Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACL016C36135413890.0
KLLA0C05962g3663368861e-118
Kwal_56.225054032508021e-104
Scas_611.23362496734e-86
CAGL0J11726g3362476387e-81
YMR005W (TAF4)3882476305e-79
YJR107W32853780.10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL016C
         (354 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL016C [1033] [Homologous to ScYMR005W (MPT1) - SH] (331298..33...   539   0.0  
KLLA0C05962g complement(527216..528316) similar to sp|P50105 Sac...   345   e-118
Kwal_56.22505                                                         313   e-104
Scas_611.2                                                            263   4e-86
CAGL0J11726g 1140123..1141133 similar to sp|P50105 Saccharomyces...   250   7e-81
YMR005W (TAF4) [3970] chr13 (276045..277211) Component of RNA po...   247   5e-79
YJR107W (YJR107W) [2999] chr10 (627254..628240) Protein of unkno...    35   0.10 

>ACL016C [1033] [Homologous to ScYMR005W (MPT1) - SH]
           (331298..332383) [1086 bp, 361 aa]
          Length = 361

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/354 (77%), Positives = 276/354 (77%)

Query: 1   MGKSPXXXXXXXXXXXXXXXXXXXXFSFGIDAEEVEPTGSDFSNDMPTPFDNFVGQDEQS 60
           MGKSP                    FSFGIDAEEVEPTGSDFSNDMPTPFDNFVGQDEQS
Sbjct: 1   MGKSPKAADQGDTGAGGKKTKGEDGFSFGIDAEEVEPTGSDFSNDMPTPFDNFVGQDEQS 60

Query: 61  NRAELPESGQXXXXXXXXXXXXXXXXXRKSPQKMQXXXXXXXXXXXXPKQQSDPDKLSDA 120
           NRAELPESGQ                 RKSPQKMQ            PKQQSDPDKLSDA
Sbjct: 61  NRAELPESGQPATTLALPAGGAGSGAGRKSPQKMQRAGMRRAAGAGAPKQQSDPDKLSDA 120

Query: 121 LLSAGVDIKEEEALLSSTVTTMKSNSQVSNSQIPLHPPFLHPSHVASMMKKVAAEQNFNQ 180
           LLSAGVDIKEEEALLSSTVTTMKSNSQVSNSQIPLHPPFLHPSHVASMMKKVAAEQNFNQ
Sbjct: 121 LLSAGVDIKEEEALLSSTVTTMKSNSQVSNSQIPLHPPFLHPSHVASMMKKVAAEQNFNQ 180

Query: 181 DFSKSSELLSLMSTACELYXXXXXXXXXXXXXXXXKAVKLNSGRRSETTRVLRDLALXXX 240
           DFSKSSELLSLMSTACELY                KAVKLNSGRRSETTRVLRDLAL   
Sbjct: 181 DFSKSSELLSLMSTACELYIRDIITNSIIISRHRRKAVKLNSGRRSETTRVLRDLALKQR 240

Query: 241 XXXXXXXXXXIALGLEKEITDTKLDSGETLHRASNATANMMIAGGKKKYSWLTSGSKVNA 300
                     IALGLEKEITDTKLDSGETLHRASNATANMMIAGGKKKYSWLTSGSKVNA
Sbjct: 241 EQEERRVKRRIALGLEKEITDTKLDSGETLHRASNATANMMIAGGKKKYSWLTSGSKVNA 300

Query: 301 TDLKNPGKVSSAVAARGDLGIKFREAREEPGIVMRDLLHALENRRVGVNNTIAK 354
           TDLKNPGKVSSAVAARGDLGIKFREAREEPGIVMRDLLHALENRRVGVNNTIAK
Sbjct: 301 TDLKNPGKVSSAVAARGDLGIKFREAREEPGIVMRDLLHALENRRVGVNNTIAK 354

>KLLA0C05962g complement(527216..528316) similar to sp|P50105
           Saccharomyces cerevisiae YMR005w MPT1 required for
           protein synthesis singleton, start by similarity
          Length = 366

 Score =  345 bits (886), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 182/336 (54%), Positives = 221/336 (65%), Gaps = 7/336 (2%)

Query: 26  FSFGIDAEEVEPTGSDFSNDMPTPFDNFVGQDEQS-NRAELPESGQXXXXXXXXXXXXXX 84
           F FG     +EP+GSDF +D+PTPFD  V +   +  +A  P +                
Sbjct: 24  FEFGKVENGLEPSGSDFGSDLPTPFDTMVTEQPLALPKASSPTTNLASPRNSSTPNLKTT 83

Query: 85  XXXRKSPQKMQXXXXXXXXXXXXPK-----QQSDPDKLSDALLSAGVDIKEEEALLSSTV 139
               K  QK +                   QQSDPDKLSDALLSAGVDI+EEEALLSSTV
Sbjct: 84  STTSKQSQKAEQKKNAGGSTGSTTASTTKPQQSDPDKLSDALLSAGVDIREEEALLSSTV 143

Query: 140 TTMKSNSQVSNSQIPLHPPFLHPSHVASMMKKVAAEQNFNQDFSKSSELLSLMSTACELY 199
              K+    +N+Q+P HPPFLHP +++  MK++A+EQNF+QDF+K++++L LMSTACELY
Sbjct: 144 ARTKATGISANNQVPSHPPFLHPKNISDFMKRIASEQNFHQDFNKNTDILGLMSTACELY 203

Query: 200 XXXXXXXXXXXXXXXXKAVKLNSGRRSETTRVLRDLALXXXXXXXXXXXXXIALGLEKEI 259
                           K VKLN+GRRSE +R LRDLAL             IALGLEK+ 
Sbjct: 204 MRDVITNSLILSIHRRKGVKLNTGRRSEVSRSLRDLALRQKTQEERRVQRRIALGLEKQT 263

Query: 260 TDTKLDSGETLHRASNATANMMIAGG-KKKYSWLTSGSKVNATDLKNPGKVSSAVAARGD 318
           TD +LD+ ET +RASNATAN+MIAGG KKKYSWLT+GSK ++TDLKN G VSSAVAARG+
Sbjct: 264 TDARLDTEETQYRASNATANLMIAGGNKKKYSWLTAGSKSSSTDLKNQGNVSSAVAARGE 323

Query: 319 LGIKFREAREEPGIVMRDLLHALENRRVGVNNTIAK 354
           +GIK+REAREEPGIVMRDLL ALENRRVGVNN I K
Sbjct: 324 MGIKYREAREEPGIVMRDLLLALENRRVGVNNVITK 359

>Kwal_56.22505
          Length = 403

 Score =  313 bits (802), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 152/250 (60%), Positives = 186/250 (74%), Gaps = 4/250 (1%)

Query: 109 KQQSDPDKLSDALLSAGVDIKEEEALLSSTVTTMKSNSQVS----NSQIPLHPPFLHPSH 164
           K Q+DPDKLSDAL SAGVDI+EEEALL+S++   KS++Q      N+QIP  PP LHP+H
Sbjct: 147 KMQTDPDKLSDALFSAGVDIREEEALLNSSMNITKSSAQAGAQAINNQIPPQPPLLHPTH 206

Query: 165 VASMMKKVAAEQNFNQDFSKSSELLSLMSTACELYXXXXXXXXXXXXXXXXKAVKLNSGR 224
           +AS MKKV +EQNFNQDFSK+ ++LSLMSTACE +                +++KLNSGR
Sbjct: 207 IASFMKKVGSEQNFNQDFSKAHDVLSLMSTACEFFMTDIITNSLVISRHRRRSIKLNSGR 266

Query: 225 RSETTRVLRDLALXXXXXXXXXXXXXIALGLEKEITDTKLDSGETLHRASNATANMMIAG 284
           RSE +R LRDLA+             I++GLEKE  + K+++ ETLHRASNATANMMIAG
Sbjct: 267 RSEVSRALRDLAIQQKEQEERRVKRRISMGLEKETAEAKMETDETLHRASNATANMMIAG 326

Query: 285 GKKKYSWLTSGSKVNATDLKNPGKVSSAVAARGDLGIKFREAREEPGIVMRDLLHALENR 344
           GKKKYSWL +G+K N   +K  GKVSS VAARG++GI++REAREEPGIVMRDLL+ALENR
Sbjct: 327 GKKKYSWLNAGAKANNNSVKVLGKVSSDVAARGEIGIRYREAREEPGIVMRDLLNALENR 386

Query: 345 RVGVNNTIAK 354
           RVGVN  I K
Sbjct: 387 RVGVNKVIPK 396

>Scas_611.2
          Length = 336

 Score =  263 bits (673), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 171/249 (68%), Gaps = 4/249 (1%)

Query: 109 KQQSDPDKLSDALLSAGVDIKEEEALLSSTVTTMKSNSQVSNSQIPLHPPFLHPSHVASM 168
           ++QSDP+K+ D L SAGVDI+EEEALL+S++   K+     + +IP HPPFLHP  VA  
Sbjct: 82  QKQSDPNKMQDVLFSAGVDIREEEALLNSSIIASKNKINTMDVRIPSHPPFLHPDQVARF 141

Query: 169 MKKVAAEQN--FNQDFSKSSELLSLMSTACELYXXXXXXXXXXXXXXXXKAVKLNSGRRS 226
           M++VA EQ     QDFSK  ELLS+MSTACE Y                +A+KLN+GRRS
Sbjct: 142 MQRVAKEQQRRTRQDFSKYPELLSMMSTACETYMRDILTNALVISRHRRRAIKLNAGRRS 201

Query: 227 ETTRVLRDLALXXXXXXXXXXXXXIALGLEKEITDTKLDSGETLHRASNATANMMIAGGK 286
           E + +LR++AL             IALGLEKE  + K+DS ETLHRASN TA +  AG K
Sbjct: 202 EISMILRNIALKEKKDEEKRVKKRIALGLEKEDLENKIDSEETLHRASNVTAGLR-AGSK 260

Query: 287 KKYSWLTSG-SKVNATDLKNPGKVSSAVAARGDLGIKFREAREEPGIVMRDLLHALENRR 345
           K+Y WLTS  SK   T +K+ GKV+S +AARG+ G+KFREAREEPGIVMRDLL+ALENRR
Sbjct: 261 KQYGWLTSSVSKPTNTSVKSAGKVASDIAARGETGLKFREAREEPGIVMRDLLYALENRR 320

Query: 346 VGVNNTIAK 354
            GV+N I+K
Sbjct: 321 NGVHNVISK 329

>CAGL0J11726g 1140123..1141133 similar to sp|P50105 Saccharomyces
           cerevisiae YMR005w MPT1 required for protein synthesis,
           hypothetical start
          Length = 336

 Score =  250 bits (638), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 130/247 (52%), Positives = 168/247 (68%), Gaps = 4/247 (1%)

Query: 109 KQQSDPDKLSDALLSAGVDIKEEEALLSSTVTTMKSNSQVSNSQIPLHPPFLHPSHVASM 168
           ++ +DP+K+ D L+SAGVD+KEEEALLSSTV    S +Q +   IP HPPFLHP  V++ 
Sbjct: 86  QKATDPNKMQDVLISAGVDLKEEEALLSSTVNV--SKTQQNAVVIPPHPPFLHPDQVSNF 143

Query: 169 MKKVAAEQNFNQDFSKSSELLSLMSTACELYXXXXXXXXXXXXXXXXKAVKLNSGRRSET 228
           MKKVA  QNFN  F+K++E+L +MS+ACE Y                K VK+N GRRS+ 
Sbjct: 144 MKKVAKTQNFNLSFTKNTEILDMMSSACESYLRDIITNTIVVSRHRRKGVKVNYGRRSQV 203

Query: 229 TRVLRDLALXXXXXXXXXXXXXIALGLEKEITDTKLDSGETLHRASNATANMMIAGGKKK 288
              LR +A+             IALGLEKE  + K+DS ETLHRASN TA +  AG KK+
Sbjct: 204 AAALRSIAINQKKEEERRMKKRIALGLEKEDYENKMDSEETLHRASNVTATLR-AGSKKQ 262

Query: 289 YSWLTSG-SKVNATDLKNPGKVSSAVAARGDLGIKFREAREEPGIVMRDLLHALENRRVG 347
           Y WLTS  +K  +  +K+ GKV++ +AARG+ G+KFREAREEPGIVMRDLL ALE+RR+G
Sbjct: 263 YGWLTSSINKPASIGVKSAGKVATEIAARGESGLKFREAREEPGIVMRDLLFALEHRRIG 322

Query: 348 VNNTIAK 354
           V+N I+K
Sbjct: 323 VHNIISK 329

>YMR005W (TAF4) [3970] chr13 (276045..277211) Component of RNA
           polymerase II general transcription factor TFIID [1167
           bp, 388 aa]
          Length = 388

 Score =  247 bits (630), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 130/247 (52%), Positives = 164/247 (66%), Gaps = 2/247 (0%)

Query: 109 KQQSDPDKLSDALLSAGVDIKEEEALLSSTVTTMKSNSQVSNSQIPLHPPFLHPSHVASM 168
           +QQSDP+K+ D L SAG+D++EEEALL+S++   KS  Q +N +IP H PFLHP  V++ 
Sbjct: 136 QQQSDPNKMQDVLFSAGIDVREEEALLNSSINASKSQVQTNNVKIPNHLPFLHPEQVSNY 195

Query: 169 MKKVAAEQNFNQDFSKSSELLSLMSTACELYXXXXXXXXXXXXXXXXKAVKLNSGRRSET 228
           M+KV  EQNFN   +K+ E+L +MS+ACE Y                KAVK+NSGRRSE 
Sbjct: 196 MRKVGKEQNFNLTPTKNPEILDMMSSACENYMRDILTNAIVISRHRRKAVKINSGRRSEV 255

Query: 229 TRVLRDLALXXXXXXXXXXXXXIALGLEKEITDTKLDSGETLHRASNATANMMIAGGKKK 288
           +  LR +AL             IALGLEKE  + K+DS ETLHRASN TA +  AG KK+
Sbjct: 256 SAALRAIALIQKKEEERRVKKRIALGLEKEDYENKIDSEETLHRASNVTAGLR-AGSKKQ 314

Query: 289 YSWLTSG-SKVNATDLKNPGKVSSAVAARGDLGIKFREAREEPGIVMRDLLHALENRRVG 347
           Y WLTS  +K  +   K+ GKV+S + ARG+ G+KFREAREEPGIVMRDLL ALENRR  
Sbjct: 315 YGWLTSSVNKPTSLGAKSSGKVASDITARGESGLKFREAREEPGIVMRDLLFALENRRNS 374

Query: 348 VNNTIAK 354
           V   I+K
Sbjct: 375 VQTIISK 381

>YJR107W (YJR107W) [2999] chr10 (627254..628240) Protein of unknown
           function, has similarity to acylglycerol lipase [987 bp,
           328 aa]
          Length = 328

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 127 DIKEEEALLSSTVTTMKSNSQVSNS--QIPLHPPFLHPSHVASMMKKVAAEQN 177
           D  E+E++L   +   K   +V ++   IP+ PPF HP+ +   + KV   QN
Sbjct: 227 DAIEKESILKDEIQFRKGYFRVVHTGDYIPMVPPFYHPAGLEMFINKVGLPQN 279

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.125    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,244,018
Number of extensions: 274165
Number of successful extensions: 664
Number of sequences better than 10.0: 14
Number of HSP's gapped: 650
Number of HSP's successfully gapped: 14
Length of query: 354
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 251
Effective length of database: 13,030,455
Effective search space: 3270644205
Effective search space used: 3270644205
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 62 (28.5 bits)