Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACL015W36235518740.0
Sklu_2419.236735515650.0
KLLA0C05984g36435415480.0
CAGL0E02343g36435715300.0
Kwal_56.2250236435715260.0
YOL010W (RCL1)36735414930.0
Scas_644.936435714900.0
ADR005W22438710.55
YDL117W (CYK3)88571655.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL015W
         (355 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL015W [1034] [Homologous to ScYOL010W (RCL1) - SH] complement(...   726   0.0  
Sklu_2419.2 YOL010W, Contig c2419 2010-3113                           607   0.0  
KLLA0C05984g 528906..530000 highly similar to sp|Q08096 Saccharo...   600   0.0  
CAGL0E02343g 225099..226193 highly similar to sp|Q08096 Saccharo...   593   0.0  
Kwal_56.22502                                                         592   0.0  
YOL010W (RCL1) [4806] chr15 (307938..309041) Protein required fo...   579   0.0  
Scas_644.9                                                            578   0.0  
ADR005W [1746] [Homologous to ScYER004W - SH] complement(712875....    32   0.55 
YDL117W (CYK3) [752] chr4 (248581..251238) Protein involved in c...    30   5.0  

>ACL015W [1034] [Homologous to ScYOL010W (RCL1) - SH]
           complement(332683..333771) [1089 bp, 362 aa]
          Length = 362

 Score =  726 bits (1874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/355 (100%), Positives = 355/355 (100%)

Query: 1   MSSKYVTFRGATNFRHRIVMATLSGKAVKIEKIRSEDMNPGLRDHEVSFLRLIEAVTNGS 60
           MSSKYVTFRGATNFRHRIVMATLSGKAVKIEKIRSEDMNPGLRDHEVSFLRLIEAVTNGS
Sbjct: 1   MSSKYVTFRGATNFRHRIVMATLSGKAVKIEKIRSEDMNPGLRDHEVSFLRLIEAVTNGS 60

Query: 61  VIEISYTGTTVIYRPGIIVGGSHTHNCPNGKAVGYYVEPLLYLAPFSKKKFSIILRGVTS 120
           VIEISYTGTTVIYRPGIIVGGSHTHNCPNGKAVGYYVEPLLYLAPFSKKKFSIILRGVTS
Sbjct: 61  VIEISYTGTTVIYRPGIIVGGSHTHNCPNGKAVGYYVEPLLYLAPFSKKKFSIILRGVTS 120

Query: 121 THQDAGIEAIKWGLMPVMEKFGVRECALHTLKRGAPPLGGGEVHLVVDSLIAQPITMHAL 180
           THQDAGIEAIKWGLMPVMEKFGVRECALHTLKRGAPPLGGGEVHLVVDSLIAQPITMHAL
Sbjct: 121 THQDAGIEAIKWGLMPVMEKFGVRECALHTLKRGAPPLGGGEVHLVVDSLIAQPITMHAL 180

Query: 181 ERPLISAIRGVAYSTRVSPSMVNRMIDGAKSVLKQVPCEANITADVWRGANSGKSPGWGI 240
           ERPLISAIRGVAYSTRVSPSMVNRMIDGAKSVLKQVPCEANITADVWRGANSGKSPGWGI
Sbjct: 181 ERPLISAIRGVAYSTRVSPSMVNRMIDGAKSVLKQVPCEANITADVWRGANSGKSPGWGI 240

Query: 241 TLVAETKKGWRYFTEAIGDAGEVPEDIGNKAAYNLLEEISRSAVVCRSQLPLAIVYMVIG 300
           TLVAETKKGWRYFTEAIGDAGEVPEDIGNKAAYNLLEEISRSAVVCRSQLPLAIVYMVIG
Sbjct: 241 TLVAETKKGWRYFTEAIGDAGEVPEDIGNKAAYNLLEEISRSAVVCRSQLPLAIVYMVIG 300

Query: 301 KEDIGRLRIARAQVDESLVLLLRDIKELFGTEALLKPADDDTDDLIVTIKGIGFT 355
           KEDIGRLRIARAQVDESLVLLLRDIKELFGTEALLKPADDDTDDLIVTIKGIGFT
Sbjct: 301 KEDIGRLRIARAQVDESLVLLLRDIKELFGTEALLKPADDDTDDLIVTIKGIGFT 355

>Sklu_2419.2 YOL010W, Contig c2419 2010-3113
          Length = 367

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/355 (80%), Positives = 323/355 (90%), Gaps = 1/355 (0%)

Query: 2   SSKYVTFRGATNFRHRIVMATLSGKAVKIEKIRSEDMNPGLRDHEVSFLRLIEAVTNGSV 61
           SS+Y  F+GA NFR RI++ATLSGKA+K+EKIRS+D+NPGL+D+EVSFLRL+EAVTNGS 
Sbjct: 6   SSRYTVFQGARNFRLRIILATLSGKAIKLEKIRSDDLNPGLKDYEVSFLRLMEAVTNGSA 65

Query: 62  IEISYTGTTVIYRPGIIVGGSHTHNCPNGKAVGYYVEPLLYLAPFSKKKFSIILRGVTST 121
           IEISYTGTTVIY+PGII+GGS+TH CP+ K VGY+VEP+LYLAPFSKKKFSI+ RG+T++
Sbjct: 66  IEISYTGTTVIYKPGIIIGGSYTHTCPSSKPVGYFVEPMLYLAPFSKKKFSILFRGITAS 125

Query: 122 HQDAGIEAIKWGLMPVMEKFGVRECALHTLKRGAPPLGGGEVHLVVDSLIAQPITMHALE 181
           H DAGIEAIKWG++PVMEKFGVRECALHTLKRG+PPLGGGEVHLVVDSLIAQPITMHAL+
Sbjct: 126 HNDAGIEAIKWGMLPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHALD 185

Query: 182 RPLISAIRGVAYSTRVSPSMVNRMIDGAKSVLKQVPCEANITADVWRGANSGKSPGWGIT 241
            PLIS+IRGV+YSTRVSPSMVNRMIDGAK+VLK V CE NITADVWRG NSGKSPGWGIT
Sbjct: 186 TPLISSIRGVSYSTRVSPSMVNRMIDGAKAVLKNVGCEVNITADVWRGDNSGKSPGWGIT 245

Query: 242 LVAETKKGWRYFTEAIGDAGEVPEDIGNKAAYNLLEEISRSAVVCRSQLPLAIVYMVIGK 301
           LVAE KKGWRYF+EAIGDAG+VPEDIG K AY LLEEIS+S VV R+QLPLAI YMVIGK
Sbjct: 246 LVAENKKGWRYFSEAIGDAGDVPEDIGTKVAYQLLEEISKSGVVGRAQLPLAITYMVIGK 305

Query: 302 EDIGRLRIARAQVDESLVLLLRDIKELFGTEALLKPADD-DTDDLIVTIKGIGFT 355
           EDIGRLRI + Q+DE  + LLRDIK++FGTE  LKP D+ D+DDLI TIKGIGFT
Sbjct: 306 EDIGRLRIKKEQIDEKFIWLLRDIKQVFGTEVYLKPTDEIDSDDLIATIKGIGFT 360

>KLLA0C05984g 528906..530000 highly similar to sp|Q08096
           Saccharomyces cerevisiae YOL010w RCL1 singleton, start
           by similarity
          Length = 364

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/354 (79%), Positives = 319/354 (90%)

Query: 2   SSKYVTFRGATNFRHRIVMATLSGKAVKIEKIRSEDMNPGLRDHEVSFLRLIEAVTNGSV 61
           SS+YVTF G+ NFR R+VMATLSGKA+KIEKIRS+D+NPGL+D+EVSFLRL+EAVTNGS 
Sbjct: 4   SSRYVTFEGSRNFRLRVVMATLSGKAIKIEKIRSDDLNPGLKDYEVSFLRLMEAVTNGSS 63

Query: 62  IEISYTGTTVIYRPGIIVGGSHTHNCPNGKAVGYYVEPLLYLAPFSKKKFSIILRGVTST 121
           IEISYTGTTVI+RPGII GGS+TH CPN K VGY+ EP+LYLAPFSKKKFSI+ RG+TS+
Sbjct: 64  IEISYTGTTVIFRPGIITGGSYTHQCPNSKPVGYFAEPMLYLAPFSKKKFSILFRGITSS 123

Query: 122 HQDAGIEAIKWGLMPVMEKFGVRECALHTLKRGAPPLGGGEVHLVVDSLIAQPITMHALE 181
           H DAGI+AIKWGLMP+MEKFGVRECALHTLKRG+PPLGGGEVHLVVDSLIAQPITMHAL+
Sbjct: 124 HNDAGIDAIKWGLMPIMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHALD 183

Query: 182 RPLISAIRGVAYSTRVSPSMVNRMIDGAKSVLKQVPCEANITADVWRGANSGKSPGWGIT 241
           + +IS+IRGV+YSTRVSPS+VNRMIDGAK VLK   CE NITADVWRG NSGKSPGWG+T
Sbjct: 184 KTMISSIRGVSYSTRVSPSLVNRMIDGAKKVLKSASCEVNITADVWRGENSGKSPGWGLT 243

Query: 242 LVAETKKGWRYFTEAIGDAGEVPEDIGNKAAYNLLEEISRSAVVCRSQLPLAIVYMVIGK 301
           LVAE K+GWR F+EAIGDAG+VPEDIG   AY+LLEEIS+S VV R+QLPL I+YM+IGK
Sbjct: 244 LVAENKQGWRIFSEAIGDAGDVPEDIGASVAYHLLEEISKSGVVGRNQLPLTILYMIIGK 303

Query: 302 EDIGRLRIARAQVDESLVLLLRDIKELFGTEALLKPADDDTDDLIVTIKGIGFT 355
           EDIGRLRI + Q+DE  V LLRDIK++FGTE LLKP DD+T DLI TIKGIGFT
Sbjct: 304 EDIGRLRITKDQIDERFVWLLRDIKKVFGTEILLKPVDDNTTDLIATIKGIGFT 357

>CAGL0E02343g 225099..226193 highly similar to sp|Q08096
           Saccharomyces cerevisiae YOL010w RCL1, start by
           similarity
          Length = 364

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/357 (78%), Positives = 316/357 (88%), Gaps = 2/357 (0%)

Query: 1   MSSKYVTFRGATNFRHRIVMATLSGKAVKIEKIRSEDMNPGLRDHEVSFLRLIEAVTNGS 60
           MSS+YV F+G  NFRHRI+ ATLSGK +KIEKIRS+D+NPGLRDHEVSFLRL+EAVTNGS
Sbjct: 1   MSSQYVVFQGPENFRHRIIFATLSGKPIKIEKIRSQDLNPGLRDHEVSFLRLMEAVTNGS 60

Query: 61  VIEISYTGTTVIYRPGIIVGGSHTHNCPNGKAVGYYVEPLLYLAPFSKKKFSIILRGVTS 120
           VIEISYTGTTVIYRPGII+GG +TH CP  K VGY+VEP+LYLAPFSKKKFSI+ +G+T+
Sbjct: 61  VIEISYTGTTVIYRPGIIIGGPYTHTCPPSKPVGYFVEPMLYLAPFSKKKFSIVFKGITA 120

Query: 121 THQDAGIEAIKWGLMPVMEKFGVRECALHTLKRGAPPLGGGEVHLVVDSLIAQPITMHAL 180
           +H DAGIEAIKWGLMPVMEKFGVRECALHTLKRG+PP GGGEVHLVVDSLIAQPITMH L
Sbjct: 121 SHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPQGGGEVHLVVDSLIAQPITMHEL 180

Query: 181 ERPLISAIRGVAYSTRVSPSMVNRMIDGAKSVLKQVPCEANITADVWRGANSGKSPGWGI 240
           +RP+IS+IRGVAYSTRVSPSMVNRMIDGAK VLK V CE NITADVWRG NSGKSPGWGI
Sbjct: 181 DRPVISSIRGVAYSTRVSPSMVNRMIDGAKQVLKNVKCEVNITADVWRGENSGKSPGWGI 240

Query: 241 TLVAET-KKGWRYFTEAIGDAGEVPEDIGNKAAYNLLEEISRSAVVCRSQLPLAIVYMVI 299
           T+VAET KKGW YF E IG +G++PE+IG+K AY L+EEIS+SA V R+QLPLAI YMVI
Sbjct: 241 TIVAETKKKGWCYFAEEIGGSGDIPEEIGSKVAYKLIEEISKSAAVDRNQLPLAITYMVI 300

Query: 300 GKEDIGRLRIARAQVDESLVLLLRDIKELFGTEALLKPADD-DTDDLIVTIKGIGFT 355
           GKEDIGRLRI R QVDE  + +LRDIK++FGTE  LKP DD  +DD I T+KGIGFT
Sbjct: 301 GKEDIGRLRITREQVDERFIQMLRDIKKIFGTEVFLKPVDDIGSDDFIATVKGIGFT 357

>Kwal_56.22502
          Length = 364

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/357 (79%), Positives = 320/357 (89%), Gaps = 2/357 (0%)

Query: 1   MSSKYV-TFRGATNFRHRIVMATLSGKAVKIEKIRSEDMNPGLRDHEVSFLRLIEAVTNG 59
           MSS  + +F+G  NFR  IV+ATLSGK +KIEKIRS+D+NPGLRDHEVSFLRL+EAVTNG
Sbjct: 1   MSSMRINSFQGVRNFRLLIVLATLSGKPIKIEKIRSDDLNPGLRDHEVSFLRLMEAVTNG 60

Query: 60  SVIEISYTGTTVIYRPGIIVGGSHTHNCPNGKAVGYYVEPLLYLAPFSKKKFSIILRGVT 119
           S IEISYTGTTVIY+PGII+GGS+THNCP GK VGYYVEP+LYLAPFSKKKFSII RGVT
Sbjct: 61  STIEISYTGTTVIYKPGIIIGGSYTHNCPPGKPVGYYVEPMLYLAPFSKKKFSIIFRGVT 120

Query: 120 STHQDAGIEAIKWGLMPVMEKFGVRECALHTLKRGAPPLGGGEVHLVVDSLIAQPITMHA 179
           ++H DAGIEAIKWGLMPVMEKFGVRECALHTLKRGAPPLGGGEVHLVVDSLIAQPITMHA
Sbjct: 121 ASHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGAPPLGGGEVHLVVDSLIAQPITMHA 180

Query: 180 LERPLISAIRGVAYSTRVSPSMVNRMIDGAKSVLKQVPCEANITADVWRGANSGKSPGWG 239
           L+ P I++IRGVAYSTRVSPSMVNRMI+GA++VLK V CE +ITADVWRG NSGKSPGWG
Sbjct: 181 LDTPQIASIRGVAYSTRVSPSMVNRMIEGARNVLKNVGCEVDITADVWRGENSGKSPGWG 240

Query: 240 ITLVAETKKGWRYFTEAIGDAGEVPEDIGNKAAYNLLEEISRSAVVCRSQLPLAIVYMVI 299
           ITLVAETKKGW+YF+E IG AG+VPEDIG + AY LLEEIS SAVV R+QL LAI+YMVI
Sbjct: 241 ITLVAETKKGWKYFSEGIGGAGDVPEDIGAQIAYELLEEISTSAVVGRNQLALAIIYMVI 300

Query: 300 GKEDIGRLRIARAQVDESLVLLLRDIKELFGTEALLKPADD-DTDDLIVTIKGIGFT 355
           GKEDIGRLRI +AQ+DE  + LLR IK++FGTE  LKP DD D+DDLI T+KGIGF+
Sbjct: 301 GKEDIGRLRITKAQIDEKFIWLLRHIKQIFGTEVFLKPVDDADSDDLIATVKGIGFS 357

>YOL010W (RCL1) [4806] chr15 (307938..309041) Protein required for
           pre-rRNA processing at cleavage sites A0, A1 and A2, has
           similarity to RNA 3'-terminal phosphate cyclase,
           interacts with Bms1p [1104 bp, 367 aa]
          Length = 367

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/354 (77%), Positives = 314/354 (88%), Gaps = 2/354 (0%)

Query: 4   KYVTFRGATNFRHRIVMATLSGKAVKIEKIRSEDMNPGLRDHEVSFLRLIEAVTNGSVIE 63
           KY TF+G+ NFR RIV+ATLSGK +KIEKIRS D+NPGL+D+EVSFLRLIE+VTNGSVIE
Sbjct: 7   KYTTFQGSQNFRLRIVLATLSGKPIKIEKIRSGDLNPGLKDYEVSFLRLIESVTNGSVIE 66

Query: 64  ISYTGTTVIYRPGIIVGGSHTHNCPNGKAVGYYVEPLLYLAPFSKKKFSIILRGVTSTHQ 123
           ISYTGTTVIYRPGIIVGG+ TH CP+ K VGY+VEP+LYLAPFSKKKFSI+ +G+T++H 
Sbjct: 67  ISYTGTTVIYRPGIIVGGASTHICPSSKPVGYFVEPMLYLAPFSKKKFSILFKGITASHN 126

Query: 124 DAGIEAIKWGLMPVMEKFGVRECALHTLKRGAPPLGGGEVHLVVDSLIAQPITMHALERP 183
           DAGIEAIKWGLMPVMEKFGVRECALHTLKRG+PPLGGGEVHLVVDSLIAQPITMH ++RP
Sbjct: 127 DAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHEIDRP 186

Query: 184 LISAIRGVAYSTRVSPSMVNRMIDGAKSVLKQVPCEANITADVWRGANSGKSPGWGITLV 243
           +IS+I GVAYSTRVSPS+VNRMIDGAK VLK + CE NITADVWRG NSGKSPGWGITLV
Sbjct: 187 IISSITGVAYSTRVSPSLVNRMIDGAKKVLKNLQCEVNITADVWRGENSGKSPGWGITLV 246

Query: 244 AETK-KGWRYFTEAIGDAGEVPEDIGNKAAYNLLEEISRSAVVCRSQLPLAIVYMVIGKE 302
           A++K KGW YF E IGDAG +PE++G K A  LLEEIS+SA V R+QLPLAIVYMVIGKE
Sbjct: 247 AQSKQKGWSYFAEDIGDAGSIPEELGEKVACQLLEEISKSAAVGRNQLPLAIVYMVIGKE 306

Query: 303 DIGRLRIARAQVDESLVLLLRDIKELFGTEALLKPADD-DTDDLIVTIKGIGFT 355
           DIGRLRI + Q+DE  ++LLRDIK++F TE  LKP D+ D +D+I TIKGIGFT
Sbjct: 307 DIGRLRINKEQIDERFIILLRDIKKIFNTEVFLKPVDEADNEDMIATIKGIGFT 360

>Scas_644.9
          Length = 364

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/357 (75%), Positives = 316/357 (88%), Gaps = 2/357 (0%)

Query: 1   MSSK-YVTFRGATNFRHRIVMATLSGKAVKIEKIRSEDMNPGLRDHEVSFLRLIEAVTNG 59
           MSSK Y+TF+G+ NFR RI+++TLSGK++KIEKIRS D+NPGL+D+EVSFLRL+E+VTNG
Sbjct: 1   MSSKPYITFQGSQNFRLRIILSTLSGKSIKIEKIRSTDLNPGLKDYEVSFLRLMESVTNG 60

Query: 60  SVIEISYTGTTVIYRPGIIVGGSHTHNCPNGKAVGYYVEPLLYLAPFSKKKFSIILRGVT 119
           SVIEISYTGTT++YRPGII GG+HTHNCP  K VGY+VEP+LYLAPFSKKKFSII +G+T
Sbjct: 61  SVIEISYTGTTILYRPGIISGGAHTHNCPPSKPVGYFVEPMLYLAPFSKKKFSIIFKGIT 120

Query: 120 STHQDAGIEAIKWGLMPVMEKFGVRECALHTLKRGAPPLGGGEVHLVVDSLIAQPITMHA 179
           ++H DAGIEAIKWGL+P++EKFG RECALHTLKRG+PP GGGEVHLVVDSLIAQPITMH 
Sbjct: 121 ASHSDAGIEAIKWGLLPILEKFGCRECALHTLKRGSPPNGGGEVHLVVDSLIAQPITMHE 180

Query: 180 LERPLISAIRGVAYSTRVSPSMVNRMIDGAKSVLKQVPCEANITADVWRGANSGKSPGWG 239
           LERP I+ +RGVAYSTRVSPSMVNRMID AK VL ++ C   ITADVWRG NSGKSPGWG
Sbjct: 181 LERPTIATVRGVAYSTRVSPSMVNRMIDSAKKVLNKLSCPVEITADVWRGENSGKSPGWG 240

Query: 240 ITLVAETKKGWRYFTEAIGDAGEVPEDIGNKAAYNLLEEISRSAVVCRSQLPLAIVYMVI 299
           ITLVA++KKGW YF+EAIGDAG+VPEDIG   AY LLEEIS SA V R+QL LAIVYMVI
Sbjct: 241 ITLVAQSKKGWCYFSEAIGDAGDVPEDIGQLVAYRLLEEISMSAAVGRNQLALAIVYMVI 300

Query: 300 GKEDIGRLRIARAQVDESLVLLLRDIKELFGTEALLKPADD-DTDDLIVTIKGIGFT 355
           GKEDIGRLRI + Q+DE+ + LLRDIK++FGTE  LKP DD ++DD+I TIKG+GFT
Sbjct: 301 GKEDIGRLRITKDQIDENFIYLLRDIKKVFGTEVFLKPVDDLNSDDMIATIKGVGFT 357

>ADR005W [1746] [Homologous to ScYER004W - SH]
           complement(712875..713549) [675 bp, 224 aa]
          Length = 224

 Score = 32.0 bits (71), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 70  TVIYRPGIIVGGSHTHNCPNGKAVGYYVEPLLYLAPFS 107
           TVI RPG+++G   TH+   G +V  ++  L+Y   F 
Sbjct: 141 TVILRPGVLLGERETHHKGFGNSVAVFLGKLVYRGRFQ 178

>YDL117W (CYK3) [752] chr4 (248581..251238) Protein involved in
           cytokinesis [2658 bp, 885 aa]
          Length = 885

 Score = 29.6 bits (65), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 5/71 (7%)

Query: 190 GVAYSTRVSPSMVNRMIDGAKS----VLKQVPCEANITADVWRGANSGKSPG-WGITLVA 244
           G+ YS+   P+   +     KS    V + V  + +     W+G+   K PG W   ++A
Sbjct: 811 GIVYSSDEGPNQNRKQPMAIKSPSGRVHELVKSDPHFPYGTWKGSIKIKEPGVWSALVIA 870

Query: 245 ETKKGWRYFTE 255
           ++  GW  F E
Sbjct: 871 DSGIGWSVFAE 881

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,824,507
Number of extensions: 437562
Number of successful extensions: 925
Number of sequences better than 10.0: 10
Number of HSP's gapped: 930
Number of HSP's successfully gapped: 10
Length of query: 355
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 252
Effective length of database: 13,030,455
Effective search space: 3283674660
Effective search space used: 3283674660
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)