..910740) Protein of unknow...    51   1e-09
CAGL0K00869g complement(88607..88945) weakly similar to sp|P4293...    35   0.002
KLLA0E16467g complement(1466545..1466865) no similarity, hypothe...    31   0.053
ABR004C [595] [Homologous to ScYKL004W (AUR1) - SH] (402173..403...    28   0.83 

>ACL128C [921] [Homologous to ScYGR206W - SH] (126718..126999)
          [282 bp, 93 aa]
          Length = 93

 Score =  145 bits (365), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 73/92 (79%)

Query: 1  MENKLRKIPLYNAFEGDMXXXXXXXXXXXXXXXXXXXTGEHLAAWDEECRRVLESVQQAR 60
          MENKLRKIPLYNAFEGDM                   TGEHLAAWDEECRRVLESVQQAR
Sbjct: 1  MENKLRKIPLYNAFEGDMPRRRAKLQLAALQIAPAAATGEHLAAWDEECRRVLESVQQAR 60

Query: 61 AQGGEWEAWYEQTYLRKQPPGLLESGTLRPRR 92
          AQGGEWEAWYEQTYLRKQPPGLLESGTLRPRR
Sbjct: 61 AQGGEWEAWYEQTYLRKQPPGLLESGTLRPRR 92

>Sklu_1420.2 YGR206W, Contig c1420 627-935 reverse complement
          Length = 102

 Score = 55.5 bits (132), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 43/92 (46%)

Query: 1  MENKLRKIPLYNAFEGDMXXXXXXXXXXXXXXXXXXXTGEHLAAWDEECRRVLESVQQAR 60
          +E+ LRKIPLYN+ +                      T ++  AW  EC ++ + +    
Sbjct: 5  VEDVLRKIPLYNSQDVRFPQESPPLRLAKLDIPPVTTTRQNFEAWIHECEQLEQDIDART 64

Query: 61 AQGGEWEAWYEQTYLRKQPPGLLESGTLRPRR 92
           +  E++ WY   YL KQPPG+ E+  L P R
Sbjct: 65 EKSSEFDQWYAAKYLNKQPPGIGETTILSPTR 96

>Kwal_33.15524
          Length = 102

 Score = 55.1 bits (131), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 44/91 (48%)

Query: 2  ENKLRKIPLYNAFEGDMXXXXXXXXXXXXXXXXXXXTGEHLAAWDEECRRVLESVQQARA 61
          E+ LR++ + NA    +                    G+HL AW EEC +VL ++Q  + 
Sbjct: 6  EDLLRQVRVVNAHSSILPKAQRKLELAPIELPEITPAGQHLEAWIEECNQVLRTIQLRKE 65

Query: 62 QGGEWEAWYEQTYLRKQPPGLLESGTLRPRR 92
          +   +++WY +   R QPPG+ ES  L P +
Sbjct: 66 KSDHFDSWYSELCNRMQPPGMSESRVLSPSK 96

>Scas_463.5
          Length = 138

 Score = 52.0 bits (123), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 39/89 (43%), Gaps = 1/89 (1%)

Query: 5   LRKIPLYNAFEGDMXXXXXXXXXXXXXXXXXXXTGEHL-AAWDEECRRVLESVQQARAQG 63
           LRK+PLYN F  D                    + E +  +W +EC  +  S Q      
Sbjct: 48  LRKVPLYNKFGPDFPREKLSRVRVPEFRLEPLQSSEEMFQSWHKECDNLTRSCQFHDKGS 107

Query: 64  GEWEAWYEQTYLRKQPPGLLESGTLRPRR 92
             ++ WY  TYL+ +PPG++E   L P +
Sbjct: 108 QMFDKWYFDTYLKNKPPGMIEKNVLSPSK 136

>YGR206W (YGR206W) [2156] chr7 (910435..910740) Protein of unknown
          function [306 bp, 101 aa]
          Length = 101

 Score = 50.8 bits (120), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 1/93 (1%)

Query: 1  MENKLRKIPLYNAFEGDMXXXXXX-XXXXXXXXXXXXXTGEHLAAWDEECRRVLESVQQA 59
          +E  LR+IPLYN +  D                     T + L  W EEC  + +  Q  
Sbjct: 5  VEELLRRIPLYNKYGKDFPQETVTRFQMPEFKLPALQPTRDLLCPWYEECDNITKVCQLH 64

Query: 60 RAQGGEWEAWYEQTYLRKQPPGLLESGTLRPRR 92
           +   +++ WY++ YL K+PPG++ +  L P R
Sbjct: 65 DSSNKKFDQWYKEQYLSKKPPGIVGNTLLSPSR 97

>CAGL0K00869g complement(88607..88945) weakly similar to sp|P42939
           Saccharomyces cerevisiae YGR206w, hypothetical start
          Length = 112

 Score = 35.0 bits (79), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 4/52 (7%)

Query: 45  WDEECRRVLESVQQARAQGGEWEAWYEQTYLRKQPPGLL----ESGTLRPRR 92
           W +EC  ++ + +     G  +E WY + Y+  +PPG++    E   L P +
Sbjct: 54  WYKECDEIIAACEVHDQLGRNFEQWYNEKYISTKPPGMVQGNGEISVLSPSK 105

>KLLA0E16467g complement(1466545..1466865) no similarity,
          hypothetical start
          Length = 106

 Score = 30.8 bits (68), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 43/96 (44%), Gaps = 9/96 (9%)

Query: 1  MENKLRKIPLYNAFEGDMXXXXXXXXXXXXXXXXXXXTG----EHLAAWDEECRRVLESV 56
          M++KLRK+ LY+  E                      T     + +  ++ +   ++   
Sbjct: 1  MDSKLRKVVLYHGVESSEKWPKGRKKLTLPSLQLLPDTDTAELQQVIQFNSDIEELIRQR 60

Query: 57 QQARAQGGEWEAWYEQTYLRKQPPGLLESGTLRPRR 92
          Q+++     ++ WY++TYL  +P GLLE   L P+R
Sbjct: 61 QESKET---FDKWYQETYLASKPKGLLEH--LAPKR 91

>ABR004C [595] [Homologous to ScYKL004W (AUR1) - SH]
          (402173..403492) [1320 bp, 439 aa]
          Length = 439

 Score = 28.1 bits (61), Expect = 0.83,   Method: Composition-based stats.
 Identities = 10/32 (31%), Positives = 18/32 (56%)

Query: 50 RRVLESVQQARAQGGEWEAWYEQTYLRKQPPG 81
          + V+ + QQA         W+E+ +L ++PPG
Sbjct: 2  KTVVLTAQQADTVDSRMPNWFERVFLAQKPPG 33

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,491,944
Number of extensions: 63484
Number of successful extensions: 108
Number of sequences better than 10.0: 8
Number of HSP's gapped: 104
Number of HSP's successfully gapped: 8
Length of query: 92
Length of database: 16,596,109
Length adjustment: 63
Effective length of query: 29
Effective length of database: 14,415,175
Effective search space: 418040075
Effective search space used: 418040075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (25.4 bits)