Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACL014C52451426920.0
Sklu_2419.353144214310.0
KLLA0C06006g51241514130.0
Kwal_56.2249952738912691e-171
Scas_644.1051244512191e-164
CAGL0J11704g50944611981e-160
YMR004W (MVP1)51144511851e-158
ACR074W4101451352e-08
Scas_690.224282071343e-08
Scas_663.191691221212e-07
Kwal_23.2896421991263e-07
ADR390C163961142e-06
YOR069W (VPS5)6752721174e-06
KLLA0C10967g400871156e-06
CAGL0G06424g164961052e-05
YJL036W (SNX4)4231841085e-05
YOR357C (GRD19)16275972e-04
CAGL0J01001g4303671013e-04
CAGL0I01144g17397947e-04
ADR211W600398940.002
YDL113C (ATG20)64034940.003
Scas_580.318382900.003
Sklu_1971.416569890.003
Scas_322.217669900.003
KLLA0F16643g66573930.003
Kwal_23.343861476930.003
CAGL0H10428g753112920.005
CAGL0L10472g638167910.005
Kwal_26.685816075860.007
KLLA0E09141g63631890.010
Sklu_2428.664795880.011
Kwal_55.2153315978820.021
Sklu_2219.263432860.022
YHR105W (YPT35)21487840.022
ADR192C60363830.044
Scas_613.2164931830.047
Sklu_2167.434994800.090
Sklu_2221.567166800.13
Scas_698.32699110790.16
Kwal_55.2174562972740.61
Sklu_2404.316369691.1
Kwal_47.1907934584711.2
Scas_712.3335794701.7
Scas_714.5863663692.3
Kwal_47.1860162234683.4
KLLA0C15543g98258674.0
KLLA0A03718g16479645.6
KLLA0E03850g113282656.7
CAGL0F00957g61164649.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL014C
         (514 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL014C [1035] [Homologous to ScYMR004W (MVP1) - SH] (333900..33...  1041   0.0  
Sklu_2419.3 YMR004W, Contig c2419 3267-4862 reverse complement        555   0.0  
KLLA0C06006g complement(530169..531707) similar to sp|P40959 Sac...   548   0.0  
Kwal_56.22499                                                         493   e-171
Scas_644.10                                                           474   e-164
CAGL0J11704g 1138009..1139538 similar to sp|P40959 Saccharomyces...   466   e-160
YMR004W (MVP1) [3969] chr13 (274017..275552) Protein required fo...   461   e-158
ACR074W [1121] [Homologous to ScYJL036W (SNX4) - SH] complement(...    57   2e-08
Scas_690.22                                                            56   3e-08
Scas_663.19                                                            51   2e-07
Kwal_23.2896                                                           53   3e-07
ADR390C [2131] [Homologous to ScYOR357C (GRD19) - SH] (1410245.....    49   2e-06
YOR069W (VPS5) [4876] chr15 (453769..455796) Member of the sorti...    50   4e-06
KLLA0C10967g 943312..944514 similar to sp|P47057 Saccharomyces c...    49   6e-06
CAGL0G06424g complement(621136..621630) highly similar to sp|Q08...    45   2e-05
YJL036W (SNX4) [2875] chr10 (378741..380012) Putative nexin sort...    46   5e-05
YOR357C (GRD19) [5134] chr15 complement(1009220..1009708) Protei...    42   2e-04
CAGL0J01001g 98637..99929 similar to sp|P47057 Saccharomyces cer...    44   3e-04
CAGL0I01144g 95410..95931 similar to sp|P38815 Saccharomyces cer...    41   7e-04
ADR211W [1952] [Homologous to ScYOR069W (VPS5) - SH; ScYKR078W -...    41   0.002
YDL113C (ATG20) [756] chr4 complement(256633..258555) Protein th...    41   0.003
Scas_580.3                                                             39   0.003
Sklu_1971.4 YHR105W, Contig c1971 6476-6973                            39   0.003
Scas_322.2                                                             39   0.003
KLLA0F16643g 1533628..1535625 similar to sp|Q92331 Saccharomyces...    40   0.003
Kwal_23.3438                                                           40   0.003
CAGL0H10428g 1016374..1018635 similar to tr|Q07528 Saccharomyces...    40   0.005
CAGL0L10472g 1117867..1119783 similar to sp|Q92331 Saccharomyces...    40   0.005
Kwal_26.6858                                                           38   0.007
KLLA0E09141g complement(817829..819739) similar to sgd|S0002271 ...    39   0.010
Sklu_2428.6 YOR069W, Contig c2428 9095-11038 reverse complement        39   0.011
Kwal_55.21533                                                          36   0.021
Sklu_2219.2 YDL113C, Contig c2219 4054-5958                            38   0.022
YHR105W (YPT35) [2393] chr8 (324768..325412) Protein that may pl...    37   0.022
ADR192C [1933] [Homologous to ScYDR425W - SH] (1037233..1039044)...    37   0.044
Scas_613.21                                                            37   0.047
Sklu_2167.4 YGL212W, Contig c2167 6607-7656 reverse complement         35   0.090
Sklu_2221.5 YDR425W, Contig c2221 7089-9104                            35   0.13 
Scas_698.32                                                            35   0.16 
Kwal_55.21745                                                          33   0.61 
Sklu_2404.3 YOR357C, Contig c2404 1457-1948                            31   1.1  
Kwal_47.19079                                                          32   1.2  
Scas_712.33                                                            32   1.7  
Scas_714.58                                                            31   2.3  
Kwal_47.18601                                                          31   3.4  
KLLA0C15543g 1349181..1352129 similar to sgd|S0006301 Saccharomy...    30   4.0  
KLLA0A03718g 334828..335322 similar to sp|Q08826 Saccharomyces c...    29   5.6  
KLLA0E03850g complement(358995..362393) weakly similar to sp|P53...    30   6.7  
CAGL0F00957g 102956..104791 similar to sp|P31383 Saccharomyces c...    29   9.9  

>ACL014C [1035] [Homologous to ScYMR004W (MVP1) - SH]
           (333900..335474) [1575 bp, 524 aa]
          Length = 524

 Score = 1041 bits (2692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/514 (97%), Positives = 501/514 (97%)

Query: 1   MMDLDSQELWGRGPSMESPNNAWASVQRTPADSARTQQIVSPVVRQAEXXXXXXXXXXXX 60
           MMDLDSQELWGRGPSMESPNNAWASVQRTPADSARTQQIVSPVVRQAE            
Sbjct: 1   MMDLDSQELWGRGPSMESPNNAWASVQRTPADSARTQQIVSPVVRQAESLGSLTLTDSSL 60

Query: 61  XAEVKETMRNNYNERKMYEPGTPALEQTVWGAPPSQLDASISGLDTSMAPVASQSSMCDE 120
            AEVKETMRNNYNERKMYEPGTPALEQTVWGAPPSQLDASISGLDTSMAPVASQSSMCDE
Sbjct: 61  SAEVKETMRNNYNERKMYEPGTPALEQTVWGAPPSQLDASISGLDTSMAPVASQSSMCDE 120

Query: 121 LHSEDLENWMNSRRKTYNPLAKNIVVVEEIPEREGILFKHTNYLVKHLVVLPNTNPSSNQ 180
           LHSEDLENWMNSRRKTYNPLAKNIVVVEEIPEREGILFKHTNYLVKHLVVLPNTNPSSNQ
Sbjct: 121 LHSEDLENWMNSRRKTYNPLAKNIVVVEEIPEREGILFKHTNYLVKHLVVLPNTNPSSNQ 180

Query: 181 TVIRRYSDFNWLQEVLLKKYPFRMIPELPPKKIGAQNADPIFLARRRKGLCRFINLVIMH 240
           TVIRRYSDFNWLQEVLLKKYPFRMIPELPPKKIGAQNADPIFLARRRKGLCRFINLVIMH
Sbjct: 181 TVIRRYSDFNWLQEVLLKKYPFRMIPELPPKKIGAQNADPIFLARRRKGLCRFINLVIMH 240

Query: 241 PVLKQDDLVLTFLTVPTDLGSWRKQANYDTTEEFTDQKIDKAFISLWHKELSNQWNKADA 300
           PVLKQDDLVLTFLTVPTDLGSWRKQANYDTTEEFTDQKIDKAFISLWHKELSNQWNKADA
Sbjct: 241 PVLKQDDLVLTFLTVPTDLGSWRKQANYDTTEEFTDQKIDKAFISLWHKELSNQWNKADA 300

Query: 301 KIDELLESWIKTSVLVERYERRMRQVSEERRLLGRVIEEFADNSVTLYPLEEGHLFHDIN 360
           KIDELLESWIKTSVLVERYERRMRQVSEERRLLGRVIEEFADNSVTLYPLEEGHLFHDIN
Sbjct: 301 KIDELLESWIKTSVLVERYERRMRQVSEERRLLGRVIEEFADNSVTLYPLEEGHLFHDIN 360

Query: 361 SHISTISKHLNSLADTSKKERQEVEEHLSVKFKTFIDIIIALKGVFDRYKIMAGNNIAHL 420
           SHISTISKHLNSLADTSKKERQEVEEHLSVKFKTFIDIIIALKGVFDRYKIMAGNNIAHL
Sbjct: 361 SHISTISKHLNSLADTSKKERQEVEEHLSVKFKTFIDIIIALKGVFDRYKIMAGNNIAHL 420

Query: 421 QRRVEINMDKLQSMESNPDVKGAEYDKLRQTIQRDKRTIAEQLNRSWLIRKCILEEFVIF 480
           QRRVEINMDKLQSMESNPDVKGAEYDKLRQTIQRDKRTIAEQLNRSWLIRKCILEEFVIF
Sbjct: 421 QRRVEINMDKLQSMESNPDVKGAEYDKLRQTIQRDKRTIAEQLNRSWLIRKCILEEFVIF 480

Query: 481 QETQFCITHVFQEWAKMHVKYANETTESWEKVYA 514
           QETQFCITHVFQEWAKMHVKYANETTESWEKVYA
Sbjct: 481 QETQFCITHVFQEWAKMHVKYANETTESWEKVYA 514

>Sklu_2419.3 YMR004W, Contig c2419 3267-4862 reverse complement
          Length = 531

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/442 (58%), Positives = 339/442 (76%), Gaps = 10/442 (2%)

Query: 81  GTPALEQTVWGAPPSQLDASI---------SGLDTSMAPVASQSSMCDELHSEDLENWMN 131
           G   +E ++W   P Q +A +           + +     ++ +   D++  + L  W+ 
Sbjct: 80  GESVMEHSIWEDHPKQSNADVMIPSEPVLVGNVLSDPLNASTSNKSTDDVFDDVLATWIE 139

Query: 132 SRRKTYNPLAKNIVVVEEIPEREGILFKHTNYLVKHLVVLPNTNPSSNQTVIRRYSDFNW 191
           + R TYNPL+ +IV+VEEIPEREGILFKHTNYLVKHL+VLP+T+PSS+++VIRRYSDF W
Sbjct: 140 AVRTTYNPLSTDIVIVEEIPEREGILFKHTNYLVKHLIVLPDTDPSSDRSVIRRYSDFVW 199

Query: 192 LQEVLLKKYPFRMIPELPPKKIGAQNADPIFLARRRKGLCRFINLVIMHPVLKQDDLVLT 251
           LQEVLLKKYPFRMIPELPPKKIG+ +AD  FL +RR+GL RFINLV+ HPVL  DDLVLT
Sbjct: 200 LQEVLLKKYPFRMIPELPPKKIGSHSADRAFLLKRRRGLSRFINLVMKHPVLNHDDLVLT 259

Query: 252 FLTVPTDLGSWRKQANYDTTEEFTDQKIDKAFISLWHKELSNQWNKADAKIDELLESWIK 311
           FLTVPTDL  WRKQA+YDTTEEFTD+KI K+F+ +W KEL+ QWN+AD+KID  LE+W K
Sbjct: 260 FLTVPTDLSGWRKQASYDTTEEFTDKKISKSFMKMWRKELAEQWNEADSKIDLALETWAK 319

Query: 312 TSVLVERYERRMRQVSEERRLLGRVIEEFADNSVTLYPLEEGHLFHDINSHISTISKHLN 371
            +VLVERY RR++Q+SE+R L   ++ EF   + +LYP+ +  +  DIN+H   I+KHL+
Sbjct: 320 ITVLVERYSRRLKQISEDRTLFESIVNEFTQTAPSLYPINKDTI-EDINAHTGIITKHLS 378

Query: 372 SLADTSKKERQEVEEHLSVKFKTFIDIIIALKGVFDRYKIMAGNNIAHLQRRVEINMDKL 431
                + KE +E   +L VKFK FID+I +LKG+F+RYKI+AGNNIA LQRRVE+N++ +
Sbjct: 379 DCNQLTSKEIEETHLNLLVKFKIFIDMIFSLKGLFERYKILAGNNIAQLQRRVELNIETM 438

Query: 432 QSMESNPDVKGAEYDKLRQTIQRDKRTIAEQLNRSWLIRKCILEEFVIFQETQFCITHVF 491
            +M+  PDV+GAEYDK++Q +QRDKRTIAEQ+NRSWLIR+CILEEF IFQETQF ITH F
Sbjct: 439 NNMKGKPDVRGAEYDKVKQAVQRDKRTIAEQMNRSWLIRECILEEFTIFQETQFVITHSF 498

Query: 492 QEWAKMHVKYANETTESWEKVY 513
           QEWAK+++KYA+  +  WE+++
Sbjct: 499 QEWAKLNMKYADLNSNEWERLF 520

>KLLA0C06006g complement(530169..531707) similar to sp|P40959
           Saccharomyces cerevisiae YMR004w MVP1 required for
           vacuolar protein sorting singleton, start by similarity
          Length = 512

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/415 (61%), Positives = 329/415 (79%), Gaps = 6/415 (1%)

Query: 98  DASISGLDTSMAPVASQSSMCDELHSEDLENWMNSRRKTYNPLAKNIVVVEEIPEREGIL 157
           +  I G++   A    Q +  DE      +NW+ S RKTY PLA++IV VEEIPEREG++
Sbjct: 92  ETDIRGVNRFQATDTPQYAANDEY-----KNWVESVRKTYFPLAEDIVSVEEIPEREGLV 146

Query: 158 FKHTNYLVKHLVVLPNTNPSSNQTVIRRYSDFNWLQEVLLKKYPFRMIPELPPKKIGAQN 217
           FKHTNYLVKHL  LPNT+PS ++TV+RRYSDF+WLQ+VLL+KYPFRM+PELPPKKIG+QN
Sbjct: 147 FKHTNYLVKHLTPLPNTDPSDDRTVVRRYSDFDWLQDVLLRKYPFRMVPELPPKKIGSQN 206

Query: 218 ADPIFLARRRKGLCRFINLVIMHPVLKQDDLVLTFLTVPTDLGSWRKQANYDTTEEFTDQ 277
           ADP+FLA+RRKGL RFINLV+ HPVL+ DDLVLTFLTVPTDL  WRKQA+YDTT+EFTD+
Sbjct: 207 ADPLFLAKRRKGLSRFINLVMKHPVLRSDDLVLTFLTVPTDLSGWRKQAHYDTTDEFTDK 266

Query: 278 KIDKAFISLWHKELSNQWNKADAKIDELLESWIKTSVLVERYERRMRQVSEERRLLGRVI 337
            I  +F++LW KE S QWNKAD +ID  L++W+K +VL+ERYE+RM+QV+ ER+LLG+++
Sbjct: 267 HISSSFMNLWRKEFSEQWNKADERIDIALDTWVKVTVLIERYEKRMKQVAHERKLLGQIL 326

Query: 338 EEFADNSVTLYPLEEGHLFHDINSHISTISKHLNSLADTSKKERQEVEEHLSVKFKTFID 397
               D +  LYP +       IN  +  I +HLNS AD  ++E +EV+  LSV+FK FID
Sbjct: 327 NAIPDTTEALYP-QSTATVSQINEGVGLIVEHLNSCADVIERENEEVDSGLSVRFKAFID 385

Query: 398 IIIALKGVFDRYKIMAGNNIAHLQRRVEINMDKLQSMESNPDVKGAEYDKLRQTIQRDKR 457
           +IIALKG+F+RYK+MAGNNI  LQRRVEIN ++L ++ESNPDVKGAEYD+++Q+I RDKR
Sbjct: 386 VIIALKGLFERYKMMAGNNIPQLQRRVEINQERLNTLESNPDVKGAEYDRVKQSISRDKR 445

Query: 458 TIAEQLNRSWLIRKCILEEFVIFQETQFCITHVFQEWAKMHVKYANETTESWEKV 512
           +I +Q+NRSWLIR+CILEEF IF ETQF IT  FQ W +++++Y N   ++WEK+
Sbjct: 446 SILDQMNRSWLIRECILEEFTIFHETQFLITDCFQRWIEINLRYTNNNVDNWEKI 500

>Kwal_56.22499
          Length = 527

 Score =  493 bits (1269), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 217/389 (55%), Positives = 303/389 (77%), Gaps = 1/389 (0%)

Query: 124 EDLENWMNSRRKTYNPLAKNIVVVEEIPEREGILFKHTNYLVKHLVVLPNTNPSSNQTVI 183
           +D E+W  + RK+YNPL  +I+VVEE+PEREG+LFKHTNYLV+HL+ LP+T+PSS+++VI
Sbjct: 128 QDFESWSEAVRKSYNPLVADIIVVEELPEREGLLFKHTNYLVRHLIDLPDTSPSSDRSVI 187

Query: 184 RRYSDFNWLQEVLLKKYPFRMIPELPPKKIGAQNADPIFLARRRKGLCRFINLVIMHPVL 243
           RRYSDF WLQEVLLKKYPFRMIP+LPPK+IG+   DP+F  +RR GL RFINLV+ HPV 
Sbjct: 188 RRYSDFVWLQEVLLKKYPFRMIPDLPPKRIGSHTTDPVFSIKRRNGLSRFINLVVKHPVF 247

Query: 244 KQDDLVLTFLTVPTDLGSWRKQANYDTTEEFTDQKIDKAFISLWHKELSNQWNKADAKID 303
           K+DDLVLTFLTVPTDL  WRKQA+YDT++EFTD+K+   F+ +WHK L+ +WN+ADA ID
Sbjct: 248 KKDDLVLTFLTVPTDLLGWRKQASYDTSDEFTDRKVSVTFVKMWHKGLAERWNEADANID 307

Query: 304 ELLESWIKTSVLVERYERRMRQVSEERRLLGRVIEEFADNSVTLYPLEEGHLFHDINSHI 363
             LE W K +VL++RYERRM  ++++R +L  ++++F +    L+  ++G   + I  H+
Sbjct: 308 TALELWAKITVLIDRYERRMAFIAQDRDILRSMLDQFTEGMPHLFNSDDGST-NVIGDHL 366

Query: 364 STISKHLNSLADTSKKERQEVEEHLSVKFKTFIDIIIALKGVFDRYKIMAGNNIAHLQRR 423
             +SKH  S  +   +E QE  + LS +F+TF D ++ALKG+F+RYK MAGNN+  LQRR
Sbjct: 367 GRVSKHFGSCNELVSQENQEACKELSPRFRTFTDTLLALKGLFERYKAMAGNNVPQLQRR 426

Query: 424 VEINMDKLQSMESNPDVKGAEYDKLRQTIQRDKRTIAEQLNRSWLIRKCILEEFVIFQET 483
           +E+N D+L+ M+  PD+KGAEYD+++Q+IQRD++ IAEQ+NRSWL+R+CIL+E+V FQE 
Sbjct: 427 IEVNSDRLEQMKDKPDLKGAEYDRVKQSIQRDRKAIAEQMNRSWLVRECILQEYVYFQEA 486

Query: 484 QFCITHVFQEWAKMHVKYANETTESWEKV 512
           QF I+ +FQ W  +++KY    +  W+K+
Sbjct: 487 QFLISDIFQRWVLLNMKYYELNSNEWDKL 515

>Scas_644.10
          Length = 512

 Score =  474 bits (1219), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 220/445 (49%), Positives = 309/445 (69%), Gaps = 9/445 (2%)

Query: 77  MYEPGTPALEQTVWG-APPSQLDASISGL------DTSMAPVASQS-SMCDEL-HSEDLE 127
           ++   T  LEQ VWG APP     ++  +           P   QS     EL  SE   
Sbjct: 56  LFNSKTDILEQRVWGEAPPDPTPNTVVPIIEPNINQPQSGPTQGQSHEQSSELDQSELFG 115

Query: 128 NWMNSRRKTYNPLAKNIVVVEEIPEREGILFKHTNYLVKHLVVLPNTNPSSNQTVIRRYS 187
            W +  RK+YNPL  +I+ +EEIPEREG+LFKHTNY VKHL+ LP  + + +  V+RRYS
Sbjct: 116 QWCDQIRKSYNPLGPDIITIEEIPEREGLLFKHTNYSVKHLIELPGQDSAKDNCVVRRYS 175

Query: 188 DFNWLQEVLLKKYPFRMIPELPPKKIGAQNADPIFLARRRKGLCRFINLVIMHPVLKQDD 247
           DF WLQE LL++YPFRM+PELPPKK+G+Q AD IFL +RRKGL RFINLV+ HPV ++DD
Sbjct: 176 DFLWLQETLLRRYPFRMVPELPPKKLGSQIADKIFLEKRRKGLLRFINLVMKHPVFQKDD 235

Query: 248 LVLTFLTVPTDLGSWRKQANYDTTEEFTDQKIDKAFISLWHKELSNQWNKADAKIDELLE 307
           LVLTFLTVPT+L +WRKQA++DT++EF D++I  +F+ +WHK +S QWN A + I+  +E
Sbjct: 236 LVLTFLTVPTELSNWRKQASFDTSDEFIDKRIAASFVKMWHKGISEQWNNAASSIERTME 295

Query: 308 SWIKTSVLVERYERRMRQVSEERRLLGRVIEEFADNSVTLYPLEEGHLFHDINSHISTIS 367
            W +  +LVER+ER+++Q++ E+ + G ++ + ++ +  LYP+E+     DIN+H S I 
Sbjct: 296 IWSRICILVERHERKLKQMAHEQSIFGSLVNDLSNLTPNLYPIEQSDTVLDINNHFSIIK 355

Query: 368 KHLNSLADTSKKERQEVEEHLSVKFKTFIDIIIALKGVFDRYKIMAGNNIAHLQRRVEIN 427
           KHLN   D ++    +    L  KFK F DI+++L+G+F+RYKIMA NNI  LQR V +N
Sbjct: 356 KHLNKTQDIAQDNATKTCNSLLPKFKLFTDILLSLRGLFERYKIMATNNIPQLQRHVVLN 415

Query: 428 MDKLQSMESNPDVKGAEYDKLRQTIQRDKRTIAEQLNRSWLIRKCILEEFVIFQETQFCI 487
            +KL++M+  PD  G EYD+++ +I RDK++I+EQLNR+WL+RKCILEEF IFQETQF +
Sbjct: 416 REKLEAMKGKPDANGVEYDRIKMSITRDKKSISEQLNRAWLVRKCILEEFTIFQETQFML 475

Query: 488 THVFQEWAKMHVKYANETTESWEKV 512
           T  FQ+W+K++  +       WEK+
Sbjct: 476 TRAFQDWSKLNASFVGINLNEWEKL 500

>CAGL0J11704g 1138009..1139538 similar to sp|P40959 Saccharomyces
           cerevisiae YMR004w MVP1 required for vacuolar protein
           sorting, hypothetical start
          Length = 509

 Score =  466 bits (1198), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 216/446 (48%), Positives = 314/446 (70%), Gaps = 18/446 (4%)

Query: 85  LEQTVWG----APPSQLDASISG------------LDTSMAPVASQSSMCDELHS--EDL 126
           L +++WG      P+ ++  +              L+T++    S +S  +E +S  E L
Sbjct: 52  LTESIWGTERTGAPNNVETGLEAKDSLNVSTNFNELNTAILSPTSSTSNIEEQNSFTESL 111

Query: 127 ENWMNSRRKTYNPLAKNIVVVEEIPEREGILFKHTNYLVKHLVVLPNTNPSSNQTVIRRY 186
           E+W+N  RKTYNP   +I+ +EEIPEREG+LFKH NY VKHL+ LPNT P  N+TV+RRY
Sbjct: 112 ESWINEVRKTYNPQQLDIISIEEIPEREGLLFKHANYSVKHLIDLPNTEPPKNRTVVRRY 171

Query: 187 SDFNWLQEVLLKKYPFRMIPELPPKKIGAQNADPIFLARRRKGLCRFINLVIMHPVLKQD 246
           SDF WLQEVLLK+YPFRMIP+LPPKKIG+QN DP+FL +RR GL +FINLV+ HP L +D
Sbjct: 172 SDFLWLQEVLLKRYPFRMIPDLPPKKIGSQNLDPVFLNKRRIGLSKFINLVMKHPKLSKD 231

Query: 247 DLVLTFLTVPTDLGSWRKQANYDTTEEFTDQKIDKAFISLWHKELSNQWNKADAKIDELL 306
           DLVLTFLTVPTDL SWRKQ +YDT +EFTD++I K F+ +W K+L+  WN     IDEL+
Sbjct: 232 DLVLTFLTVPTDLTSWRKQVSYDTADEFTDKRISKDFVKIWKKDLAEIWNNTANCIDELI 291

Query: 307 ESWIKTSVLVERYERRMRQVSEERRLLGRVIEEFADNSVTLYPLEEGHLFHDINSHISTI 366
           + W K S+LV+R+E+R++ ++ ER+++  +I +  + + ++YP+++     DINS ++ I
Sbjct: 292 DKWTKISILVDRHEKRLQIIANERKIMNDLIHDVGNLTKSVYPIDQNPTILDINSGMTVI 351

Query: 367 SKHLNSLADTSKKERQEVEEHLSVKFKTFIDIIIALKGVFDRYKIMAGNNIAHLQRRVEI 426
           SKH+    +   ++  + ++ +  KF+ + DI+ ALK VF+RYK++A NN++ LQ+ +++
Sbjct: 352 SKHIEKTNENYNQQALDTKQKVLPKFRMYTDILRALKNVFERYKMLATNNVSMLQKHIDL 411

Query: 427 NMDKLQSMESNPDVKGAEYDKLRQTIQRDKRTIAEQLNRSWLIRKCILEEFVIFQETQFC 486
           N+ KL+ M+  PD  G EYD+++ TI++D++ + EQ NR+WLIR+CILEEF IFQETQF 
Sbjct: 412 NLQKLEDMKGKPDASGQEYDRIKTTIRKDRKIMYEQSNRAWLIRECILEEFTIFQETQFM 471

Query: 487 ITHVFQEWAKMHVKYANETTESWEKV 512
           IT  FQEWAK+   Y++     WE V
Sbjct: 472 ITGCFQEWAKVQSTYSSLNLNEWENV 497

>YMR004W (MVP1) [3969] chr13 (274017..275552) Protein required for
           sorting proteins to the vacuole, interacts genetically
           with Vps1p [1536 bp, 511 aa]
          Length = 511

 Score =  461 bits (1185), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 229/445 (51%), Positives = 319/445 (71%), Gaps = 14/445 (3%)

Query: 78  YEPGTPALEQTVWGAPPSQLDASISGLDTSMAP-VASQSSMCD---------ELHSEDLE 127
           + P    LE+++W    + L A+  G+  S  P +A+  ++ D         E    DL 
Sbjct: 59  FLPTNDVLEESIWDDSRNPLGAT--GM--SQTPNIAANETVIDKNDARDQNIEESEADLL 114

Query: 128 NWMNSRRKTYNPLAKNIVVVEEIPEREGILFKHTNYLVKHLVVLPNTNPSSNQTVIRRYS 187
           +W N+ RKTY PL  +I+++EEIPEREG+LFKH NYLVKHL+ LP+T+PS  +TV+RRYS
Sbjct: 115 DWTNNVRKTYRPLDADIIIIEEIPEREGLLFKHANYLVKHLIALPSTSPSEERTVVRRYS 174

Query: 188 DFNWLQEVLLKKYPFRMIPELPPKKIGAQNADPIFLARRRKGLCRFINLVIMHPVLKQDD 247
           DF WL+E+LLK+YPFRMIPELPPK+IG+QNAD +FL +RR GL RFINLV+ HP L  DD
Sbjct: 175 DFLWLREILLKRYPFRMIPELPPKRIGSQNADQLFLKKRRIGLSRFINLVMKHPKLSNDD 234

Query: 248 LVLTFLTVPTDLGSWRKQANYDTTEEFTDQKIDKAFISLWHKELSNQWNKADAKIDELLE 307
           LVLTFLTV TDL SWRKQA YDT+ EF D+KI + F+ +W KE + QWN+A + ID  +E
Sbjct: 235 LVLTFLTVRTDLTSWRKQATYDTSNEFADKKISQEFMKMWKKEFAEQWNQAASCIDTSME 294

Query: 308 SWIKTSVLVERYERRMRQVSEERRLLGRVIEEFADNSVTLYPLEEGHLFHDINSHISTIS 367
            W + ++L+ER+E+R+ Q+  ER     +++ F++ +  LYP+++     DIN+++S I 
Sbjct: 295 LWYRITLLLERHEKRIMQMVHERNFFETLVDNFSEVTPKLYPVQQNDTILDINNNLSIIK 354

Query: 368 KHLNSLADTSKKERQEVEEHLSVKFKTFIDIIIALKGVFDRYKIMAGNNIAHLQRRVEIN 427
           KHL + +   K+E +E+   LS KFK F DI+++L+ +F+RYKIMA NN+  LQR VE+N
Sbjct: 355 KHLETTSSICKQETEEISGTLSPKFKIFTDILLSLRSLFERYKIMAANNVVELQRHVELN 414

Query: 428 MDKLQSMESNPDVKGAEYDKLRQTIQRDKRTIAEQLNRSWLIRKCILEEFVIFQETQFCI 487
            +KL+SM+  PDV GAEYD++++ IQ+D+R+I EQ NR+WLIR+CILEEF IFQETQF I
Sbjct: 415 KEKLESMKGKPDVSGAEYDRIKKIIQKDRRSIIEQSNRAWLIRQCILEEFTIFQETQFLI 474

Query: 488 THVFQEWAKMHVKYANETTESWEKV 512
           T  FQ+WAK++  +A      WEK+
Sbjct: 475 TRAFQDWAKLNSNHAGLKLNEWEKL 499

>ACR074W [1121] [Homologous to ScYJL036W (SNX4) - SH]
           complement(496156..497388) [1233 bp, 410 aa]
          Length = 410

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 68/145 (46%), Gaps = 17/145 (11%)

Query: 182 VIRRYSDFNWLQEVLLKKYPFRMIPELPPKKI--GAQNADPIFLARRRKGLCRFINLVIM 239
           V RRYSDF  L ++L   YP  ++P LP KK+          F  +R   L  F+  +  
Sbjct: 55  VHRRYSDFVLLYQILANDYPACIVPPLPDKKVLNYLDRFSQSFTQKRCHSLQNFLQRLAQ 114

Query: 240 HPVLKQDDLVLTFLTVPTDLGSWRKQ-----ANYDTTEEFTDQKIDKAFISLWH------ 288
           HPVL Q  ++ TFL V +D  +++K       N    EE T + I  AF S+        
Sbjct: 115 HPVLSQSKILHTFL-VSSDWDAYQKSLAETVGNLSNKEELT-ETIMNAFKSVHSQSDEFV 172

Query: 289 --KELSNQWNKADAKIDELLESWIK 311
             KE S + +   +KID+L    +K
Sbjct: 173 EIKEKSGKLDHNVSKIDKLFHRVVK 197

>Scas_690.22
          Length = 428

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 94/207 (45%), Gaps = 28/207 (13%)

Query: 182 VIRRYSDFNWLQEVLLKKYPFRMIPELPPKK----IGAQNADPIFLARRRKGLCRFINLV 237
           V RRYSD   L ++L+  +P  +IP LP KK    I        F  +R   L  F+  V
Sbjct: 77  VHRRYSDLVLLHDILMNDHPTCIIPPLPDKKVLQYIAGDRFSQRFTQKRCHSLQNFLRRV 136

Query: 238 IMHPVLKQDDLVLTFLTVPTDLGSWRK--QANYDTT-EEFTDQKIDKAFISLW---HKEL 291
            +HP+L +  ++ TFL +  D  ++RK    N  T  EE TD     AF++ +   HK+ 
Sbjct: 137 SLHPILSKSKILETFL-IDADWDAYRKSLSGNIQTNKEEVTD-----AFMNAFKTVHKQ- 189

Query: 292 SNQWNKADAKIDELLESWIKTSVLVERYERRMRQVSEERRLLGRVIEEF-----ADNSVT 346
           S ++ +   K D+L  +  K      +  ++   +SE+   L + +++       DN   
Sbjct: 190 SEEFVEIKEKSDKLDHTLSKLDKNFHKMTKKNESISEDYGKLEQTLQDLNELISGDNE-- 247

Query: 347 LYPLEEGHLFHDINSHISTISKHLNSL 373
             PL  G      N  I+ +S  LN L
Sbjct: 248 --PL--GRKLKFFNEGITQLSYGLNDL 270

>Scas_663.19
          Length = 169

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 61/122 (50%), Gaps = 11/122 (9%)

Query: 137 YNPLAKNIVVVEE--IPEREGILFKHTNYLVKHLVVLPNTNPSSNQTVIRRYSDFNWLQE 194
           +NP+  N   + +  IP  +  +F  T+Y +     LPN   S N  V RRYSDF + ++
Sbjct: 40  HNPITHNSNGLGDVRIPNGDQNMF--TDYEIVCHTNLPNFK-SRNSKVRRRYSDFEFFKK 96

Query: 195 VLLKK------YPFRMIPELPPKKIGAQNADPIFLARRRKGLCRFINLVIMHPVLKQDDL 248
            LLK+      +P  MIP LP K       +P  +  R +GL +++  V  HP+L+    
Sbjct: 97  CLLKEISMFTNHPRIMIPHLPGKIFLNNRFNPEVIEERMQGLDKWLKTVAGHPLLQSGSK 156

Query: 249 VL 250
           VL
Sbjct: 157 VL 158

>Kwal_23.2896
          Length = 421

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 50/99 (50%), Gaps = 8/99 (8%)

Query: 173 NTNPSSNQTVI---RRYSDFNWLQEVLLKKYPFRMIPELPPKK----IGAQNADPIFLAR 225
           NT P     +I   RRYSDF  LQ +L + +P  +IP LP KK    I        F  +
Sbjct: 58  NTTPLEEIDIIVVHRRYSDFLLLQSILSQDHPTCVIPPLPDKKVFQYIAGDRFSQSFTQK 117

Query: 226 RRKGLCRFINLVIMHPVLKQDDLVLTFLTVPTDLGSWRK 264
           R   L  F+  +  HP+L +  +++TFL +  D  ++R+
Sbjct: 118 RCHSLQNFLRRISEHPILSKSQVLMTFL-MSNDWEAYRR 155

>ADR390C [2131] [Homologous to ScYOR357C (GRD19) - SH]
           (1410245..1410736) [492 bp, 163 aa]
          Length = 163

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 33/96 (34%), Positives = 51/96 (53%), Gaps = 6/96 (6%)

Query: 160 HTNYLVKHLVVLPNTNPSSNQTVIRRYSDFNWLQEVLLKK-----YPFRMIPELPPKKIG 214
           +T+YLV     LP+  P     V RRYSDF + +  L K+     +P  +IP LP K + 
Sbjct: 58  YTDYLVVCRTNLPSF-PQRVSHVRRRYSDFEFFKRCLFKELSLSAHPRVVIPALPGKILW 116

Query: 215 AQNADPIFLARRRKGLCRFINLVIMHPVLKQDDLVL 250
           A+      +  RR+GL ++++ V  HP+L+    VL
Sbjct: 117 ARRFHDEVIEERREGLAQWLSTVAGHPLLQSGSKVL 152

>YOR069W (VPS5) [4876] chr15 (453769..455796) Member of the sorting
           nexin family involved in Golgi retention and vacuolar
           sorting [2028 bp, 675 aa]
          Length = 675

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 70/272 (25%), Positives = 107/272 (39%), Gaps = 65/272 (23%)

Query: 182 VIRRYSDFNWLQEVLLKKYPFRMIPELPPKKIGAQNADPIFLARRRKGLCRFINLVIMHP 241
           V RRY DF WL   L   +  ++IP  PP+K    +    F+  RR  +   +  +   P
Sbjct: 317 VSRRYRDFRWLYRQLQNNHWGKVIPP-PPEKQSVGSFKENFIENRRFQMESMLKKICQDP 375

Query: 242 VLKQDDLVLTFLTVPTDLGSWRKQANY---------------------------DTTEEF 274
           VL++D   L FLT   D  S  K+  +                           D  E  
Sbjct: 376 VLQKDKDFLLFLT-SDDFSSESKKRAFLTGSGAINDSNDLSEVRISEIQLLGAEDAAEVL 434

Query: 275 TDQKID----KAFISLWHKELSNQWNKAD-------AKIDELLESWIKTSVLVERYERRM 323
            +  ID    K F+S+    L  ++N+AD        KIDEL ++  K S       + +
Sbjct: 435 KNGGIDAESHKGFMSISFSSLP-KYNEADEFFIEKKQKIDELEDNLKKLS-------KSL 486

Query: 324 RQVSEERRLLGRVIEEFADNSVTLYPLEEGHLFHDINSHISTISKHLNSLADTSKK---- 379
             V   R  L    EEF+    TL  L       + NS +      LN+ AD  K     
Sbjct: 487 EMVDTSRNTLAASTEEFSSMVETLASLN----VSEPNSEL------LNNFADVHKSIKSS 536

Query: 380 -ERQEVEEHLS--VKFKTFIDIIIALKGVFDR 408
            ER  ++E L+  V    +I  + ++K +F++
Sbjct: 537 LERSSLQETLTMGVMLDDYIRSLASVKAIFNQ 568

>KLLA0C10967g 943312..944514 similar to sp|P47057 Saccharomyces
           cerevisiae YJL036w SNX4 singleton, hypothetical start
          Length = 400

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 46/87 (52%), Gaps = 5/87 (5%)

Query: 182 VIRRYSDFNWLQEVLLKKYPFRMIPELPPKKI----GAQNADPIFLARRRKGLCRFINLV 237
           V+RRY+DF  L ++L+  +P  ++P LP KK+            F  +R + L  F+  +
Sbjct: 52  VVRRYNDFVLLHQILINDHPALLVPPLPDKKVLNYLSGDRFSHSFTQKRCRSLQTFMRRL 111

Query: 238 IMHPVLKQDDLVLTFLTVPTDLGSWRK 264
           + H  L +  ++ TFLT  TD   +R+
Sbjct: 112 LSHSELSKSRILETFLT-STDWDVYRR 137

>CAGL0G06424g complement(621136..621630) highly similar to sp|Q08826
           Saccharomyces cerevisiae YOR357c GRD19, hypothetical
           start
          Length = 164

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 6/96 (6%)

Query: 160 HTNYLVKHLVVLPNTNPSSNQTVIRRYSDFNWLQEVLLKKY-----PFRMIPELPPKKIG 214
           +T+Y +     LPN +  +++ V RRYSDF + ++ LLK+      P  ++P LP K   
Sbjct: 59  YTDYEIICRTNLPNFHKRASR-VRRRYSDFEFFRKCLLKEISMLNNPRVVVPHLPGKIYL 117

Query: 215 AQNADPIFLARRRKGLCRFINLVIMHPVLKQDDLVL 250
           +       +  RR+GL R++ +V  HP+L+     L
Sbjct: 118 SNRFSDEVIEERRQGLNRWMQIVAGHPLLQSGSKTL 153

>YJL036W (SNX4) [2875] chr10 (378741..380012) Putative nexin sorting
           protein, possibly involved in proteasome function [1272
           bp, 423 aa]
          Length = 423

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 84/184 (45%), Gaps = 20/184 (10%)

Query: 175 NPSSNQTVIRRYSDFNWLQEVLLKKYPFRMIPELPPKK----IGAQNADPIFLARRRKGL 230
           +P S   V RRYSD   L ++LL ++P  +IP LP KK    I        F  +R   L
Sbjct: 68  DPESIIVVHRRYSDLLLLHDILLNRFPTCIIPPLPDKKVFQYIAGDRFSQRFTQKRCHSL 127

Query: 231 CRFINLVIMHPVLKQDDLVLTFLTVPTDLGSWRK------QANYD-TTEEF-----TDQK 278
             F+  V +HP L Q  +  TFL V  D  S RK      Q N D  T+ F     T  K
Sbjct: 128 QNFLRRVSLHPDLSQSKVFKTFL-VSKDWESHRKVLQDSLQPNKDEVTDAFMNAFKTVHK 186

Query: 279 IDKAFISLWHKELSNQWNKADAKIDELLESWI-KTSVLVERYERRMRQVSEERRLLGRVI 337
            ++ F  +  +E S++ ++   KID+L    + K   + E Y +    + E + L+    
Sbjct: 187 QNEEFTEI--REKSDKLDRTVTKIDKLFHKVVKKNDSMSEDYTKLGSNLQELQELVTGEN 244

Query: 338 EEFA 341
           EE A
Sbjct: 245 EELA 248

>YOR357C (GRD19) [5134] chr15 complement(1009220..1009708) Protein
           involved in retrieval of late Golgi membrane proteins
           from the prevacuolar compartment [489 bp, 162 aa]
          Length = 162

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 5/75 (6%)

Query: 182 VIRRYSDFNWLQEVLLKK-----YPFRMIPELPPKKIGAQNADPIFLARRRKGLCRFINL 236
           V RRYSDF + ++ L+K+     +P  M+P LP K + +       +  RR+GL  ++  
Sbjct: 78  VRRRYSDFEFFRKCLIKEISMLNHPKVMVPHLPGKILLSNRFSNEVIEERRQGLNTWMQS 137

Query: 237 VIMHPVLKQDDLVLT 251
           V  HP+L+    VL 
Sbjct: 138 VAGHPLLQSGSKVLV 152

>CAGL0J01001g 98637..99929 similar to sp|P47057 Saccharomyces
           cerevisiae YJL036w SNX4, hypothetical start
          Length = 430

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 82/367 (22%), Positives = 154/367 (41%), Gaps = 57/367 (15%)

Query: 182 VIRRYSDFNWLQEVLLKKYPFRMIPELPPKK----IGAQNADPIFLARRRKGLCRFINLV 237
           V RRY+D   L ++L   +P  +IP LP KK    I        F  RR   L  F+  V
Sbjct: 80  VHRRYNDVVLLHDILQNDHPTCIIPPLPDKKVLQYIAGDRFGRRFTQRRCHSLQNFLRRV 139

Query: 238 IMHPVLKQDDLVLTFLTVPTDLGSWRKQANYDTTEEFTDQKIDKAFISLWHK-------- 289
             HP+L    ++  FL V  +  ++RK     T +    + +  A ++ + K        
Sbjct: 140 SQHPILSTSKVLEIFL-VGNEWDTYRKNI-AGTLQNAQKEDVTDAVMNAFKKVHNQNEEF 197

Query: 290 -ELSNQWNKADAKIDELLESW----IKTSVLVERYERRMRQVSEERRLLGRVIEEFADN- 343
            E+ ++ +K D  ++ + + +     K   ++E Y +    + E + L+    ++ AD+ 
Sbjct: 198 TEIRDRSDKLDNSVNRINKVFHRVVKKNEAIIEDYSKLGLTLQELQELVSSDNDKLADSL 257

Query: 344 -----SVTL--YPLEEGHLFHDIN--------SHISTISKHLNSLADTSKKERQEVEEHL 388
                 VT   Y L++ ++F D          SH     K    L D  + + +E+ ++L
Sbjct: 258 KVFIEGVTQFSYGLQDLNMFIDYEYLIDLKDLSHYIGSMKQTMRLKDQKQIDYEELSDYL 317

Query: 389 SVKFKTFIDIIIALKG---VFDRYKIMAGNNIAHLQRRVEINMDKLQSMESNPDVKGAEY 445
           +   K   ++I    G   +  + + +AG N     RR +IN  KL+S  S+   +    
Sbjct: 318 TKSIKEKNNLISGYGGGNFLTSKLEELAGYN-QEASRRDKIN--KLESTISSLTTELETA 374

Query: 446 DKLRQTIQRDKRTIAEQLNRSWLIRKCILEEFVIFQETQFCITHVFQEWAKMHVKYANET 505
            K+  T +++  T+ E            +++F   +  +  I+      A  ++K+    
Sbjct: 375 KKVADTFEQE--TLKE------------VKKFEEIKNDELKIS--LNNLADENIKFYERM 418

Query: 506 TESWEKV 512
            E+WEKV
Sbjct: 419 LETWEKV 425

>CAGL0I01144g 95410..95931 similar to sp|P38815 Saccharomyces
           cerevisiae YHR105w, start by similarity
          Length = 173

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 48/97 (49%), Gaps = 15/97 (15%)

Query: 172 PNTNPSSNQTVIRRYSDFNWLQEVLL----KKYPFRM--IPELPPK-------KIGAQNA 218
           PN++ S      +RYSDF   +  LL     K P  +  IPELPP        K    N 
Sbjct: 73  PNSSGSYRIHTYKRYSDFVEFRNALLDRVRTKRPASVSEIPELPPPVKWYYSWKYNEINL 132

Query: 219 DPIFLARRRKGLCRFINLVIMHP--VLKQDDLVLTFL 253
           +  +LA RRKGL  FIN V+++   V    DLV+ FL
Sbjct: 133 NKEWLANRRKGLELFINQVLLNGNIVDIAKDLVIQFL 169

>ADR211W [1952] [Homologous to ScYOR069W (VPS5) - SH; ScYKR078W -
           SH] complement(1072310..1074112) [1803 bp, 600 aa]
          Length = 600

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 88/398 (22%), Positives = 150/398 (37%), Gaps = 62/398 (15%)

Query: 158 FKHTNYLVKHLVVLPNTNPSSNQTVIRRYSDFNWLQEVLLKKYPFRMIPELPPK-KIGAQ 216
           F H  Y V+    L      +  +V RRY DF WL   L   +  ++IP  P K K+G  
Sbjct: 219 FSHVEYSVRTRSPLVG---DAEVSVQRRYRDFRWLYRQLQSNHWGKVIPPPPDKQKVGRF 275

Query: 217 NADPIFLARRRKGLCRFINLVIMHPVLKQDDLVLTFLTVPTDLGSWRKQANYDTTEEFTD 276
             D  F+  RR  + R +  +  +  L+ D   L FLT  T+     K+    T    + 
Sbjct: 276 KQD--FIENRRFQMERMLQRIAQNAALQNDQDFLLFLT-STNFVQDSKEREQATGSRASS 332

Query: 277 QKIDKAFISLWHKELSNQWNKADAKIDELLES------WIKTSVLVERY----------- 319
              D + I L    L    +      +  LES         +   V +Y           
Sbjct: 333 DSNDLSEIHLSELTLLGPDDAESVIRNGGLESDTGSLFMSLSFSSVPKYTEPDTFIMEKR 392

Query: 320 ------ERRMRQ-------VSEERRLLGRVIEEFADNSVTLYPLEEGHLFHDINSHISTI 366
                 E ++RQ       V  ++  L  VI+EFA    +L  LE       I S+ + +
Sbjct: 393 QHIDVMEEQLRQMYKSLELVDSQKNELVSVIKEFAATINSLVELEASKRISSILSNFAEV 452

Query: 367 SKHLNSLADTSKKERQEVEEHLSVKFKTFIDIIIALKGVFDR------YKIMAGNNI--- 417
             HL  +    +   Q+    L V    ++  + ++K VF++      Y ++  +++   
Sbjct: 453 --HLRIMESLQRTSLQD-SLTLGVTIDEYLRSLGSIKAVFNQRAKLGYYLVIVESDLHKK 509

Query: 418 -AHLQRRVEINMDKLQSMESNPDVKGAEYDKLRQTIQRDKRTIAEQLNRSWLIRKCILEE 476
            AHLQ        KL +   +P  K A   +    +QR  +TI +       I + + +E
Sbjct: 510 QAHLQ--------KLTTSGKSPTDKAAAAKQELANLQRRHKTIKDHWEH---IAETLRDE 558

Query: 477 FVIFQETQFC-ITHVFQEWAKMHVKYANETTESWEKVY 513
              + E +     +  + + +  ++   E  E WE  Y
Sbjct: 559 LAAYSEAKITDFRNNLEIYLESAIETQKECIELWETFY 596

>YDL113C (ATG20) [756] chr4 complement(256633..258555) Protein that
           may play a role in vesicular transport, has similarity
           to human SNX1 [1923 bp, 640 aa]
          Length = 640

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (70%)

Query: 179 NQTVIRRYSDFNWLQEVLLKKYPFRMIPELPPKK 212
           N TV RRYSDF  L+ +L++ +P  +IP +P K+
Sbjct: 186 NSTVQRRYSDFESLRSILIRLFPMTLIPPIPEKQ 219

>Scas_580.3
          Length = 183

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 43/82 (52%), Gaps = 10/82 (12%)

Query: 184 RRYSDFNWLQEVLLKKYPFRM-IPELPPK-------KIGAQNADPIFLARRRKGLCRFIN 235
           +RYSDF   +  ++ K   RM IP LPP        K    N D  +LA+RR+GL RF+ 
Sbjct: 102 KRYSDFVAFRNSIMNKLGDRMEIPSLPPGVPWYDSWKYQDVNFDKKWLAKRRRGLERFLE 161

Query: 236 LVIM--HPVLKQDDLVLTFLTV 255
            V++    VL   + + TFL +
Sbjct: 162 QVLLDRELVLLAKNEIRTFLGL 183

>Sklu_1971.4 YHR105W, Contig c1971 6476-6973
          Length = 165

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 10/69 (14%)

Query: 182 VIRRYSDFNWLQEVLLKKYPFRM---IPELPPK-------KIGAQNADPIFLARRRKGLC 231
           + +RYSDF  L+  L++  P  +   IP LPPK       +    N D  +LA+RR GL 
Sbjct: 80  LYKRYSDFENLRNRLIQALPSELHQSIPSLPPKVRWYESWRYQDVNFDKKWLAKRRAGLE 139

Query: 232 RFINLVIMH 240
            F+N V+++
Sbjct: 140 YFLNQVLLN 148

>Scas_322.2
          Length = 176

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 10/69 (14%)

Query: 182 VIRRYSDFNWLQEVLLKKYPFRM---IPELPPK-------KIGAQNADPIFLARRRKGLC 231
           + +RYSDF  L+  L++  P  +   IP LPPK       +    N D  +LA+RR GL 
Sbjct: 91  LYKRYSDFENLRNRLIQALPSELHQSIPSLPPKVRWYESWRYQDVNFDKKWLAKRRAGLE 150

Query: 232 RFINLVIMH 240
            F+N V+++
Sbjct: 151 YFLNQVLLN 159

>KLLA0F16643g 1533628..1535625 similar to sp|Q92331 Saccharomyces
           cerevisiae YOR069w VPS5 involved in Golgi retention and
           vacuolar sorting, start by similarity
          Length = 665

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 182 VIRRYSDFNWLQEVLLKKYPFRMIPELPPKKIGAQNADPIFLARRRKGLCRFINLVIMHP 241
           V RRY DF WL   L   +  ++IP  PP+K         F+  RR  + R +  +  + 
Sbjct: 306 VKRRYRDFRWLYRQLQHNHWGKIIPP-PPEKQAVGRFKQDFIENRRAQMERMLQHIASNH 364

Query: 242 VLKQDDLVLTFLT 254
           VL++D+  + FLT
Sbjct: 365 VLQKDEDFILFLT 377

>Kwal_23.3438
          Length = 614

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 40/76 (52%), Gaps = 11/76 (14%)

Query: 138 NPLAKN-IVVVEEIPEREGILFKHTNYLVKHLVVLPNTNPSSNQTVIRRYSDFNWLQEVL 196
            PL+ + + ++E     EG    +  Y +K+           ++ V RRYSDF  L+++L
Sbjct: 134 GPLSGDKVYILEASKASEGQGRTYIAYTIKY----------GDKVVKRRYSDFESLRKIL 183

Query: 197 LKKYPFRMIPELPPKK 212
           +K +P  +IP +P K+
Sbjct: 184 IKLFPMSLIPPIPEKQ 199

>CAGL0H10428g 1016374..1018635 similar to tr|Q07528 Saccharomyces
           cerevisiae YDL113c, hypothetical start
          Length = 753

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 54/112 (48%), Gaps = 14/112 (12%)

Query: 101 ISGLDTSMAPVASQSSMCDELHSEDLENWMNSRRKTYNPLAKNIVVVEEIPEREGILFKH 160
           +S  DT+     S S+    L++ +++++ N+ +       K++ ++E     EG     
Sbjct: 249 VSNTDTNKHSKESSSA----LNNANMKSFGNAVKSYTKKSGKHVRILEAKKVSEGQSRTF 304

Query: 161 TNYLVKHLVVLPNTNPSSNQTVIRRYSDFNWLQEVLLKKYPFRMIPELPPKK 212
             Y +K+          +   V RRYSDF  L+ +L+K +P  +IP +P K+
Sbjct: 305 VAYFIKY----------NGHMVRRRYSDFESLRSILVKLFPLMVIPPIPEKE 346

>CAGL0L10472g 1117867..1119783 similar to sp|Q92331 Saccharomyces
           cerevisiae YOR069w, start by similarity
          Length = 638

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 71/167 (42%), Gaps = 15/167 (8%)

Query: 105 DTSMAPVASQSSMCDELHSEDLENWMNSRRKTYNPLAKNIVVVEEIPEREGILFK-HTNY 163
           +T + P  S  +  +E   +D+E+          P+  +  +    P + G L   H  Y
Sbjct: 210 NTDITPTESVHNKTEEASQQDIED---------EPVISHFQIEVTDPIKVGELTSSHIKY 260

Query: 164 LVKHLVVLPNTNPSSNQTVIRRYSDFNWLQEVLLKKYPFRMIPELPPKKIGAQNADPIFL 223
            V     L   +P+ NQ V RRY DF WL   L   +  ++IP  PP+K       P F+
Sbjct: 261 TVNAESEL--LSPNQNQ-VSRRYRDFRWLYRQLQNNHWGKVIPP-PPEKQTVGTFQPEFV 316

Query: 224 ARRRKGLCRFINLVIMHPVLKQDDLVLTFLTVPTDLGSWRKQANYDT 270
             RR  L   +  +     L++D+    FLT   +     K+ +Y+T
Sbjct: 317 ETRRLQLQTMLRRIANDSDLQRDEHFHMFLT-SDNFAEDSKRVSYET 362

>Kwal_26.6858
          Length = 160

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 5/75 (6%)

Query: 182 VIRRYSDFNWLQEVLLKK-----YPFRMIPELPPKKIGAQNADPIFLARRRKGLCRFINL 236
           V RRYS+F   ++ L+K+     +P  ++P LP K +     +   +  R++GL +++  
Sbjct: 76  VRRRYSEFELFRKCLIKELSLSSHPKVVVPHLPGKILLGNRFNDEVIEERKQGLNKWLVA 135

Query: 237 VIMHPVLKQDDLVLT 251
           V  HP+L+    VL 
Sbjct: 136 VAGHPLLQSGSKVLV 150

>KLLA0E09141g complement(817829..819739) similar to sgd|S0002271
           Saccharomyces cerevisiae YDL113c, start by similarity
          Length = 636

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 23/31 (74%)

Query: 182 VIRRYSDFNWLQEVLLKKYPFRMIPELPPKK 212
           V RRYSDF  L++VL+K +P  +IP +P K+
Sbjct: 193 VKRRYSDFESLRKVLVKLFPISLIPPIPEKQ 223

>Sklu_2428.6 YOR069W, Contig c2428 9095-11038 reverse complement
          Length = 647

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 41/95 (43%), Gaps = 4/95 (4%)

Query: 160 HTNYLVKHLVVLPNTNPSSNQTVIRRYSDFNWLQEVLLKKYPFRMIPELPPKKIGAQNAD 219
           H  Y VK      N    S   V RRY DF WL   L      R+IP  PP+K       
Sbjct: 268 HVEYTVK---TKSNAIQPSECQVKRRYRDFRWLYRQLQNNNWGRIIPP-PPEKQTVGRFK 323

Query: 220 PIFLARRRKGLCRFINLVIMHPVLKQDDLVLTFLT 254
             F+  RR  + R +  +    +L++D+  + FLT
Sbjct: 324 EDFIESRRFQMERMLKKISSDSILQKDEDFIMFLT 358

>Kwal_55.21533
          Length = 159

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 10/78 (12%)

Query: 182 VIRRYSDFNWLQEVLLKKYPFRM---IPELPPK-------KIGAQNADPIFLARRRKGLC 231
           + +RYSDF   +E L+     ++   IP LPPK       +    N    +LARRR GL 
Sbjct: 74  IYKRYSDFVRFREELMATLSPKLRTGIPALPPKLSWFDSWRYDDANFKSAWLARRRAGLE 133

Query: 232 RFINLVIMHPVLKQDDLV 249
            F+N V+++  L  + L 
Sbjct: 134 FFLNQVLLNDSLLVEALA 151

>Sklu_2219.2 YDL113C, Contig c2219 4054-5958
          Length = 634

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 24/32 (75%)

Query: 181 TVIRRYSDFNWLQEVLLKKYPFRMIPELPPKK 212
           TV RRYS+F  L+++L+K +P  +IP +P K+
Sbjct: 188 TVRRRYSEFESLRKILVKLFPMTLIPPIPEKQ 219

>YHR105W (YPT35) [2393] chr8 (324768..325412) Protein that may play
           a role in vesicular transport, has similarity to Grd19p,
           bacterial helix-turn-helix regulator protein of the argR
           group, and human SNX1 [645 bp, 214 aa]
          Length = 214

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 47/87 (54%), Gaps = 17/87 (19%)

Query: 184 RRYSDFNWLQEVLLKKY----PFRM----IPELPPK-------KIGAQNADPIFLARRRK 228
           +RYSDF  L+E LL +     P ++    IP LPP        K    N +  +LA+R++
Sbjct: 121 KRYSDFVRLRENLLTRIKTAKPEKLNCLQIPHLPPSVQWYSSWKYQEVNLNKDWLAKRQR 180

Query: 229 GLCRFINLVIMHPVLKQ--DDLVLTFL 253
           GL  F+N +I++  L +   D+++ FL
Sbjct: 181 GLEYFLNHIILNSSLVEMTKDILIQFL 207

>ADR192C [1933] [Homologous to ScYDR425W - SH] (1037233..1039044)
           [1812 bp, 603 aa]
          Length = 603

 Score = 36.6 bits (83), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 10/63 (15%)

Query: 182 VIRRYSDFNWLQEVLLKKYPFRMIPELPPKK---------IGAQNADPIFLARRRKGLCR 232
           V RRYS+F+ L++ L +  P  +IP +P K          + A+N D   + +RR+ L R
Sbjct: 156 VTRRYSEFDSLRQALARLLPTVIIPPIPSKHPLIRYFLNPLNAEN-DIRIIEKRRRLLSR 214

Query: 233 FIN 235
           F+N
Sbjct: 215 FLN 217

>Scas_613.21
          Length = 649

 Score = 36.6 bits (83), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%)

Query: 182 VIRRYSDFNWLQEVLLKKYPFRMIPELPPKK 212
           V RRYSDF  L+ VL++ +P  +IP +P K+
Sbjct: 204 VRRRYSDFESLRNVLVRLFPITLIPPIPEKE 234

>Sklu_2167.4 YGL212W, Contig c2167 6607-7656 reverse complement
          Length = 349

 Score = 35.4 bits (80), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 13/94 (13%)

Query: 181 TVIRRYSDFNWLQEVLLKKYPFRMIPELPPKKIG-----AQNADPIFLARRRKGLCRFIN 235
           TV RR+S+F  L++ L +++   +  ELPP+  G     + + DP  +  R+  L  F+ 
Sbjct: 42  TVSRRFSEFVSLKKQLEQEFNAELPYELPPRHYGFWNKSSHSCDPQVIQERKSKLSTFL- 100

Query: 236 LVIMHPVL----KQDDLVLTFLTVPTDLGSWRKQ 265
           L +++       K+   +  FL +P   G+W  Q
Sbjct: 101 LDLLNDSFDTRWKKSPFLCHFLQLP---GNWDTQ 131

>Sklu_2221.5 YDR425W, Contig c2221 7089-9104
          Length = 671

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 10/66 (15%)

Query: 179 NQTVIRRYSDFNWLQEVLLKKYPFRMIPELPPKK---------IGAQNADPIFLARRRKG 229
           N+ V RRYS+F+ L++ L +  P  +IP +P K          + A+N D   + +R++ 
Sbjct: 206 NKQVTRRYSEFDTLRQALCRLLPSVIIPPIPSKHPLIKYFLNPLNAEN-DVKIIDKRKRL 264

Query: 230 LCRFIN 235
           L  F+N
Sbjct: 265 LTSFLN 270

>Scas_698.32
          Length = 699

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 45/110 (40%), Gaps = 5/110 (4%)

Query: 146 VVEEIPEREGILFK-HTNYLVKHLVVLPNTNPSSNQTVIRRYSDFNWLQEVLLKKYPFRM 204
           +V + P + G L   H  Y+V   V       S    V RRY DF WL   L   +  ++
Sbjct: 303 IVVKDPRKVGELTSAHIEYMV---VAEAKILESGCSIVYRRYRDFRWLYRQLQNNHWGKI 359

Query: 205 IPELPPKKIGAQNADPIFLARRRKGLCRFINLVIMHPVLKQDDLVLTFLT 254
           IP  PP+K         F+  RR  +   +  +     L+ D   + FLT
Sbjct: 360 IPP-PPEKQAVGRFKQDFIENRRLQMENMLQTIASSDSLQNDSDFILFLT 408

>Kwal_55.21745
          Length = 629

 Score = 33.1 bits (74), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 182 VIRRYSDFNWLQEVLLKKYPFRMIPELPPKKIGAQNADPIFLARRRKGLCRFINLVIMHP 241
           V RRY DF WL   L   +  ++IP  P K+   +  D  F+  RR  + R +  +    
Sbjct: 272 VQRRYRDFRWLYRQLQNNHWGKIIPPPPEKQTVGRFKDD-FIENRRFQMERMLTKISQDK 330

Query: 242 VLKQDDLVLTFL 253
            L++D   + FL
Sbjct: 331 DLQEDVDFVMFL 342

>Sklu_2404.3 YOR357C, Contig c2404 1457-1948
          Length = 163

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 188 DFNWLQEVLLKK-----YPFRMIPELPPKKIGAQNADPIFLARRRKGLCRFINLVIMHPV 242
           DF + ++ L+K+     +P  ++P LP K + +   +   +  RR+GL +++  V  HP+
Sbjct: 85  DFEFFRKCLVKELALSSHPRVVVPHLPGKILLSNRFNDEIIEERRQGLQQWLLNVAGHPL 144

Query: 243 LKQDDLVLT 251
           L+    VL 
Sbjct: 145 LQSGSKVLV 153

>Kwal_47.19079
          Length = 345

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 8/84 (9%)

Query: 183 IRRYSDFNWLQEVLLKKYPFRMIPELPPKKIG-----AQNADPIFLARRRKGLCRFINLV 237
            RR+SDF  L++ L ++    +  ELPP++       + + DP  +  R K L  F++ +
Sbjct: 45  FRRFSDFVKLKKDLEQEVGSELPYELPPRRFNKWMRPSGSCDPDVIEERVKELSTFLHDL 104

Query: 238 I---MHPVLKQDDLVLTFLTVPTD 258
           +        K+   V  FL +P+D
Sbjct: 105 LNDSFDTRWKKSPYVCHFLQIPSD 128

>Scas_712.33
          Length = 357

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 43/94 (45%), Gaps = 12/94 (12%)

Query: 182 VIRRYSDFNWLQEVLLKKYPFRMIPELPPKKIG---------AQNADPIFLARRRKGLCR 232
           + +R+S+F  L+  L K++   +  ELP +  G           + DP+    RR  L +
Sbjct: 52  IYKRFSEFLELKRRLEKEFNSELPYELPSRHHGPIFNVWTRSTTSIDPVITEERRIQLAK 111

Query: 233 FINLVI---MHPVLKQDDLVLTFLTVPTDLGSWR 263
           F++ ++        K  +LV  FL +P +   +R
Sbjct: 112 FVSDMLNDSFDTKWKNSELVRVFLQLPLNWNDYR 145

>Scas_714.58
          Length = 636

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 10/63 (15%)

Query: 182 VIRRYSDFNWLQEVLLKKYPFRMIPELPPKK---------IGAQNADPIFLARRRKGLCR 232
           V RRYS+F+ L +VL +  P  +IP +P K          I   N   I   R+RK    
Sbjct: 197 VTRRYSEFDSLYQVLKRLLPTIVIPPIPTKHPLINYLINPINVNNDTKIIDKRKRK-FNS 255

Query: 233 FIN 235
           F+N
Sbjct: 256 FLN 258

>Kwal_47.18601
          Length = 622

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 22/34 (64%)

Query: 178 SNQTVIRRYSDFNWLQEVLLKKYPFRMIPELPPK 211
           + + V+RRYS+F+ L+  L +  P  ++P +P K
Sbjct: 149 AGKHVVRRYSEFDTLRHALHRLLPTVIVPPIPSK 182

>KLLA0C15543g 1349181..1352129 similar to sgd|S0006301 Saccharomyces
           cerevisiae YPR097w, start by similarity
          Length = 982

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 159 KHTNYLVKHLVVLPNTNPSSNQTVIRRYSDFNWLQEVLLKKYPFRMIPELPPK-KIGA 215
           +H +Y    ++ +   +P++   V + Y DF  L + L   YP + +P+LP K KI A
Sbjct: 265 RHQSYF---MIRVRKEDPATTVFVYKTYEDFKRLAKDLKTGYPGKKLPQLPHKNKIQA 319

>KLLA0A03718g 334828..335322 similar to sp|Q08826 Saccharomyces
           cerevisiae YOR357c GRD19 singleton, start by similarity
          Length = 164

 Score = 29.3 bits (64), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 6/79 (7%)

Query: 188 DFNWLQEVLLKK-----YPFRMIPELPPKKIGAQNADPIFLARRRKGLCRFINLVIMHPV 242
           DF   +++L+K+     +P   +  LP K + +       +  RR+GL +++  V  HP+
Sbjct: 86  DFELFRKLLIKELQLSNHPKVSVQHLPGKILLSNRFSDAVIEERRQGLNKWLASVAGHPL 145

Query: 243 LKQDDLVLT-FLTVPTDLG 260
           L+    VL  F+  PT  G
Sbjct: 146 LQTGSKVLVRFIQDPTFQG 164

>KLLA0E03850g complement(358995..362393) weakly similar to sp|P53280
            Saccharomyces cerevisiae YGR134w CAF130 hypothetical
            protein singleton, start by similarity
          Length = 1132

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 7/82 (8%)

Query: 276  DQKIDKAFISLWHKELSNQWNKADAKIDELLESWIKTSVLVERYERRMRQVSEERRLLGR 335
            DQ +   F  L   ++ ++W   D + D  +E+  KTS++ ER+ R +   S    L G+
Sbjct: 1004 DQLLPVDFDKLKLSDIDDRW---DTETDTSIENGDKTSIMSERFSRMLPVQS----LDGQ 1056

Query: 336  VIEEFADNSVTLYPLEEGHLFH 357
             +++   + +  YPL EG   H
Sbjct: 1057 PVDKVFRHLLQKYPLTEGTPIH 1078

>CAGL0F00957g 102956..104791 similar to sp|P31383 Saccharomyces
           cerevisiae YAL016w TPD3, hypothetical start
          Length = 611

 Score = 29.3 bits (64), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 307 ESWIKTSVLVERYERRMRQVSEERRLLGRVIEEFADNSVTLYPLEEGHLFHDINSHISTI 366
           E+W    ++ E++E    ++S+  +++  ++E F    ++L    EG +   I  H+S  
Sbjct: 268 EAWRVRYMVAEKFEDLADEISQLDKVVDHLLEPF----LSLCEDNEGDVRKAIAGHVSGF 323

Query: 367 SKHL 370
           SKH+
Sbjct: 324 SKHI 327

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.131    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,922,669
Number of extensions: 719117
Number of successful extensions: 2601
Number of sequences better than 10.0: 97
Number of HSP's gapped: 2652
Number of HSP's successfully gapped: 100
Length of query: 514
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 408
Effective length of database: 12,926,601
Effective search space: 5274053208
Effective search space used: 5274053208
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)