Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACL018W1341326021e-81
Scas_248.1d1541274494e-58
KLLA0C05896g1581274355e-56
Kwal_56.225201571274163e-53
Scas_699.895729594.4
YLR310C (CDC25)158988594.9
Scas_568.111619566.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL018W
         (132 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL018W [1031] [Homologous to NOHBY] complement(329990..330394) ...   236   1e-81
Scas_248.1d                                                           177   4e-58
KLLA0C05896g 522074..522550 weakly similar to ca|CA3383|IPF8359 ...   172   5e-56
Kwal_56.22520                                                         164   3e-53
Scas_699.8                                                             27   4.4  
YLR310C (CDC25) [3699] chr12 complement(752226..756995) Guanine-...    27   4.9  
Scas_568.1                                                             26   6.7  

>ACL018W [1031] [Homologous to NOHBY] complement(329990..330394)
           [405 bp, 134 aa]
          Length = 134

 Score =  236 bits (602), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 121/132 (91%), Positives = 121/132 (91%)

Query: 1   MSALAFKLGALLIRQVTRPVANVLKQQAKQHSAFKQVCIRLAQQMHRADVKLRSRLTPVA 60
           MSALAFKLGALLIRQVTRPVANVLKQQAKQHSAFKQVCIRLAQQMHRADVKLRSRLTPVA
Sbjct: 1   MSALAFKLGALLIRQVTRPVANVLKQQAKQHSAFKQVCIRLAQQMHRADVKLRSRLTPVA 60

Query: 61  QPKKIRPLNDERAVENGATLLSELXXXXXXXXXXXWETVRQRNKELDRREQVLQDIKELQ 120
           QPKKIRPLNDERAVENGATLLSEL           WETVRQRNKELDRREQVLQDIKELQ
Sbjct: 61  QPKKIRPLNDERAVENGATLLSELFVFGVTGTVVVWETVRQRNKELDRREQVLQDIKELQ 120

Query: 121 EEIDELKRALAD 132
           EEIDELKRALAD
Sbjct: 121 EEIDELKRALAD 132

>Scas_248.1d
          Length = 154

 Score =  177 bits (449), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 101/127 (79%)

Query: 1   MSALAFKLGALLIRQVTRPVANVLKQQAKQHSAFKQVCIRLAQQMHRADVKLRSRLTPVA 60
           MSA+A KLGAL+IRQVTRPVANVLK QAKQH +FK++CI LAQ+MHRADV LRSRLTP  
Sbjct: 1   MSAIAVKLGALVIRQVTRPVANVLKAQAKQHDSFKRICISLAQRMHRADVILRSRLTPSN 60

Query: 61  QPKKIRPLNDERAVENGATLLSELXXXXXXXXXXXWETVRQRNKELDRREQVLQDIKELQ 120
             KKIRPLN+E+AVENGATL SE+           WET+RQR KEL+RREQV QDI  LQ
Sbjct: 61  FSKKIRPLNEEKAVENGATLFSEMFVFGVTGSVVVWETLRQRTKELNRREQVSQDISFLQ 120

Query: 121 EEIDELK 127
            EI+EL+
Sbjct: 121 SEIEELR 127

>KLLA0C05896g 522074..522550 weakly similar to ca|CA3383|IPF8359
           Candida albicans unknown function, start by similarity
          Length = 158

 Score =  172 bits (435), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 85/127 (66%), Positives = 99/127 (77%)

Query: 1   MSALAFKLGALLIRQVTRPVANVLKQQAKQHSAFKQVCIRLAQQMHRADVKLRSRLTPVA 60
           MSA+A KLGALL+RQVTRP+ANVLK+QAK+H+ FK++CI LAQ+MH ADV LRS+LTP  
Sbjct: 1   MSAIALKLGALLVRQVTRPMANVLKRQAKEHAVFKEICIGLAQKMHVADVVLRSKLTPTK 60

Query: 61  QPKKIRPLNDERAVENGATLLSELXXXXXXXXXXXWETVRQRNKELDRREQVLQDIKELQ 120
             K IRPLND +AVENGATLLSE            WET+RQR KELDRREQV QDI  LQ
Sbjct: 61  FSKTIRPLNDTKAVENGATLLSEGFVFGVTGSVVVWETLRQRQKELDRREQVTQDIAFLQ 120

Query: 121 EEIDELK 127
            EI+EL+
Sbjct: 121 SEIEELR 127

>Kwal_56.22520
          Length = 157

 Score =  164 bits (416), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 94/127 (74%)

Query: 1   MSALAFKLGALLIRQVTRPVANVLKQQAKQHSAFKQVCIRLAQQMHRADVKLRSRLTPVA 60
           MSALA KLG LLIRQVTRPVANVLK QAKQH  FK++C+ +AQ+MHR D KLR+RLTP  
Sbjct: 1   MSALAVKLGTLLIRQVTRPVANVLKAQAKQHDKFKRICVGVAQKMHRVDAKLRTRLTPGN 60

Query: 61  QPKKIRPLNDERAVENGATLLSELXXXXXXXXXXXWETVRQRNKELDRREQVLQDIKELQ 120
           Q  K+RPLND RAVENGAT LSE            WETVRQR KE++RREQV  DI  LQ
Sbjct: 61  QEIKVRPLNDARAVENGATWLSEAFVFGVTGSVVVWETVRQRAKEINRREQVASDISFLQ 120

Query: 121 EEIDELK 127
            EI+ L+
Sbjct: 121 SEIEYLR 127

>Scas_699.8
          Length = 957

 Score = 27.3 bits (59), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (75%), Gaps = 1/29 (3%)

Query: 101 QRNKELDRREQVLQD-IKELQEEIDELKR 128
           QRN+E+    +VLQD I EL+ E++ELKR
Sbjct: 879 QRNQEVMEENRVLQDRIIELETEVEELKR 907

>YLR310C (CDC25) [3699] chr12 complement(752226..756995)
            Guanine-nucleotide exchange protein for Ras1p and Ras2p,
            has an SH3 domain [4770 bp, 1589 aa]
          Length = 1589

 Score = 27.3 bits (59), Expect = 4.9,   Method: Composition-based stats.
 Identities = 24/88 (27%), Positives = 40/88 (45%), Gaps = 5/88 (5%)

Query: 47   RADVKLRSRLTP--VAQPKKIRPLNDERAVENGATLLSELXXXXXXXXXXXWETVRQRNK 104
            +ADVK RS+LT   V   +  + LN+  ++     ++S L           W+ V   +K
Sbjct: 1368 QADVKTRSKLTQYFVTVAQHCKELNNFSSM---TAIVSALYSSPIYRLKKTWDLVSTESK 1424

Query: 105  ELDRREQVLQDIKELQEEIDELKRALAD 132
            +L +    L D K    +  EL R++ D
Sbjct: 1425 DLLKNLNNLMDSKRNFVKYRELLRSVTD 1452

>Scas_568.1
          Length = 116

 Score = 26.2 bits (56), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (73%), Gaps = 1/19 (5%)

Query: 53 RSRLTPVAQPKKIRPLNDE 71
          R  +TPVA P K+RP NDE
Sbjct: 11 RLEITPVATPSKLRP-NDE 28

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.131    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,227,312
Number of extensions: 102416
Number of successful extensions: 664
Number of sequences better than 10.0: 21
Number of HSP's gapped: 663
Number of HSP's successfully gapped: 21
Length of query: 132
Length of database: 16,596,109
Length adjustment: 90
Effective length of query: 42
Effective length of database: 13,480,489
Effective search space: 566180538
Effective search space used: 566180538
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)