Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACL019C57556430140.0
Kwal_56.225225135425546e-64
KLLA0C05874g5533945472e-62
YOL013C (HRD1)5514134657e-51
Scas_644.65103744224e-45
CAGL0E02299g5454134219e-45
Scas_248.12602012772e-27
YKL034W (TUL1)758841247e-07
Sklu_2102.1751541193e-06
CAGL0L01947g757561167e-06
KLLA0F25674g757551167e-06
AFR275W753541159e-06
Kwal_26.8099750561131e-05
Scas_625.4761541051e-04
Kwal_27.1054610478962e-04
Kwal_55.1999915296982e-04
AGR034W15973982e-04
Sklu_1676.310156943e-04
Scas_705.41428541013e-04
KLLA0E03960g704601014e-04
AER390W316561004e-04
CAGL0K02563g586531014e-04
YBR062C11585917e-04
KLLA0E16720g30565978e-04
CAGL0M08690g32866979e-04
Scas_625.11274132960.001
CAGL0B05049g147069980.001
CAGL0K08052g30556930.003
Scas_573.9150256940.003
Sklu_2432.9147562930.004
Kwal_26.803066055920.005
Scas_713.4557043920.005
Kwal_56.2390058934910.006
YDR265W (PEX10)33756890.007
YHL010C58551890.010
ABR104W32832870.014
KLLA0E18601g65057880.016
Scas_560.6*11836810.016
CAGL0H10274g11427810.017
KLLA0F18458g14053820.020
CAGL0E01441g71729860.023
KLLA0F25740g51759850.030
YOL138C134170850.034
YOL054W40658840.035
Kwal_55.2120627557830.035
Kwal_26.809052079840.036
Scas_665.139234840.040
AAL030C153993840.048
YDR143C (SAN1)61029830.051
AER016C14781790.058
KLLA0C15697g30452810.078
KLLA0C08756g42758800.100
Sklu_1785.333134790.12
KLLA0E06435g96561800.13
KLLA0F12166g152849800.16
Kwal_14.1287151850790.19
CAGL0I04576g14984750.21
Sklu_2317.249332780.23
Scas_615.1333025770.24
Kwal_55.20318899114770.29
KLLA0E21043g132127770.33
YPR093C28852750.37
KLLA0C14344g151858750.51
Scas_589.13131141740.69
Kwal_55.2205411155690.75
ADL186C136192730.91
Sklu_2416.811055680.92
Sklu_2337.232232721.0
ADL181W10847671.0
AAR049C44358721.1
AGL079C50651721.1
YLR247C155627721.2
Kwal_14.1868135756721.2
AGL217W414108711.2
KLLA0E17787g16227691.3
Sklu_2416.2135333721.3
CAGL0I09988g38786711.4
ABL058C154632702.1
Kwal_56.2311213583662.5
KLLA0A02343g55377692.8
Scas_672.226366673.0
CAGL0J03586g41158683.0
CAGL0E01485g133652693.3
Scas_585.5*10947633.8
CAGL0B02013g112021684.3
Kwal_56.2354396532674.6
Sklu_2148.347576665.6
YOL133W (HRT1)12122635.7
CAGL0I06138g81553666.7
KLLA0F23892g51878657.6
KLLA0C14542g32641647.9
Kwal_23.628545826649.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL019C
         (564 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH] (328044..32...  1165   0.0  
Kwal_56.22522                                                         218   6e-64
KLLA0C05874g complement(520079..521740) weakly similar to sgd|S0...   215   2e-62
YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiqui...   183   7e-51
Scas_644.6                                                            167   4e-45
CAGL0E02299g complement(219009..220646) similar to tr|Q08109 Sac...   166   9e-45
Scas_248.1                                                            111   2e-27
YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing ...    52   7e-07
Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement          50   3e-06
CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces c...    49   7e-06
KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces...    49   7e-06
AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH] complement...    49   9e-06
Kwal_26.8099                                                           48   1e-05
Scas_625.4                                                             45   1e-04
Kwal_27.10546                                                          42   2e-04
Kwal_55.19999                                                          42   2e-04
AGR034W [4344] [Homologous to ScYBR062C - SH] complement(772772....    42   2e-04
Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement         41   3e-04
Scas_705.41                                                            44   3e-04
KLLA0E03960g 369201..371315 some similarities with sp|P22470 Sac...    44   4e-04
AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH] complement...    43   4e-04
CAGL0K02563g complement(230983..232743) similar to sp|P38748 Sac...    44   4e-04
YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein ...    40   7e-04
KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568 S...    42   8e-04
CAGL0M08690g complement(865182..866168) similar to sp|Q05568 Sac...    42   9e-04
Scas_625.11                                                            42   0.001
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    42   0.001
CAGL0K08052g complement(800162..801079) weakly similar to tr|Q06...    40   0.003
Scas_573.9                                                             41   0.003
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              40   0.004
Kwal_26.8030                                                           40   0.005
Scas_713.45                                                            40   0.005
Kwal_56.23900                                                          40   0.006
YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogene...    39   0.007
YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein t...    39   0.010
ABR104W [696] [Homologous to ScYPR093C - SH] complement(574067.....    38   0.014
KLLA0E18601g complement(1645113..1647065) some similarities with...    39   0.016
Scas_560.6*                                                            36   0.016
CAGL0H10274g complement(1003801..1004145) similar to sp|P38239 S...    36   0.017
KLLA0F18458g complement(1697871..1698293) some similarities with...    36   0.020
CAGL0E01441g 135075..137228 weakly similar to sp|P22470 Saccharo...    38   0.023
KLLA0F25740g complement(2389226..2390779) similar to sp|P38748 S...    37   0.030
YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible...    37   0.034
YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required...    37   0.035
Kwal_55.21206                                                          37   0.035
Kwal_26.8090                                                           37   0.036
Scas_665.1                                                             37   0.040
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    37   0.048
YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein tha...    37   0.051
AER016C [2521] [Homologous to ScYDL008W (APC11) - SH] (659572..6...    35   0.058
KLLA0C15697g 1360289..1361203 weakly similar to sgd|S0006297 Sac...    36   0.078
KLLA0C08756g complement(765847..767130) weakly similar to sp|P10...    35   0.100
Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement         35   0.12 
KLLA0E06435g complement(581935..584832) similar to sp|P38164 Sac...    35   0.13 
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    35   0.16 
Kwal_14.1287                                                           35   0.19 
CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces c...    33   0.21 
Sklu_2317.2 YDR143C, Contig c2317 4002-5483                            35   0.23 
Scas_615.13                                                            34   0.24 
Kwal_55.20318                                                          34   0.29 
KLLA0E21043g 1872227..1876192 similar to sgd|S0005498 Saccharomy...    34   0.33 
YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protei...    33   0.37 
KLLA0C14344g 1245226..1249782 similar to sp|Q04781 Saccharomyces...    33   0.51 
Scas_589.13                                                            33   0.69 
Kwal_55.22054                                                          31   0.75 
ADL186C [1555] [Homologous to ScYOL138C - SH] (369322..373407) [...    33   0.91 
Sklu_2416.8 YOL133W, Contig c2416 15124-15456                          31   0.92 
Sklu_2337.2 YPR093C, Contig c2337 3730-4698 reverse complement         32   1.0  
ADL181W [1560] [Homologous to ScYOL133W (HRT1) - SH] complement(...    30   1.0  
AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH] (428904..43...    32   1.1  
AGL079C [4232] [Homologous to ScYHL010C - SH] (557422..558942) [...    32   1.1  
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    32   1.2  
Kwal_14.1868                                                           32   1.2  
AGL217W [4095] [Homologous to ScYOL054W - SH] complement(290043....    32   1.2  
KLLA0E17787g complement(1571018..1571506) similar to sgd|S000216...    31   1.3  
Sklu_2416.2 YOL138C, Contig c2416 613-4674 reverse complement          32   1.3  
CAGL0I09988g complement(951368..952531) similar to tr|Q12161 Sac...    32   1.4  
ABL058C [534] [Homologous to ScYMR247C - SH] (288355..292995) [4...    32   2.1  
Kwal_56.23112                                                          30   2.5  
KLLA0A02343g complement(208673..210334) similar to sgd|S0005687 ...    31   2.8  
Scas_672.2                                                             30   3.0  
CAGL0J03586g complement(341290..342525) similar to sp|P10862 Sac...    31   3.0  
CAGL0E01485g complement(138830..142840) similar to tr|Q08281 Sac...    31   3.3  
Scas_585.5*                                                            29   3.8  
CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharo...    31   4.3  
Kwal_56.23543                                                          30   4.6  
Sklu_2148.3 YNL116W, Contig c2148 7107-8534                            30   5.6  
YOL133W (HRT1) [4690] chr15 (70324..70689) Activator of the Cdc5...    29   5.7  
CAGL0I06138g 585873..588320 weakly similar to sp|P21268 Saccharo...    30   6.7  
KLLA0F23892g complement(2229493..2231049) some similarities with...    30   7.6  
KLLA0C14542g 1272215..1273195 weakly similar to sgd|S0002721 Sac...    29   7.9  
Kwal_23.6285                                                           29   9.8  

>ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH]
           (328044..329771) [1728 bp, 575 aa]
          Length = 575

 Score = 1165 bits (3014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/564 (98%), Positives = 558/564 (98%)

Query: 1   MPREVSWPMWAMFITATYALAGWSAYSCATSFDDPLSALFMASSGVHFVIWGNFLIVHYC 60
           MPREVSWPMWAMFITATYALAGWSAYSCATSFDDPLSALFMASSGVHFVIWGNFLIVHYC
Sbjct: 1   MPREVSWPMWAMFITATYALAGWSAYSCATSFDDPLSALFMASSGVHFVIWGNFLIVHYC 60

Query: 61  LFVWAIIRVLFGQLTAIEYDHIFERLHVVLVTLASIVITMRKTYMAGHMTILFYTLCLVA 120
           LFVWAIIRVLFGQLTAIEYDHIFERLHVVLVTLASIVITMRKTYMAGHMTILFYTLCLVA
Sbjct: 61  LFVWAIIRVLFGQLTAIEYDHIFERLHVVLVTLASIVITMRKTYMAGHMTILFYTLCLVA 120

Query: 121 HWVLRDRMDFVFQVHGTDSSLLGILCSRFMFSLLVLGMVDYKMLKFCVQNTNVDGKRHEL 180
           HWVLRDRMDFVFQVHGTDSSLLGILCSRFMFSLLVLGMVDYKMLKFCVQNTNVDGKRHEL
Sbjct: 121 HWVLRDRMDFVFQVHGTDSSLLGILCSRFMFSLLVLGMVDYKMLKFCVQNTNVDGKRHEL 180

Query: 181 YLMLALSFAQLILDVLHVVLLTSLNLFEMVRSRRTRSANLVYEGGTTXXXXXXEVFILEG 240
           YLMLALSFAQLILDVLHVVLLTSLNLFEMVRSRRTRSANLVYEGGTT      EVFILEG
Sbjct: 181 YLMLALSFAQLILDVLHVVLLTSLNLFEMVRSRRTRSANLVYEGGTTDDDADDEVFILEG 240

Query: 241 KYIYETVFDLTITVLKVILDIIQEVFVPWSITVVYSIFVRSIKAGESFLLVYNYWKNNKK 300
           KYIYETVFDLTITVLKVILDIIQEVFVPWSITVVYSIFVRSIKAGESFLLVYNYWKNNKK
Sbjct: 241 KYIYETVFDLTITVLKVILDIIQEVFVPWSITVVYSIFVRSIKAGESFLLVYNYWKNNKK 300

Query: 301 LYEKLSDVSEEQLDDTDSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMER 360
           LYEKLSDVSEEQLDDTDSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMER
Sbjct: 301 LYEKLSDVSEEQLDDTDSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMER 360

Query: 361 SQTCPICRLSVFANDSNSHATTQAREQTPPDLLQERGIDEHIDVIGMQDMSVQSISLHEG 420
           SQTCPICRLSVFANDSNSHATTQAREQTPPDLLQERGIDEHIDVIGMQDMSVQSISLHEG
Sbjct: 361 SQTCPICRLSVFANDSNSHATTQAREQTPPDLLQERGIDEHIDVIGMQDMSVQSISLHEG 420

Query: 421 TAVRRGTTGNCMNQAYDGGLLSHEERDQAGWVAFPIEFRADNKVFFNLNDSQGDRQWMAS 480
           TAVRRGTTGNCMNQAYDGGLLSHEERDQAGWVAFPIEFRADNKVFFNLNDSQGDRQWMAS
Sbjct: 421 TAVRRGTTGNCMNQAYDGGLLSHEERDQAGWVAFPIEFRADNKVFFNLNDSQGDRQWMAS 480

Query: 481 YTSYPRQNMVNSDDPDNASESHSRIPSPSLPGSLEGTSSQVDVTVSAKDAPANACFVIAT 540
           YTSYPRQNMVNSDDPDNASESHSRIPSPSLPGSLEGTSSQVDVTVSAKDAPANACFVIAT
Sbjct: 481 YTSYPRQNMVNSDDPDNASESHSRIPSPSLPGSLEGTSSQVDVTVSAKDAPANACFVIAT 540

Query: 541 SKLEQTKEVEHLKRKVEELESRVE 564
           SKLEQTKEVEHLKRKVEELESRVE
Sbjct: 541 SKLEQTKEVEHLKRKVEELESRVE 564

>Kwal_56.22522
          Length = 513

 Score =  218 bits (554), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 161/542 (29%), Positives = 262/542 (48%), Gaps = 104/542 (19%)

Query: 45  GVHFVIWGNFLIVHYCLFVWAIIRVLFGQLTAIEYDHIFERLHVVLVTLASIVITMRKTY 104
           G++ ++  NF  V+  L   A+  +LFG+L  +EY+HIFERL   +V    +     ++ 
Sbjct: 45  GLNLILLCNFAAVNGVLLWKALTHLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFSESE 104

Query: 105 MAGHMTILFYTLCL----VAHWVLRDRMDFVFQVHGTDSSLLGILCSRFMFSLLVLGMVD 160
               M+++ ++  L    V HWVLRDR++ VFQ     ++   +L SRF F++ +LG +D
Sbjct: 105 F---MSVMAFSAALIFVKVFHWVLRDRLEHVFQHTDEHTNFARLLLSRFFFNIFLLGFLD 161

Query: 161 YKMLKFCVQNTNVDGKRH------ELYLMLALSFAQLILDVLHVVLLTSLNLFEMVRSRR 214
           ++M KFC+Q T    +         ++LM A+ FA L++DV  V + + +NL E+ + +R
Sbjct: 162 FQMTKFCIQGTRFFSRSGFYSSSLSVHLMFAVEFAMLLVDVTEVAMKSIINLVEVYQCKR 221

Query: 215 TRSANLVYEGGTTXXXXXXEVFILEGKYIYETVFDLTITVLKVILDIIQEVFVPWSITVV 274
           + + +     G            LEGK++YE V  L   + ++ L I+  + +P+S+ ++
Sbjct: 222 SFARDGEDYTG------------LEGKFMYEKVVQLICQLTRMGLHIM--LMMPFSMPLM 267

Query: 275 ---------YSIFVRSIKAGESFLLVYNYWKNNKKLYEKLSDVSEEQLDDTD-SMCIICM 324
                    +++F       +S LL    WK+N+++ EKL DVSE QL  +D  MCI+CM
Sbjct: 268 IAKDILWDAFAVF----HTAKSLLLT---WKSNRQIDEKLPDVSEAQLAASDDKMCIVCM 320

Query: 325 DDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPICRLSVFANDSNSHATTQA 384
           DDML  +E T   ++ K LPC H LH GCLKSWMERSQTCPICR+ VF    N   T+  
Sbjct: 321 DDMLAPSECTNAKQKPKRLPCNHCLHLGCLKSWMERSQTCPICRVPVFDKKGNVVVTSDQ 380

Query: 385 REQTPPDLLQERGIDEHIDVIGMQDMSVQSISLHEGTAVRRGTTGNCMNQAYDGGLLSHE 444
               P                     +V+S +    TA     +    + A    + SH 
Sbjct: 381 TNNQPG-----------------TSSAVESTADETSTAATTSVSSQSSSIAV-TDVPSH- 421

Query: 445 ERDQAGWVAFP-IEFRADNKVFFNLNDSQGDRQWMASYTSYPRQNMVNSDDPD-NASESH 502
              Q GW AFP ++   +  +   + D+ G         +  +  +V  D  +  A E+ 
Sbjct: 422 ---QRGWYAFPTVQVHDEGSIDIKVTDTSG---------AEIKATLVCKDRHEFEAIETD 469

Query: 503 SRIPSPSLPGSLEGTSSQVDVTVSAKDAPANACFVIATSKLEQTKEVEHLKRKVEELESR 562
           ++ P                     K    N C       + Q +++E LKR++ ELE++
Sbjct: 470 AQGPR--------------------KVVVKNDC-------VYQNQDIERLKRRISELENK 502

Query: 563 VE 564
           V+
Sbjct: 503 VD 504

>KLLA0C05874g complement(520079..521740) weakly similar to
           sgd|S0005373 Saccharomyces cerevisiae YOL013c HRD1
           involved in degradation of HMG2P, start by similarity
          Length = 553

 Score =  215 bits (547), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 131/394 (33%), Positives = 205/394 (52%), Gaps = 21/394 (5%)

Query: 17  TYALAGWSAYSCATSFDDPLSALFMASSGVHFVIWGNFLIVHYCLFVWAIIRVLFGQLTA 76
           +Y  A WS + C T+    L A+   + G+H +IWGN  +++  L +  +I +LFGQL  
Sbjct: 33  SYTAAAWSLHYCVTTSFSYLHAMTKITEGIHAMIWGNLFLLNSVLILKGVIHMLFGQLRL 92

Query: 77  IEYDHIFERLHVVLVTLASIVITMRKTYMAGHMTILFYTLCLVAHWVLRDRMDFVFQVHG 136
           IEY+HI ER+   ++TL     +M        +  + +  C   HW+L+DRM+  FQ + 
Sbjct: 93  IEYEHILERISYTVITLLLSCSSMNGLISVMQIHCVLFVCCRTLHWILKDRMEVTFQAND 152

Query: 137 TDSSLLGILCSRFMFSLLVLGMVDYKMLKFCVQNTNVDGKRHELYLMLALS-FAQLILDV 195
              +L  IL SRFMF+LLVL  VD  ++ + V            Y +  +S +A L  D+
Sbjct: 153 MRLTLKDILLSRFMFNLLVLTAVDGIIVAYYVNKILYKSNIDVTYTLFIISQYAILGTDL 212

Query: 196 LHVVLLTSLNLFEMV----RSRRTRSAN-LVYEGGTTXXXXXXEVFI------------L 238
           L V+L T LNLFE+     R+R  R+A+  V E           V I            L
Sbjct: 213 LQVILRTGLNLFELSTIQNRARIRRNADHHVDEPVINHEERPNAVAIEEDEDEDEENAGL 272

Query: 239 EGKYIYETVFDLTITVLKVILDIIQEVFVPWSITVVYSIFVRSIKAGESFLLVYNYWKNN 298
           EGK+IYE + D+ I+ +KVI+      F    + +V ++   +I   +S   ++  WK++
Sbjct: 273 EGKFIYEKLIDVFISTVKVIIKFASS-FSTGRVMMV-TVLWEAITTFKSARGLWKNWKSS 330

Query: 299 KKLYEKLSDVSEEQLDDTD-SMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSW 357
           K L   L D ++ Q++  +  +CI+CM+D LP+ +     ++ K+LPC H LH  CLK+W
Sbjct: 331 KSLDASLMDATDIQIESGEIDICIVCMEDFLPSHQRKSDGKKVKILPCTHALHLSCLKNW 390

Query: 358 MERSQTCPICRLSVFANDSNSHATTQAREQTPPD 391
           + RS TCPICRL +F  + N        + T P+
Sbjct: 391 IARSPTCPICRLPIFDENGNVMPYQDHSQSTDPN 424

>YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiquitin
           ligase required for endoplasmic reticulum-associated
           degradation of misfolded luminal and integral membrane
           proteins [1656 bp, 551 aa]
          Length = 551

 Score =  183 bits (465), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 131/413 (31%), Positives = 216/413 (52%), Gaps = 50/413 (12%)

Query: 11  AMFITATYALAGWSAYSCATSFDDPLSALFMASSGVHFVIWGNFLIVHYCLFVWAIIRVL 70
           A+F+  TY L  +  YS   +    L      + G + ++   F++++  L    + ++L
Sbjct: 11  AIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLWQLLTKLL 70

Query: 71  FGQLTAIEYDHIFERLHVVLVTLASIVITMRKTYMAGHMTILFYTLCL----VAHWVLRD 126
           FG+L  IE++HIFERL   ++    +     + Y     T+ F+ L L    V HW+L+D
Sbjct: 71  FGELRLIEHEHIFERLPFTIINTLFMSSLFHERYF---FTVAFFGLLLLYLKVFHWILKD 127

Query: 127 RMDFVFQVHGTDSSLLGILCSRFMFSLLVLGMVDYKMLKFCVQ----NTNVDGKRHELYL 182
           R++ + Q     +++  ++ SRF F+L++L +VDY+++  C+     N   D +   LYL
Sbjct: 128 RLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISSIYTNQKSDIESTSLYL 187

Query: 183 MLALSFAQLILDVLHVVLLTSLNLFEMVRSRRTRSA--NLVYEGGTTXXXXXX------- 233
           +  + F  L++D+L++ L T LN +E  RS+++ S   N +  G  T             
Sbjct: 188 IQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNENNHIVHGDPTDENTVESDQSQPV 247

Query: 234 ------------EVFILEGKYIYETVFDLTITVLKVILDIIQEVFVPWSIT------VVY 275
                       +   LEGK++YE   D+    LK  L +   + +P+ +       VV+
Sbjct: 248 LNDDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHL--SMLIPFRMPMMLLKDVVW 305

Query: 276 SIFVRSIKAGESFLLVYNYWKNNKKLYEKLSDVSEEQLDDT---DSMCIICMDDML--PT 330
            I     ++G S   ++  W+NNK+L + L  V+ EQL ++   D++CIICMD+++  P 
Sbjct: 306 DILAL-YQSGTS---LWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELIHSPN 361

Query: 331 TETTK-MNRRAKMLPCGHMLHFGCLKSWMERSQTCPICRLSVFANDSNSHATT 382
            +T K  N++ K LPCGH+LH  CLK+WMERSQTCPICRL VF    N   TT
Sbjct: 362 QQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTT 414

>Scas_644.6
          Length = 510

 Score =  167 bits (422), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 110/374 (29%), Positives = 189/374 (50%), Gaps = 47/374 (12%)

Query: 43  SSGVHFVIWGNFLIVHYCLFVWAIIR-VLFGQLTAIEYDHIFERLHVVLVTLASIVITMR 101
           + G + +I   F++++  L +W  +  +LF +L  IE +HI ERL   ++    I     
Sbjct: 42  NQGFNVMIITIFILLN-ALLLWKFLNFLLFKELRLIEQEHIMERLPFTIINFIFISTMFN 100

Query: 102 KTYMAGHMTILFYTLCL----VAHWVLRDRMDFVFQVHGTDSSLLGILCSRFMFSLLVLG 157
           + +    +T+ FY   L    + +W+L+DR++F+ Q   T+ S+   + S+F  +L++L 
Sbjct: 101 EKFF---ITMAFYGFILLYMKIFYWILKDRLEFLIQ-SNTNYSVSRFIFSKFYLNLIILS 156

Query: 158 MVDYKMLKFCV------------------------------QNTNVDGKRHELYLMLALS 187
            ++ +++K C+                                +N +   + +YLMLA+ 
Sbjct: 157 TINLQLIKTCIPLNYEFLKKLYLNSTSILQSLINYSSPSSTHASNFNLGVNPIYLMLAME 216

Query: 188 FAQLILDVLHVVLLTSLNLFEMVRSRRTRSAN----LVYEGGTTXXXXXXEVFILEGKYI 243
           FA L+++ +++ L + L+L+E+ +S +    N     + +          +   LE K+I
Sbjct: 217 FAILLINFINLFLHSILSLYEIYKSNQYDQLNAIIEDIEDENDDDDDTPADFNGLENKFI 276

Query: 244 YETVFDLTITVLKVILDIIQEVFVPWSITVVYSIFVRSIKAGESFLLVYNYWKNNKKLYE 303
           YE + DL    L  ++ I   + +   + V+  I    I   ++  +++   KNNK L  
Sbjct: 277 YEKIIDLFTRSLMTMIHISLALPLNLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDS 336

Query: 304 KLSDVSEEQLDDTDSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQT 363
           KL D+  E L D+D++CI+CMDD+L      K   +AK LPCGH LH  CLK+WMERSQT
Sbjct: 337 KLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKK---KAKRLPCGHFLHLSCLKNWMERSQT 393

Query: 364 CPICRLSVFANDSN 377
           CPICRL VF    N
Sbjct: 394 CPICRLPVFDESGN 407

>CAGL0E02299g complement(219009..220646) similar to tr|Q08109
           Saccharomyces cerevisiae YOL013c HRD1, start by
           similarity
          Length = 545

 Score =  166 bits (421), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 122/413 (29%), Positives = 207/413 (50%), Gaps = 42/413 (10%)

Query: 10  WAMFITATYALAGWSAYSCATSFDDPLSALFMASSGVHFVIWGNFLIVHYCLFVWAIIRV 69
           + +F   TY L  +   S   S    L      S G + +I   F +++  L    +  +
Sbjct: 10  FLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNSTLLWQFLTSM 69

Query: 70  LFGQLTAIEYDHIFERLHVVLVTLASIVITMRKTY---MAGHMTILFYTLCLVAHWVLRD 126
           LFG+L  IE++HIFERL   ++    +  T  + Y   +A    +L Y    V HW+LRD
Sbjct: 70  LFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMK--VFHWILRD 127

Query: 127 RMDFVFQVHGTDSSLLGILCSRFMFSLLVLGMVDYKMLKFCVQ--------------NTN 172
           R+D + Q    D+    +L +R++ +LL+L ++D  ++ FCV               N+ 
Sbjct: 128 RLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSYVISFCVSTAYNIASSIFTAGTNSI 187

Query: 173 VDG------KRHELYLMLALSFAQLILDVLHVVLLTSLNLFEMVRSRRTRSANLVY---- 222
           V G      +R  +Y+M A+ F  L++D+++++L T L  +E   SR+    N  +    
Sbjct: 188 VLGGGSPLTQRALIYIMQAMEFTNLMIDLVNLILNTGLQFYEFHLSRKFSQNNPTFNSIS 247

Query: 223 --EGGTTXXXXXXEVFILEGKYIYETVFDLTITVLKVILDIIQEVFVPWSITVVYSIFVR 280
             +  T       +   LEGK++YE + D+    L+ ++ ++  + +   + +V  IFV 
Sbjct: 248 AEDADTESEDGDSQFNGLEGKFMYEKLIDVVTRFLQTLVHVVMAMVLNLPLMLVKDIFVD 307

Query: 281 S---IKAGESFLLVYNYWKNNKKLYEKLSDVSEEQLDDT---DSMCIICMDDMLPTTETT 334
                   +S L +   WKN+K+L  KL  ++ + L++    D++CI+CMD+++      
Sbjct: 308 VWVLYMNSKSLLAI---WKNSKQLDTKLPTMTSDDLNNDPNFDNVCIVCMDELVSENPHH 364

Query: 335 KMN--RRAKMLPCGHMLHFGCLKSWMERSQTCPICRLSVFANDSNSHATTQAR 385
             +  ++ K LPCGH+LH  CLK+WMERSQTCPICRL VF  +    A + A 
Sbjct: 365 HQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPVFDENGEILAPSSAN 417

>Scas_248.1
          Length = 260

 Score =  111 bits (277), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/201 (36%), Positives = 114/201 (56%), Gaps = 9/201 (4%)

Query: 17  TYALAGWSAYSCATSFDDPLSALFMASSGVHFVIWGNFLIVHYCLFVWAIIRVLFGQLTA 76
           TY+ A WS Y   +S    L        GV+ +I GNF +++  L    + R+LFG+L  
Sbjct: 52  TYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVLLWKLLTRLLFGELRL 111

Query: 77  IEYDHIFERLHVVLVTLASIVITMRKTYMAGHMTILFYTLCL----VAHWVLRDRMDFVF 132
           IEY+H+FERL   +V  +  V +M K      +T+L +T  L    V HW+L+DR++FVF
Sbjct: 112 IEYEHVFERLSFTIVN-SIFVSSMFKE--QDFLTVLVFTAVLIFLKVFHWILKDRLEFVF 168

Query: 133 QVHGTDSSLLGILCSRFMFSLLVLGMVDYKMLKFCVQN--TNVDGKRHELYLMLALSFAQ 190
           Q    +++L  +L SRF F+LL L  VDY+M+++C+ N  +N       +YLM  + FA 
Sbjct: 169 QNANENTNLKKMLFSRFNFNLLFLASVDYQMVRYCLSNSISNDQWTSSSVYLMFGIDFAM 228

Query: 191 LILDVLHVVLLTSLNLFEMVR 211
           L++D L + L   +N  E+ R
Sbjct: 229 LLVDTLSIGLHGVVNFVEVYR 249

>YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing a
           C3HC4 type (RING) zinc finger, which may mediate
           protein-protein interactions, has low similarity to
           uncharacterized C. albicans Orf6.5365p [2277 bp, 758 aa]
          Length = 758

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 45/84 (53%), Gaps = 12/84 (14%)

Query: 292 YNYWK--NNKKLYEKLSDVSEEQLDDTDSMCIICMDDML----PTTETTKMNRRAKML-P 344
           Y+Y+K  +N+ + E     +E  +D     C ICM D+        ET K+++ + M+ P
Sbjct: 674 YSYFKPLSNEYISEHGGGTAEHTVD-----CAICMSDVPIYIEEIPETHKVDQHSYMVTP 728

Query: 345 CGHMLHFGCLKSWMERSQTCPICR 368
           C H+ H  CL++WM     CP+CR
Sbjct: 729 CNHVFHTSCLENWMNYKLQCPVCR 752

>Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement
          Length = 751

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 320 CIICMDDML----PTTETTKMNRRAKML-PCGHMLHFGCLKSWMERSQTCPICR 368
           C ICM D+        ET K++  + M+ PCGH+ H  CL+SWM     CP+CR
Sbjct: 692 CAICMTDVPIYVSDIEETHKVDINSYMVTPCGHIFHTQCLESWMSYKLQCPVCR 745

>CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w, start by similarity
          Length = 757

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 9/56 (16%)

Query: 320 CIICMDDM------LPTTETTKMNRRAKML-PCGHMLHFGCLKSWMERSQTCPICR 368
           C ICM +       LP  ET ++++ + M+ PC HM H  CL+SWM     CP+CR
Sbjct: 698 CAICMAEFPVYVEELP--ETHQVDKDSYMITPCDHMFHTSCLESWMSYKLQCPVCR 751

>KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w singleton, start by similarity
          Length = 757

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 5/55 (9%)

Query: 319 MCIICMDDML----PTTETTKMNRRAKML-PCGHMLHFGCLKSWMERSQTCPICR 368
           +C ICM D+      T ET K++ ++ M+ PC H+ H  CL++WM     CP+CR
Sbjct: 697 VCPICMVDVPVYVEETEETHKIDAQSYMITPCSHIFHTECLENWMSYKLQCPVCR 751

>AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH]
           complement(928488..930749) [2262 bp, 753 aa]
          Length = 753

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 320 CIICMDDML----PTTETTKMNRRAKML-PCGHMLHFGCLKSWMERSQTCPICR 368
           C ICM ++        ET K N    M+ PC H+ H GCL++WM     CP+CR
Sbjct: 694 CAICMSELAIHVEDIPETHKANIHDYMVTPCSHLFHTGCLENWMSYKLQCPVCR 747

>Kwal_26.8099
          Length = 750

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 9/56 (16%)

Query: 320 CIICMD------DMLPTTETTKMNRRAKML-PCGHMLHFGCLKSWMERSQTCPICR 368
           C ICM       D +P  ET K+++   M+ PC H+ H  CL+SWM     CP+CR
Sbjct: 691 CAICMSEVAVYVDDIP--ETHKVDKDDYMITPCSHIFHTQCLESWMSYKLQCPVCR 744

>Scas_625.4
          Length = 761

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 320 CIICMDDML----PTTETTKMNRRAKML-PCGHMLHFGCLKSWMERSQTCPICR 368
           C ICM ++        ET  +++ + M+ PC H+ H  CL++WM     CP+CR
Sbjct: 702 CAICMSEVPVYIEEAEETHNIDQHSYMVTPCDHIFHTDCLENWMGYKLQCPVCR 755

>Kwal_27.10546
          Length = 104

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 11/78 (14%)

Query: 303 EKLSDVSEEQLDDTDSMCIIC---MDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWME 359
           + L  V + +L D ++  I C    DD  P           ++  C H     C+  W+ 
Sbjct: 19  DSLPRVEKGKLKDAEACSICCCNYRDDKYPLV--------VELPHCNHRFDLECVAVWLS 70

Query: 360 RSQTCPICRLSVFANDSN 377
           +S+TCP+CR  V ++  N
Sbjct: 71  KSRTCPLCRDDVLSHKPN 88

>Kwal_55.19999
          Length = 152

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 42/96 (43%), Gaps = 11/96 (11%)

Query: 281 SIKAGESFLLVYNYWKNNKKLYEKLSDVSEEQLDDTDS-MCIICMDDMLPTTETTKMNRR 339
           S+  GE+ L       +++  +  L   SE     +DS  CI+C+  ML  +        
Sbjct: 62  SLSVGETTLSTAGLPTDSQVEHIGLEQASEMSFIPSDSRKCILCLGFMLDPS-------- 113

Query: 340 AKMLPCGHMLHFGCLKSWMERSQTCPICRLSVFAND 375
               PCGH+  + CL SW      CP+CR +  A +
Sbjct: 114 --CAPCGHVFCWKCLLSWCNERPECPLCRQTCHAQN 147

>AGR034W [4344] [Homologous to ScYBR062C - SH]
           complement(772772..773251) [480 bp, 159 aa]
          Length = 159

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 11/73 (15%)

Query: 303 EKLSDVSEEQLDDTDSMCIIC---MDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWME 359
           + L  V +++L + D+  I C   ++D  P           ++  CGH     C+  W+ 
Sbjct: 74  DTLPRVPKKRLAEGDNCAICCCGYLEDEYPLV--------VELPNCGHTFDLQCVSVWLS 125

Query: 360 RSQTCPICRLSVF 372
           RS TCP+CR  V 
Sbjct: 126 RSTTCPMCRSDVL 138

>Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement
          Length = 101

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 28/56 (50%), Gaps = 10/56 (17%)

Query: 313 LDDTDSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPICR 368
           ++++   CI+C+ +M          +     PCGH+  + C+ +W +    CP+CR
Sbjct: 44  INESSRKCILCLTEM----------KDPSCAPCGHIFCWNCIINWCKERSECPLCR 89

>Scas_705.41
          Length = 428

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 7/54 (12%)

Query: 317 DSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQT--CPICR 368
           D++C IC DD+  T        + K+ PC H  H+ C++ W   S    CP+CR
Sbjct: 9   DNICPICFDDLNDTDIL-----QGKLKPCNHKYHYDCIRRWHGYSDNSDCPLCR 57

>KLLA0E03960g 369201..371315 some similarities with sp|P22470
           Saccharomyces cerevisiae YDR143c SAN1 mating-type
           regulation protein singleton, hypothetical start
          Length = 704

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 340 AKMLPCGHMLHFGCLKSWMERSQTCPICRLSVFANDS----NSHATTQAREQTPPDLLQE 395
           A +LPCGH+    CL  W     +CPICR  + + +     +S   T +R    PD  Q+
Sbjct: 214 ATVLPCGHVFGRECLYKWTTEHNSCPICRAPILSEEELQALHSSDDTSSRGNNGPDATQQ 273

>AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH]
           complement(1370316..1370364,1370423..1371324) [951 bp,
           316 aa]
          Length = 316

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 10/56 (17%)

Query: 313 LDDTDSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPICR 368
           + +    CI+C+ DM   +           LPCGHM  + C+  W      CP+CR
Sbjct: 259 ISEQSRKCILCLADMTDPS----------CLPCGHMFCWACVMQWCNERNECPLCR 304

>CAGL0K02563g complement(230983..232743) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c, hypothetical start
          Length = 586

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 8/53 (15%)

Query: 320 CIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPICRLSVF 372
           C +C++ M   +ETT +      +PC H  H  CL  W  ++  CP+CRLS F
Sbjct: 247 CPVCLERM--DSETTGL----ITIPCQHTFHCQCLDKW--KNSKCPVCRLSSF 291

>YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein
           containing a C3HC4 type (RING) zinc finger, which may
           mediate protein-protein interactions, has moderate
           similarity to uncharacterized C. albicans Orf6.8878p
           [348 bp, 115 aa]
          Length = 115

 Score = 39.7 bits (91), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 41/85 (48%), Gaps = 14/85 (16%)

Query: 305 LSDVSEEQLDDTDSMCIIC----MDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMER 360
           L  +++++L  TD+ C IC    ++D  P           ++  C H     CL  W+ R
Sbjct: 30  LPRINKKKLKATDN-CSICYTNYLEDEYPLV--------VELPHCHHKFDLECLSVWLSR 80

Query: 361 SQTCPICRLSVFAND-SNSHATTQA 384
           S TCP+CR +V  +   N   TT+A
Sbjct: 81  STTCPLCRDNVMGHRIINEIDTTEA 105

>KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w PAS4 peroxisomal
           assembly protein - peroxin singleton, start by
           similarity
          Length = 305

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 11/65 (16%)

Query: 305 LSDVSEEQLDDTDS-MCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQT 363
           LSD+        DS  C++C++ ML  + T          PCGH+  + C+  W    Q 
Sbjct: 239 LSDLEVLPFIKEDSRKCVLCLNYMLDPSAT----------PCGHLFCWDCIMEWTLERQE 288

Query: 364 CPICR 368
           CP+CR
Sbjct: 289 CPLCR 293

>CAGL0M08690g complement(865182..866168) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w peroxisomal assembly
           protein - peroxin, hypothetical start
          Length = 328

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 11/66 (16%)

Query: 304 KLSDVSEEQLDDTDSM-CIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQ 362
           KLS+  E     T+S  CI+C+ +M   +           LPCGH+  + C+  W + + 
Sbjct: 260 KLSNGKELAFIPTESRNCILCLMEMTDPS----------CLPCGHVFCWDCITDWTKENP 309

Query: 363 TCPICR 368
            CP+CR
Sbjct: 310 ECPLCR 315

>Scas_625.11
          Length = 274

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 55/132 (41%), Gaps = 27/132 (20%)

Query: 245 ETVFDLTITVLKVILDIIQEVFVPWSITVVYSIFVRSIKAGESFLLVYNYWKNNKKLYEK 304
           +T  +L    L  ++  +   F+P +  ++ S    +      F+             E+
Sbjct: 148 DTTANLRNVPLSALMREMASRFIPENFDIITSQRSAAKPCTNEFI-------------EQ 194

Query: 305 LSDVSEEQLDDTDSMCIICM----DDMLPTTETTKMNRRAKMLP-CGHMLHFGCLKSWME 359
           L   +  +L ++   C IC     DD    TE T        LP C H  HF C+K W++
Sbjct: 195 LPRTNCAELSNSSDECPICRIAYSDDF--ETEIT-------CLPNCSHHFHFECIKLWLQ 245

Query: 360 RSQTCPICRLSV 371
           ++  CP+CR +V
Sbjct: 246 KNSLCPLCRDNV 257

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 10/69 (14%)

Query: 300  KLYEKLSDVSEEQLDDTDSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWME 359
            K    LS ++ E   +T   C IC+    P T          M+ CGH+    C+ SW++
Sbjct: 1144 KYLHNLSTLTYEAQKNTTMECSICLQ---PIT-------NGAMVNCGHLFCTSCIFSWLK 1193

Query: 360  RSQTCPICR 368
              +TCP+C+
Sbjct: 1194 NRKTCPLCK 1202

>CAGL0K08052g complement(800162..801079) weakly similar to tr|Q06834
           Saccharomyces cerevisiae YPR093c, hypothetical start
          Length = 305

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 8/56 (14%)

Query: 318 SMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQ--TCPICRLSV 371
            +C IC++D+   + T+ +       PCGH  H  C++ W   ++   CP+CR+  
Sbjct: 4   KVCAICLEDICGKSSTSYLK------PCGHEYHSDCIRKWHGHAEDLKCPMCRIDA 53

>Scas_573.9
          Length = 1502

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 10/56 (17%)

Query: 320  CIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPICRLSVFAND 375
            C IC+ D+              ML CGH     C+ SW++  + CP+C++   A++
Sbjct: 1191 CSICLQDI----------SLGSMLKCGHFFCKRCITSWLKNKKNCPMCKMVTTASE 1236

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/62 (22%), Positives = 31/62 (50%), Gaps = 10/62 (16%)

Query: 310  EEQLDDTDSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPICRL 369
            EE  +  +  C +C +++   +          ++ CGH   + C+ +W++   TCP+C+ 
Sbjct: 1155 EEHKEGEELSCAVCFNEIFVGS----------VVKCGHFFCYSCIHTWLKEHNTCPLCKT 1204

Query: 370  SV 371
            +V
Sbjct: 1205 NV 1206

>Kwal_26.8030
          Length = 660

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 5/55 (9%)

Query: 318 SMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPICRLSVF 372
           S C IC D M      T +     M PCGH +H  C   + + S  CP C++SV 
Sbjct: 384 SSCPICGDFMF-----TSVKPVVYMSPCGHAIHQHCFDEYTKHSYKCPSCQVSVL 433

>Scas_713.45
          Length = 570

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 21/43 (48%)

Query: 337 NRRAKMLPCGHMLHFGCLKSWMERSQTCPICRLSVFANDSNSH 379
           N     LPCGH+    CL  W +   TCP+CR  +   D+  H
Sbjct: 227 NHSPTKLPCGHIFGRECLYRWCKLENTCPLCRHVIAEVDTTQH 269

>Kwal_56.23900
          Length = 589

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (52%)

Query: 342 MLPCGHMLHFGCLKSWMERSQTCPICRLSVFAND 375
            LPC H+    C++ W     TCPICR ++   D
Sbjct: 224 QLPCSHVFGRECIRQWTNLHNTCPICRANIVGAD 257

>YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogenesis
           protein (peroxin) [1014 bp, 337 aa]
          Length = 337

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 10/56 (17%)

Query: 313 LDDTDSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPICR 368
           + +    CI+C+ +M   +            PCGH+  + CL SW +    CP+CR
Sbjct: 279 IPEASRKCILCLMNMSDPS----------CAPCGHLFCWSCLMSWCKERPECPLCR 324

>YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein that
           binds in vitro to proteins containing canonical nuclear
           localization signal, has similarity to human BRAP2
           breast cancer-associated protein which may regulate
           protein import into the nucleus [1758 bp, 585 aa]
          Length = 585

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 8/51 (15%)

Query: 320 CIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPICRLS 370
           C +C++ M   +ETT +      +PC H  H  CL  W  ++  CP+CR S
Sbjct: 240 CPVCLERM--DSETTGL----VTIPCQHTFHCQCLNKW--KNSRCPVCRHS 282

>ABR104W [696] [Homologous to ScYPR093C - SH]
           complement(574067..575053) [987 bp, 328 aa]
          Length = 328

 Score = 38.1 bits (87), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 3/32 (9%)

Query: 340 AKMLPCGHMLHFGCLKSWME---RSQTCPICR 368
            +++PCGH  H  C++ W      +++CP+CR
Sbjct: 30  GRLMPCGHEYHLACIRKWFHLHSGNRSCPVCR 61

>KLLA0E18601g complement(1645113..1647065) some similarities with
           ca|CA2706|IPF11006 Candida albicans unknown function,
           hypothetical start
          Length = 650

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 5/57 (8%)

Query: 316 TDSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPICRLSVF 372
           T S C IC + M  +T          M PCGH +H  C   +++ S  CP C +SV 
Sbjct: 367 TRSNCPICREYMFTSTMAV-----VYMDPCGHAIHQHCFDEYIKHSYKCPNCNVSVI 418

>Scas_560.6*
          Length = 118

 Score = 35.8 bits (81), Expect = 0.016,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 343 LP-CGHMLHFGCLKSWMERSQTCPICRLSVFANDSN 377
           LP C H     C+  W+ +S TCP+CR +V  +  N
Sbjct: 67  LPRCNHRFDLECISVWLSKSVTCPLCRDNVLEHKLN 102

>CAGL0H10274g complement(1003801..1004145) similar to sp|P38239
           Saccharomyces cerevisiae YBR062c, hypothetical start
          Length = 114

 Score = 35.8 bits (81), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 345 CGHMLHFGCLKSWMERSQTCPICRLSV 371
           CGH   F C+  W+ ++ TCP+CR  V
Sbjct: 64  CGHKFDFECVSMWLTKNTTCPMCRDDV 90

>KLLA0F18458g complement(1697871..1698293) some similarities with
           sp|P38239 Saccharomyces cerevisiae YBR062c singleton,
           hypothetical start
          Length = 140

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 12/53 (22%)

Query: 320 CIIC----MDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPICR 368
           C IC    +DD  P          AK+  C H     CL  W++ + TCP+CR
Sbjct: 71  CAICQCNFLDDPYPLV--------AKVPRCNHKFDLECLSIWLQNNHTCPMCR 115

>CAGL0E01441g 135075..137228 weakly similar to sp|P22470
           Saccharomyces cerevisiae YDR143c mating-type regulation
           protein, hypothetical start
          Length = 717

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 343 LPCGHMLHFGCLKSWMERSQTCPICRLSV 371
           +PCGH+    CL  W     +CP+CR  +
Sbjct: 293 IPCGHIFGRSCLYEWTRLENSCPLCRKKI 321

>KLLA0F25740g complement(2389226..2390779) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c singleton, start by
           similarity
          Length = 517

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 8/59 (13%)

Query: 319 MCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPICRLSVFANDSN 377
           MC +C++ +   +E T +       PC H  H  CL  W  ++  CP+CR S   + +N
Sbjct: 214 MCPVCLEKL--DSEVTGL----VTTPCQHTFHCKCLDQW--KNGNCPVCRYSQLKDVNN 264

>YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible
            component of a glycogen synthase kinase, homozygous
            diploid null mutant accumulates glycogen [4026 bp, 1341
            aa]
          Length = 1341

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 10/70 (14%)

Query: 298  NKKLYEKLSDVSEEQLDDTDSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSW 357
            NKK+ +K      +     ++ C++C     P  + T +     +LPCGH  HF C++ W
Sbjct: 1271 NKKIMDKFGYWYCDSCKKKNTSCVLCE---RPLKKLTMV-----ILPCGHEGHFQCIQEW 1322

Query: 358  M--ERSQTCP 365
               E  Q CP
Sbjct: 1323 FLDENEQECP 1332

>YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required
           for normal resistance to NaCl and for normal mating
           efficiency of MATa cells, contains a C3HC4-type zinc
           finger [1221 bp, 406 aa]
          Length = 406

 Score = 37.0 bits (84), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 16/58 (27%)

Query: 319 MCIICMDDM-LPTTETTKMNRRAKMLPCGHMLHFGCLKSWM----ERSQTCPICRLSV 371
           +C IC D M +P            M PCGH   +GCL +W     ++   CP CR  +
Sbjct: 29  VCSICHDYMFVPM-----------MTPCGHNYCYGCLNTWFASNTQKELACPQCRSDI 75

>Kwal_55.21206
          Length = 275

 Score = 36.6 bits (83), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 8/57 (14%)

Query: 315 DTDSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMER-SQTCPICRLS 370
           D+ + C IC +D        K+N    +L C H+ H  C+  W+ R S  CP+C+ S
Sbjct: 115 DSRTTCAICQEDF------NKLNN-VCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164

>Kwal_26.8090
          Length = 520

 Score = 37.0 bits (84), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 9/79 (11%)

Query: 308 VSEEQLDDTD-SMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPI 366
            +++++ DT+   C +C++ +   +E T +      +PC H  H  CL  W +    CP+
Sbjct: 214 TAKKEVQDTELPTCPVCLERL--DSEVTGL----ATIPCQHTFHCVCLNKWGD--NRCPV 265

Query: 367 CRLSVFANDSNSHATTQAR 385
           CR S      +S A   AR
Sbjct: 266 CRYSGLKLTKSSLARQGAR 284

>Scas_665.1
          Length = 392

 Score = 37.0 bits (84), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 4/34 (11%)

Query: 342 MLPCGHMLHFGCLKSWM----ERSQTCPICRLSV 371
           M  CGH   +GCLKSW+    ++   CP CR  +
Sbjct: 42  MTSCGHNYCYGCLKSWISTNSKKELACPQCRSDI 75

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 41/93 (44%), Gaps = 17/93 (18%)

Query: 276  SIFVRSIKAGESFLLVYNYWKNNKKLYEKLSDVSEEQLDDTDSMCIICMDDMLPTTETTK 335
            S+++++I+   +      Y +N  KL + L D       +    C IC+ D+        
Sbjct: 1182 SMYLKNIQKISTLQSRLKYLQNLTKLEQALKD-------NMRFNCTICLCDICD------ 1228

Query: 336  MNRRAKMLPCGHMLHFGCLKSWMERSQTCPICR 368
                  ++  GH     C+ SW+E  Q+CP+C+
Sbjct: 1229 ----GAIIGRGHFYCQECISSWLETKQSCPLCK 1257

>YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein that
           may antagonize the function of Spt16p and Sir4p [1833
           bp, 610 aa]
          Length = 610

 Score = 36.6 bits (83), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 343 LPCGHMLHFGCLKSWMERSQTCPICRLSV 371
           LPCGH+    C+  W     +CP+CR  +
Sbjct: 255 LPCGHIFGRECIYKWSRLENSCPLCRQKI 283

>AER016C [2521] [Homologous to ScYDL008W (APC11) - SH]
           (659572..660015) [444 bp, 147 aa]
          Length = 147

 Score = 35.0 bits (79), Expect = 0.058,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 36/81 (44%), Gaps = 9/81 (11%)

Query: 294 YWKNNKKLYEKLSDVSEEQLDDTDSMCIICMDDMLPTTETTKMNRRAKML---PCGHMLH 350
           YW   K+L ++ S V E++  D + +C IC      T    K+      L    C H  H
Sbjct: 15  YWDVPKEL-KRDSPVYEDE--DEEDVCGICRGSYNGTCPNCKLPGETCPLIVGSCHHNFH 71

Query: 351 FGCLKSWMERSQT---CPICR 368
             C+  W+  S +   CP+CR
Sbjct: 72  VHCIYQWLNTSTSKGLCPMCR 92

>KLLA0C15697g 1360289..1361203 weakly similar to sgd|S0006297
           Saccharomyces cerevisiae YPR093c, start by similarity
          Length = 304

 Score = 35.8 bits (81), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 9/52 (17%)

Query: 319 MCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQ--TCPICR 368
           +C IC++ M  T +        ++LPC H  H  C++ W   S    CP CR
Sbjct: 4   ICGICLESMNETDQ-------GELLPCEHRYHVSCIRKWHLYSNDFKCPTCR 48

>KLLA0C08756g complement(765847..767130) weakly similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein singleton, start by similarity
          Length = 427

 Score = 35.4 bits (80), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 12/58 (20%)

Query: 312 QLDDTDSM--CIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPIC 367
           QL D DS+  C IC D +          + + + PCGH     C++ ++++   CP+C
Sbjct: 22  QLTDLDSLLRCHICKDFL----------KASVLTPCGHSFCSICIRKYLQKESKCPLC 69

>Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement
          Length = 331

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 4/34 (11%)

Query: 342 MLPCGHMLHFGCLKSWMERSQ----TCPICRLSV 371
           M  CGH   + C+ +W+  +     TCP CR SV
Sbjct: 6   MTSCGHNYCYDCISNWLNNNNATELTCPQCRTSV 39

>KLLA0E06435g complement(581935..584832) similar to sp|P38164
           Saccharomyces cerevisiae YBL104c singleton, hypothetical
           start
          Length = 965

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 8/61 (13%)

Query: 313 LDDTDSMCIICMDDMLPTTETTKMNRRAKM-------LPCGHMLHFGCLKSWMERSQTCP 365
           ++ T + C + +DD     E  K  +R KM       L C H +H G  + W ER   CP
Sbjct: 897 INGTTNSCEVRIDDDAKINEV-KERKRLKMNEWFSFCLKCNHGMHAGHAEEWFERHSICP 955

Query: 366 I 366
           +
Sbjct: 956 V 956

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 12/49 (24%), Positives = 23/49 (46%), Gaps = 10/49 (20%)

Query: 320  CIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPICR 368
            C +C  D+   +          +L CGH     C+  W +++ +CP+C+
Sbjct: 1208 CAVCYSDIYTGS----------ILKCGHFFCKDCVTHWFKKNTSCPMCK 1246

>Kwal_14.1287
          Length = 1518

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 12/50 (24%), Positives = 24/50 (48%), Gaps = 10/50 (20%)

Query: 320  CIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPICRL 369
            C IC+ ++              ++ CGH     C+ SW++   +CP+C++
Sbjct: 1189 CTICLGEIY----------MGSVIKCGHFFCQDCICSWLKNHSSCPLCKM 1228

>CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces
           cerevisiae YDL008w APC11 subunit of the anaphase
           promoting complex, start by similarity
          Length = 149

 Score = 33.5 bits (75), Expect = 0.21,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 34/84 (40%), Gaps = 7/84 (8%)

Query: 288 FLLVYNYWKNNKKLYEKLSDVSEEQLDDTDSMCIICMDDMLPTTETTKMNRRAKMLPCGH 347
           F  V++  KN  +L E ++D  E    D   +C        P       +    +  CGH
Sbjct: 12  FNWVWDIPKNEDRLDESMADEDE----DVCGICRASYHAPCPNCRYPGESCAIVLGRCGH 67

Query: 348 MLHFGCLKSWMERSQT---CPICR 368
             H  C+  W++   +   CP+CR
Sbjct: 68  NFHVHCISRWVDTPTSKGLCPMCR 91

>Sklu_2317.2 YDR143C, Contig c2317 4002-5483
          Length = 493

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 15/32 (46%)

Query: 342 MLPCGHMLHFGCLKSWMERSQTCPICRLSVFA 373
            L CGH     C+  W +   +CPICR  +  
Sbjct: 138 QLKCGHRFGRMCIYQWTKEHNSCPICRAEIVG 169

>Scas_615.13
          Length = 330

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 15/25 (60%)

Query: 344 PCGHMLHFGCLKSWMERSQTCPICR 368
           PCGH+  + C+  W +    CP+CR
Sbjct: 294 PCGHIFCWECILDWCKERPECPLCR 318

>Kwal_55.20318
          Length = 899

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 48/114 (42%), Gaps = 21/114 (18%)

Query: 296 KNNKKLYEKLSDVSEEQLDDTDSMCIICMDDMLPT----------TETTKMNRRAKMLPC 345
           K NKKL     D  E +L + +S  +  +DD  P+          T  T +N       C
Sbjct: 761 KKNKKLI----DSYEAELQEKESRLLSLLDDTNPSQIRLKNQNCNTCHTTLNAPIVYFKC 816

Query: 346 GHMLHFGCL--KSWMERSQ---TCPICRLSVFANDSNSHATTQAREQTPPDLLQ 394
           GH+ H  CL  +  +ER      CP C +    ++   +A  Q + Q   DLL+
Sbjct: 817 GHIYHQRCLNEEESLERGSRFFKCPQCVIDFETSEGMKNA--QIKAQMDADLLK 868

>KLLA0E21043g 1872227..1876192 similar to sgd|S0005498 Saccharomyces
            cerevisiae YOL138c, hypothetical start
          Length = 1321

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 15/27 (55%), Gaps = 2/27 (7%)

Query: 342  MLPCGHMLHFGCLKSWM--ERSQTCPI 366
            ML CGH  HF CLK W   E    CP+
Sbjct: 1288 MLNCGHEGHFECLKKWFFDENMDVCPL 1314

>YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protein
           containing a C3HC4 type (RING) zinc finger, which may
           mediate protein-protein interactions [867 bp, 288 aa]
          Length = 288

 Score = 33.5 bits (75), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 8/52 (15%)

Query: 320 CIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERS--QTCPICRL 369
           C IC+ D     +   +N       CGH  H  C++ W + S    CPICR+
Sbjct: 4   CPICLADDQEGEQFGCLN------VCGHKFHLNCIREWHKYSINLKCPICRV 49

>KLLA0C14344g 1245226..1249782 similar to sp|Q04781 Saccharomyces
            cerevisiae YMR247c singleton, start by similarity
          Length = 1518

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 25/58 (43%), Gaps = 19/58 (32%)

Query: 320  CIIC------MDDMLPTTETTKMNRRAKMLP-CGHMLHFGCLKSWMERS--QTCPICR 368
            C IC      +D  LPT          K+ P C +  H  CL  W + S   TCP+CR
Sbjct: 1464 CAICYYVLHAIDRKLPT----------KVCPTCNNRFHGACLYKWFKSSGNNTCPLCR 1511

>Scas_589.13
          Length = 1311

 Score = 33.1 bits (74), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 8/41 (19%)

Query: 317  DSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSW 357
            +S+CI C   M   T          +L CGH  HF C +SW
Sbjct: 1260 NSLCIFCERPMKKLT--------MAILQCGHEAHFQCFRSW 1292

>Kwal_55.22054
          Length = 111

 Score = 31.2 bits (69), Expect = 0.75,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 22/55 (40%), Gaps = 8/55 (14%)

Query: 320 CIICMDDML-------PTTETTKMNR-RAKMLPCGHMLHFGCLKSWMERSQTCPI 366
           C IC + ++       PT  T   N   A    C H  H  C+  W++    CP+
Sbjct: 45  CAICRNHIMEPCIQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQTRNACPL 99

>ADL186C [1555] [Homologous to ScYOL138C - SH] (369322..373407) [4086
            bp, 1361 aa]
          Length = 1361

 Score = 32.7 bits (73), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 33/92 (35%), Gaps = 23/92 (25%)

Query: 276  SIFVRSIKAGESFLLVYNYWKNNKKLYEKLSDVSEEQLDDTDSMCIICMDDMLPTTETTK 335
            +I  +  +AGES +  + YW               +     +S+C+ C   M        
Sbjct: 1283 TILSKRHQAGESNMTNFGYWYC-------------DSCRKPNSLCVYCEQPMKKLA---- 1325

Query: 336  MNRRAKMLPCGHMLHFGCLKSWM--ERSQTCP 365
                   L CGH  HF CL+ W   E    CP
Sbjct: 1326 ----LSFLNCGHGGHFECLQQWFLDEGMSECP 1353

>Sklu_2416.8 YOL133W, Contig c2416 15124-15456
          Length = 110

 Score = 30.8 bits (68), Expect = 0.92,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 22/55 (40%), Gaps = 8/55 (14%)

Query: 320 CIICMDDML-------PTTETTKMNR-RAKMLPCGHMLHFGCLKSWMERSQTCPI 366
           C IC + ++       PT  T   N   A    C H  H  C+  W++    CP+
Sbjct: 44  CAICRNHIMEPCIQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQTRNACPL 98

>Sklu_2337.2 YPR093C, Contig c2337 3730-4698 reverse complement
          Length = 322

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 2/32 (6%)

Query: 340 AKMLPCGHMLHFGCLKSWMERSQ--TCPICRL 369
            +++ C H  H  C++ W   SQ   CP CR+
Sbjct: 18  GRLVTCQHEYHLECIREWHNHSQDFKCPTCRV 49

>ADL181W [1560] [Homologous to ScYOL133W (HRT1) - SH]
           complement(379684..380010) [327 bp, 108 aa]
          Length = 108

 Score = 30.4 bits (67), Expect = 1.0,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 19/47 (40%), Gaps = 3/47 (6%)

Query: 320 CIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPI 366
           CI C  + +  TE   +   A    C H  H  C+  W+     CP+
Sbjct: 53  CIQCQPNAMTDTENECV---AAWGTCNHAFHLHCINKWLLTRNACPL 96

>AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH]
           (428904..430235) [1332 bp, 443 aa]
          Length = 443

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 12/58 (20%)

Query: 312 QLDDTDSM--CIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPIC 367
           +L D DS+  C IC  DML T   T+         CGH     C++ ++ +   CP+C
Sbjct: 22  ELADLDSLLRCHIC-KDMLQTPVLTQ---------CGHTFCSLCIREYLNKESRCPLC 69

>AGL079C [4232] [Homologous to ScYHL010C - SH] (557422..558942)
           [1521 bp, 506 aa]
          Length = 506

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 8/51 (15%)

Query: 320 CIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPICRLS 370
           C +C++ M   ++TT +   A    C H  H  CL  W  +   CP+CR S
Sbjct: 212 CPVCLERM--DSDTTGLITTA----CQHTFHCQCLDKW--KDGRCPVCRYS 254

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 15/27 (55%)

Query: 342  MLPCGHMLHFGCLKSWMERSQTCPICR 368
            ++ CGH     C+ +W+     CPIC+
Sbjct: 1251 IIKCGHYFCKSCILTWLRAHSKCPICK 1277

>Kwal_14.1868
          Length = 1357

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 8/56 (14%)

Query: 314  DDTDSM-CIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPICR 368
            D  +SM C  CM+ M    E+T +     + PCGHML  GC + + E ++  P  R
Sbjct: 1056 DGLESMTCPQCMEQM--ELESTMV-----ITPCGHMLCEGCSEMYFEDARAQPGAR 1104

>AGL217W [4095] [Homologous to ScYOL054W - SH]
           complement(290043..291287) [1245 bp, 414 aa]
          Length = 414

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 42/108 (38%), Gaps = 35/108 (32%)

Query: 269 WSITVVYSIFVRSIKAGESFLLVYNYWKNNKKLYEKLSDVSEEQLDDTDSMCIICMDDM- 327
           W +TV   +     ++G   L++       +KL E              ++C IC D M 
Sbjct: 6   WLLTVRTKVLTDVKQSGRKHLIII------RKLLET-------------TICTICHDYMY 46

Query: 328 LPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQT----CPICRLSV 371
           +P            M  CGH   + C+ +W+  + +    CP CR S+
Sbjct: 47  VPV-----------MTGCGHNYCYFCISNWLNNTSSTELNCPQCRSSI 83

>KLLA0E17787g complement(1571018..1571506) similar to sgd|S0002166
           Saccharomyces cerevisiae YDL008w APC11 subunit of the
           anaphase promoting complex, start by similarity
          Length = 162

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 14/27 (51%), Gaps = 3/27 (11%)

Query: 345 CGHMLHFGCLKSWMERSQT---CPICR 368
           C H  H  C+K W+    +   CP+CR
Sbjct: 87  CNHNFHVHCIKQWLSTETSKGLCPLCR 113

>Sklu_2416.2 YOL138C, Contig c2416 613-4674 reverse complement
          Length = 1353

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%)

Query: 342  MLPCGHMLHFGCLKSWM--ERSQTCPICRLSVF 372
            +L CGH  HF C K W   E  Q CP   L V 
Sbjct: 1320 VLNCGHEGHFECFKKWFLEENMQECPGGCLGVL 1352

>CAGL0I09988g complement(951368..952531) similar to tr|Q12161
           Saccharomyces cerevisiae YOL054w, start by similarity
          Length = 387

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 34/86 (39%), Gaps = 26/86 (30%)

Query: 289 LLVYNYWKNNKKLYEKLSDVSEEQLDDTDSMCIICMDDM-LPTTETTKMNRRAKMLPCGH 347
           L+++   K   K+  KL D +         +C IC D M +P T             CGH
Sbjct: 8   LVLHRSEKTKNKILSKLLDTT---------ICSICHDYMFVPMT-----------TECGH 47

Query: 348 MLHFGCLKSWMERSQ-----TCPICR 368
              + CLK+W          +CP CR
Sbjct: 48  SYCYTCLKTWFSSDTNRGGLSCPECR 73

>ABL058C [534] [Homologous to ScYMR247C - SH] (288355..292995) [4641
            bp, 1546 aa]
          Length = 1546

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 3/32 (9%)

Query: 340  AKMLP-CGHMLHFGCLKSWMERS--QTCPICR 368
            +K+ P C +  H  CL  W + S   TCP+CR
Sbjct: 1508 SKVCPTCSNRFHGACLYKWFKSSGNNTCPLCR 1539

>Kwal_56.23112
          Length = 135

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 35/83 (42%), Gaps = 13/83 (15%)

Query: 299 KKLYEKLS--------DVSEEQLDDTD--SMCIICMDDMLPTTETTKMNRRAKMLPCGHM 348
           KK+Y   S        D +++++ D D   +C +  +   P       N    +  C H 
Sbjct: 6   KKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPGDNCPLVIGECNHN 65

Query: 349 LHFGCLKSWMERSQT---CPICR 368
            H  C++ W+E +     CP+CR
Sbjct: 66  FHVHCIQQWLETATAKGLCPMCR 88

>KLLA0A02343g complement(208673..210334) similar to sgd|S0005687
           Saccharomyces cerevisiae YOR161c, start by similarity
          Length = 553

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 2/77 (2%)

Query: 62  FVWAIIRVLFGQLTAIEYDHIFERLHVVLVTLASIVITMR-KTYMAGHMTILFYTLCLVA 120
           FV++II ++  ++   ++  I   L  ++  LA+ ++ +  K Y AG + ++F  +C + 
Sbjct: 154 FVFSIIGIVLARMFP-KFFIIAGILFNIIAGLATAIMYLSLKYYSAGIVFLVFTAICALF 212

Query: 121 HWVLRDRMDFVFQVHGT 137
           +W +R R+ F   V  T
Sbjct: 213 YWRMRHRIPFTVAVLKT 229

>Scas_672.2
          Length = 263

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 28/66 (42%), Gaps = 16/66 (24%)

Query: 316 TDSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQT------CPICRL 369
           T+  C ICMD   P T        A + PCGH+    CL   +  S+T      C +CR 
Sbjct: 193 TEYRCPICMD--PPET--------ALIAPCGHVFCCDCLFQMVNSSRTYRKDGHCALCRK 242

Query: 370 SVFAND 375
            V   D
Sbjct: 243 EVRLRD 248

>CAGL0J03586g complement(341290..342525) similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein, hypothetical start
          Length = 411

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 25/58 (43%), Gaps = 12/58 (20%)

Query: 312 QLDDTDSM--CIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPIC 367
           QL + D +  C IC D +          +   + PCGH     C++ ++     CP+C
Sbjct: 17  QLQELDDLLRCHICKDFL----------KNPVLTPCGHTFCSLCIRGYLSNEPKCPLC 64

>CAGL0E01485g complement(138830..142840) similar to tr|Q08281
            Saccharomyces cerevisiae YOL138c, start by similarity
          Length = 1336

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 10/52 (19%)

Query: 316  TDSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWM--ERSQTCP 365
            T+++C++C       T   K+   A  L CGH  HF C   W   E    CP
Sbjct: 1285 TNTLCVVC------NTPLRKLTMAA--LKCGHEGHFECFTQWFITEGMSECP 1328

>Scas_585.5*
          Length = 109

 Score = 28.9 bits (63), Expect = 3.8,   Method: Composition-based stats.
 Identities = 12/47 (25%), Positives = 19/47 (40%), Gaps = 3/47 (6%)

Query: 320 CIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPI 366
           CI C    +  T+   +   A    C H  H  C+  W++    CP+
Sbjct: 54  CIECQPKAMTDTDNECV---AAWGTCNHAFHLHCINKWIKTRDACPL 97

>CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharomyces
            cerevisiae YDR128w, start by similarity
          Length = 1120

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 10/21 (47%), Positives = 12/21 (57%)

Query: 345  CGHMLHFGCLKSWMERSQTCP 365
            C H+LH  C K W   S+ CP
Sbjct: 1086 CQHVLHLKCSKEWWNVSKECP 1106

>Kwal_56.23543
          Length = 965

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 6/32 (18%)

Query: 343 LPCGHMLHFGCLKSWMERSQTC------PICR 368
           L CGH++H  CL ++ E   +C      P CR
Sbjct: 181 LECGHLVHEECLMTYFENPTSCHIDELFPFCR 212

>Sklu_2148.3 YNL116W, Contig c2148 7107-8534
          Length = 475

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 32/76 (42%), Gaps = 10/76 (13%)

Query: 298 NKKLYEKLSDVSEEQLDDTDSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSW 357
           NK+  ++L ++ +      +  C IC+  + P            + PC H  H+ C++  
Sbjct: 367 NKEALQRLKNLQKLTTGSEEEDCSICLSKIKPCQAIF-------ISPCSHSWHYQCVRRL 419

Query: 358 MERSQT---CPICRLS 370
           +  S     CP CR S
Sbjct: 420 VMTSYPQFVCPNCRSS 435

>YOL133W (HRT1) [4690] chr15 (70324..70689) Activator of the
           Cdc53p-containing SCF-Cdc4p ubiquitin ligase required
           for ubiquitination of Sic1p and for the G1 to S cell
           cycle transition; RING-box protein [366 bp, 121 aa]
          Length = 121

 Score = 28.9 bits (63), Expect = 5.7,   Method: Composition-based stats.
 Identities = 7/22 (31%), Positives = 11/22 (50%)

Query: 345 CGHMLHFGCLKSWMERSQTCPI 366
           C H  H  C+  W++    CP+
Sbjct: 88  CNHAFHLHCINKWIKTRDACPL 109

>CAGL0I06138g 585873..588320 weakly similar to sp|P21268
           Saccharomyces cerevisiae YJL157c FAR1 cyclin-dependent
           kinase inhibitor, hypothetical start
          Length = 815

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 7/53 (13%)

Query: 320 CIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTC---PICRL 369
           C IC ++M  T +  K+      L CGH+ H+ C  +  E + +    PIC++
Sbjct: 185 CSICDEEMTVTFKGEKILE----LDCGHLSHYDCFMAIFEETHSINELPICQI 233

>KLLA0F23892g complement(2229493..2231049) some similarities with
           sp|P38823 Saccharomyces cerevisiae YHR115c, hypothetical
           start
          Length = 518

 Score = 29.6 bits (65), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 18/78 (23%)

Query: 298 NKKLYEKLSDV----SEEQLDDTDSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGC 353
           NK+  +K+  +    S  +L+D    C IC+  +       K  +   + PC H  HF C
Sbjct: 370 NKEAIQKMKALQKMTSGTELED----CSICLSKI-------KACQAVFIAPCSHSWHFKC 418

Query: 354 LKSWMERSQT---CPICR 368
           ++  + ++     CP CR
Sbjct: 419 IRQLVSKTYPQFVCPNCR 436

>KLLA0C14542g 1272215..1273195 weakly similar to sgd|S0002721
           Saccharomyces cerevisiae YDR313c PIB1
           phosphatidylinositol(3)-phosphate binding protein, start
           by similarity
          Length = 326

 Score = 29.3 bits (64), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 7/41 (17%)

Query: 320 CIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMER 360
           C IC ++M P  +  +       L C  + H+ C+KSW ++
Sbjct: 261 CPICFEEMAPGQKVGR-------LECLCVFHYHCIKSWFKK 294

>Kwal_23.6285
          Length = 458

 Score = 29.3 bits (64), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 8/26 (30%), Positives = 14/26 (53%)

Query: 342 MLPCGHMLHFGCLKSWMERSQTCPIC 367
           + PC H     C++ ++ R   CP+C
Sbjct: 49  LTPCAHTFCSLCIREYLNRELRCPLC 74

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.135    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,683,025
Number of extensions: 743400
Number of successful extensions: 3152
Number of sequences better than 10.0: 115
Number of HSP's gapped: 3228
Number of HSP's successfully gapped: 117
Length of query: 564
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 457
Effective length of database: 12,891,983
Effective search space: 5891636231
Effective search space used: 5891636231
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)